Advanced Search (OLGA)

Gene: Ubl3 (ubiquitin-like 3) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Ubl3

Name:

ubiquitin-like 3

RGD ID:

1305431

Description:

Predicted to be located in plasma membrane. Orthologous to human UBL3 (ubiquitin like 3); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 4,4'-sulfonyldiphenol.

Type:

protein-coding (Ensembl: lncRNA)

RefSeq Status:

VALIDATED

Previously known as:

LOC363869; membrane-anchored ubiquitin-fold protein; MGC109350; MUB; ubiquitin-like protein 3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	UBL3 (ubiquitin like 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ubl3 (ubiquitin-like 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ubl3 (ubiquitin like 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	UBL3 (ubiquitin like 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	UBL3 (ubiquitin like 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ubl3 (ubiquitin like 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	UBL3 (ubiquitin like 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	UBL3 (ubiquitin like 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ubl3 (ubiquitin like 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	UBL3 (ubiquitin like 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ubl3 (ubiquitin-like 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ubl3a (ubiquitin-like 3a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ubl3b (ubiquitin-like 3b)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	C46F11.6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	UBL3	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ubl3	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	11,509,912 - 11,554,548 (+)	NCBI		GRCr8
mRatBN7.2	12	6,473,684 - 6,518,331 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	6,473,460 - 6,518,862 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	7,159,191 - 7,204,106 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	7,782,324 - 7,827,239 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	6,810,332 - 6,855,256 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	7,865,938 - 7,911,526 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	7,865,938 - 7,911,525 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	9,953,322 - 9,997,648 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	7,019,485 - 7,063,818 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	7,049,412 - 7,093,745 (+)	NCBI
Celera	12	8,222,177 - 8,266,763 (+)	NCBI		Celera
Cytogenetic Map	12	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ubl3	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Ubl3 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of UBL3 mRNA	CTD	PMID:22206623
Ubl3	Rat	1,2-dimethylhydrazine	decreases expression	ISO	Ubl3 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of UBL3 mRNA	CTD	PMID:22206623
Ubl3	Rat	17alpha-ethynylestradiol	affects expression	ISO	Ubl3 (Mus musculus)	6480464	Ethinyl Estradiol affects the expression of UBL3 mRNA	CTD	PMID:17555576
Ubl3	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	Ubl3 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of UBL3 mRNA	CTD	PMID:17942748
Ubl3	Rat	17alpha-ethynylestradiol	increases expression	ISO	Ubl3 (Mus musculus)	6480464	Ethinyl Estradiol results in increased expression of UBL3 mRNA	CTD	PMID:17942748
Ubl3	Rat	17beta-estradiol	increases expression	ISO	Ubl3 (Mus musculus)	6480464	Estradiol results in increased expression of UBL3 mRNA	CTD	PMID:15289156
Ubl3	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Ubl3 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of UBL3 mRNA	CTD	PMID:17942748
Ubl3	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of UBL3 mRNA	CTD	PMID:34747641
Ubl3	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Ubl3 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of UBL3 mRNA	CTD	PMID:21570461
Ubl3	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of UBL3 mRNA	CTD	PMID:21215274 and PMID:32109520
Ubl3	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Ubl3 (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in increased expression of UBL3 mRNA	CTD	PMID:17942748 and PMID:19933214
Ubl3	Rat	2,3,7,8-Tetrachlorodibenzofuran	decreases expression	EXP		6480464	2 more ...	CTD	PMID:32109520
Ubl3	Rat	2-hydroxypropanoic acid	decreases expression	ISO	UBL3 (Homo sapiens)	6480464	Lactic Acid results in decreased expression of UBL3 mRNA	CTD	PMID:30851411
Ubl3	Rat	4,4'-sulfonyldiphenol	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of UBL3 mRNA	CTD	PMID:36041667
Ubl3	Rat	aflatoxin B1	increases expression	ISO	Ubl3 (Mus musculus)	6480464	Aflatoxin B1 results in increased expression of UBL3 mRNA	CTD	PMID:19770486
Ubl3	Rat	aflatoxin B1	decreases methylation	ISO	UBL3 (Homo sapiens)	6480464	Aflatoxin B1 results in decreased methylation of UBL3 gene	CTD	PMID:27153756
Ubl3	Rat	aflatoxin B1	decreases expression	ISO	UBL3 (Homo sapiens)	6480464	Aflatoxin B1 results in decreased expression of UBL3 mRNA	CTD	PMID:22100608
Ubl3	Rat	all-trans-retinoic acid	increases expression	ISO	UBL3 (Homo sapiens)	6480464	Tretinoin results in increased expression of UBL3 mRNA	CTD	PMID:33167477
Ubl3	Rat	amitrole	decreases expression	EXP		6480464	Amitrole results in decreased expression of UBL3 mRNA	CTD	PMID:38685447
Ubl3	Rat	amphetamine	increases expression	EXP		6480464	Amphetamine results in increased expression of UBL3 mRNA	CTD	PMID:30779732
Ubl3	Rat	antirheumatic drug	increases expression	ISO	UBL3 (Homo sapiens)	6480464	Antirheumatic Agents results in increased expression of UBL3 mRNA	CTD	PMID:24449571
Ubl3	Rat	Aroclor 1254	decreases expression	ISO	Ubl3 (Mus musculus)	6480464	Chlorodiphenyl (54% Chlorine) results in decreased expression of UBL3 mRNA	CTD	PMID:23650126
Ubl3	Rat	arsane	multiple interactions	ISO	UBL3 (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of UBL3 mRNA	CTD	PMID:39836092
Ubl3	Rat	arsenic atom	multiple interactions	ISO	UBL3 (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of UBL3 mRNA	CTD	PMID:39836092
Ubl3	Rat	arsenous acid	decreases expression	ISO	Ubl3 (Mus musculus)	6480464	Arsenic Trioxide results in decreased expression of UBL3 mRNA	CTD	PMID:35676786
Ubl3	Rat	benzo[a]pyrene	increases expression	ISO	Ubl3 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of UBL3 mRNA	CTD	PMID:22228805
Ubl3	Rat	Benzo[k]fluoranthene	decreases expression	ISO	Ubl3 (Mus musculus)	6480464	benzo(k)fluoranthene results in decreased expression of UBL3 mRNA	CTD	PMID:26377693
Ubl3	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	UBL3 (Homo sapiens)	6480464	Diethylhexyl Phthalate results in increased expression of UBL3 mRNA	CTD	PMID:31163220
Ubl3	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of UBL3 mRNA	CTD	PMID:25181051
Ubl3	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of UBL3 mRNA	CTD	PMID:36041667
Ubl3	Rat	bisphenol A	decreases methylation	ISO	UBL3 (Homo sapiens)	6480464	bisphenol A results in decreased methylation of UBL3 gene	CTD	PMID:31601247
Ubl3	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of UBL3 mRNA	CTD	PMID:34947998
Ubl3	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of UBL3 mRNA	CTD	PMID:33296240
Ubl3	Rat	bisphenol A	decreases methylation	ISO	Ubl3 (Mus musculus)	6480464	bisphenol A results in decreased methylation of UBL3 promoter	CTD	PMID:27312807
Ubl3	Rat	bisphenol F	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of UBL3 mRNA	CTD	PMID:36041667
Ubl3	Rat	cadmium atom	multiple interactions	ISO	UBL3 (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of UBL3 mRNA	CTD	PMID:35301059
Ubl3	Rat	cadmium dichloride	multiple interactions	ISO	UBL3 (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of UBL3 mRNA	CTD	PMID:35301059
Ubl3	Rat	CGP 52608	multiple interactions	ISO	UBL3 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to UBL3 gene]	CTD	PMID:28238834
Ubl3	Rat	cisplatin	multiple interactions	ISO	UBL3 (Homo sapiens)	6480464	[Cisplatin co-treated with jinfukang] results in decreased expression of UBL3 mRNA	CTD	PMID:27392435
Ubl3	Rat	cisplatin	decreases expression	ISO	UBL3 (Homo sapiens)	6480464	Cisplatin results in decreased expression of UBL3 mRNA	CTD	PMID:27392435
Ubl3	Rat	clofibric acid	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of UBL3 mRNA	CTD	PMID:17602206
Ubl3	Rat	cobalt dichloride	increases expression	ISO	UBL3 (Homo sapiens)	6480464	cobaltous chloride results in increased expression of UBL3 mRNA	CTD	PMID:19376846
Ubl3	Rat	copper(II) sulfate	increases expression	ISO	UBL3 (Homo sapiens)	6480464	Copper Sulfate results in increased expression of UBL3 mRNA	CTD	PMID:19549813
Ubl3	Rat	crocidolite asbestos	decreases expression	ISO	Ubl3 (Mus musculus)	6480464	Asbestos and Crocidolite results in decreased expression of UBL3 mRNA	CTD	PMID:29279043
Ubl3	Rat	cyclosporin A	increases expression	ISO	UBL3 (Homo sapiens)	6480464	Cyclosporine results in increased expression of UBL3 mRNA	CTD	PMID:25562108
Ubl3	Rat	cytarabine	increases expression	ISO	UBL3 (Homo sapiens)	6480464	Cytarabine results in increased expression of UBL3 mRNA	CTD	PMID:19194470
Ubl3	Rat	DDE	decreases expression	ISO	UBL3 (Homo sapiens)	6480464	Dichlorodiphenyl Dichloroethylene results in decreased expression of UBL3 mRNA	CTD	PMID:38568856
Ubl3	Rat	diarsenic trioxide	decreases expression	ISO	Ubl3 (Mus musculus)	6480464	Arsenic Trioxide results in decreased expression of UBL3 mRNA	CTD	PMID:35676786
Ubl3	Rat	dibenz[a,h]anthracene	increases expression	ISO	Ubl3 (Mus musculus)	6480464	1 more ...	CTD	PMID:26377693
Ubl3	Rat	dicrotophos	decreases expression	ISO	UBL3 (Homo sapiens)	6480464	dicrotophos results in decreased expression of UBL3 mRNA	CTD	PMID:28302478
Ubl3	Rat	diethylstilbestrol	increases expression	ISO	Ubl3 (Mus musculus)	6480464	Diethylstilbestrol results in increased expression of UBL3 mRNA	CTD	PMID:15289156
Ubl3	Rat	dorsomorphin	multiple interactions	ISO	UBL3 (Homo sapiens)	6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ...	CTD	PMID:27188386
Ubl3	Rat	elemental selenium	decreases expression	ISO	UBL3 (Homo sapiens)	6480464	Selenium results in decreased expression of UBL3 mRNA	CTD	PMID:19244175
Ubl3	Rat	etoposide	affects response to substance	ISO	UBL3 (Homo sapiens)	6480464	UBL3 protein affects the susceptibility to Etoposide	CTD	PMID:16217747
Ubl3	Rat	flutamide	increases expression	EXP		6480464	Flutamide results in increased expression of UBL3 mRNA	CTD	PMID:24136188
Ubl3	Rat	folic acid	multiple interactions	ISO	Ubl3 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of UBL3 mRNA	CTD	PMID:22206623
Ubl3	Rat	genistein	increases expression	ISO	Ubl3 (Mus musculus)	6480464	Genistein results in increased expression of UBL3 mRNA	CTD	PMID:15289156
Ubl3	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of UBL3 mRNA	CTD	PMID:22061828
Ubl3	Rat	lead(0)	affects expression	ISO	UBL3 (Homo sapiens)	6480464	Lead affects the expression of UBL3 mRNA	CTD	PMID:28903495
Ubl3	Rat	mitomycin C	affects response to substance	ISO	UBL3 (Homo sapiens)	6480464	UBL3 protein affects the susceptibility to Mitomycin	CTD	PMID:16217747
Ubl3	Rat	mitoxantrone	affects response to substance	ISO	UBL3 (Homo sapiens)	6480464	UBL3 protein affects the susceptibility to Mitoxantrone	CTD	PMID:16217747
Ubl3	Rat	N-nitrosodiethylamine	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of UBL3 mRNA	CTD	PMID:17602206
Ubl3	Rat	nefazodone	increases expression	EXP		6480464	nefazodone results in increased expression of UBL3 mRNA	CTD	PMID:24136188
Ubl3	Rat	nickel sulfate	decreases expression	ISO	UBL3 (Homo sapiens)	6480464	nickel sulfate results in decreased expression of UBL3 mRNA	CTD	PMID:22714537
Ubl3	Rat	perfluorooctane-1-sulfonic acid	decreases expression	ISO	UBL3 (Homo sapiens)	6480464	perfluorooctane sulfonic acid results in decreased expression of UBL3 mRNA	CTD	PMID:27153767
Ubl3	Rat	phenobarbital	increases expression	ISO	Ubl3 (Mus musculus)	6480464	Phenobarbital results in increased expression of UBL3 mRNA	CTD	PMID:19363144
Ubl3	Rat	quercetin	decreases expression	ISO	UBL3 (Homo sapiens)	6480464	Quercetin results in decreased expression of UBL3 mRNA	CTD	PMID:21632981
Ubl3	Rat	rac-lactic acid	decreases expression	ISO	UBL3 (Homo sapiens)	6480464	Lactic Acid results in decreased expression of UBL3 mRNA	CTD	PMID:30851411
Ubl3	Rat	SB 431542	multiple interactions	ISO	UBL3 (Homo sapiens)	6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ...	CTD	PMID:27188386
Ubl3	Rat	selenium atom	decreases expression	ISO	UBL3 (Homo sapiens)	6480464	Selenium results in decreased expression of UBL3 mRNA	CTD	PMID:19244175
Ubl3	Rat	senecionine	decreases expression	ISO	Ubl3 (Mus musculus)	6480464	senecionine results in decreased expression of UBL3 protein	CTD	PMID:35357534
Ubl3	Rat	silver atom	increases expression	ISO	UBL3 (Homo sapiens)	6480464	Silver results in increased expression of UBL3 mRNA	CTD	PMID:26014281
Ubl3	Rat	silver(0)	increases expression	ISO	UBL3 (Homo sapiens)	6480464	Silver results in increased expression of UBL3 mRNA	CTD	PMID:26014281
Ubl3	Rat	sodium arsenite	increases expression	ISO	UBL3 (Homo sapiens)	6480464	sodium arsenite results in increased expression of UBL3 mRNA	CTD	PMID:38568856
Ubl3	Rat	sodium arsenite	multiple interactions	ISO	UBL3 (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of UBL3 mRNA	CTD	PMID:39836092
Ubl3	Rat	tamoxifen	affects expression	ISO	Ubl3 (Mus musculus)	6480464	Tamoxifen affects the expression of UBL3 mRNA	CTD	PMID:17555576
Ubl3	Rat	temozolomide	decreases expression	ISO	UBL3 (Homo sapiens)	6480464	Temozolomide results in decreased expression of UBL3 mRNA	CTD	PMID:31758290
Ubl3	Rat	thiram	increases expression	ISO	UBL3 (Homo sapiens)	6480464	Thiram results in increased expression of UBL3 mRNA	CTD	PMID:38568856
Ubl3	Rat	titanium dioxide	decreases methylation	ISO	Ubl3 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of UBL3 promoter	CTD	PMID:35295148
Ubl3	Rat	trichostatin A	increases expression	ISO	UBL3 (Homo sapiens)	6480464	trichostatin A results in increased expression of UBL3 mRNA	CTD	PMID:24935251 and PMID:26272509
Ubl3	Rat	trichostatin A	multiple interactions	ISO	UBL3 (Homo sapiens)	6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of UBL3 mRNA	CTD	PMID:27188386
Ubl3	Rat	triptonide	increases expression	ISO	Ubl3 (Mus musculus)	6480464	triptonide results in increased expression of UBL3 mRNA	CTD	PMID:33045310
Ubl3	Rat	urethane	increases expression	ISO	UBL3 (Homo sapiens)	6480464	Urethane results in increased expression of UBL3 mRNA	CTD	PMID:28818685
Ubl3	Rat	valproic acid	affects expression	ISO	UBL3 (Homo sapiens)	6480464	Valproic Acid affects the expression of UBL3 mRNA	CTD	PMID:25979313
Ubl3	Rat	valproic acid	multiple interactions	ISO	UBL3 (Homo sapiens)	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of UBL3 mRNA	CTD	PMID:27188386
Ubl3	Rat	valproic acid	increases expression	ISO	UBL3 (Homo sapiens)	6480464	Valproic Acid results in increased expression of UBL3 mRNA	CTD	PMID:23179753 more ...
Ubl3	Rat	vitamin E	decreases expression	ISO	UBL3 (Homo sapiens)	6480464	Vitamin E results in decreased expression of UBL3 mRNA	CTD	PMID:19244175

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ubl3	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ubl3	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Ubl3	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ubl3	Rat	protein binding	enables	ISO	UBL3 (Homo sapiens)	1624291	UniProtKB:P02766 more ...	RGD	PMID:32296183 and PMID:32814053

#	Reference Title	Reference Citation
1.	GOA pipeline	RGD automated data pipeline
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
3.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

PMID:15489334	PMID:19056867	PMID:23376485

Ubl3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	11,509,912 - 11,554,548 (+)	NCBI		GRCr8
mRatBN7.2	12	6,473,684 - 6,518,331 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	6,473,460 - 6,518,862 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	7,159,191 - 7,204,106 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	7,782,324 - 7,827,239 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	6,810,332 - 6,855,256 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	7,865,938 - 7,911,526 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	7,865,938 - 7,911,525 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	9,953,322 - 9,997,648 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	7,019,485 - 7,063,818 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	7,049,412 - 7,093,745 (+)	NCBI
Celera	12	8,222,177 - 8,266,763 (+)	NCBI		Celera
Cytogenetic Map	12	p11	NCBI

UBL3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	13	29,764,371 - 29,850,617 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	13	29,764,371 - 29,850,617 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	13	30,338,508 - 30,424,754 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	13	29,236,542 - 29,322,160 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	13	29,236,543 - 29,322,160	NCBI
Celera	13	11,408,157 - 11,494,450 (-)	NCBI		Celera
Cytogenetic Map	13	q12.3	NCBI
HuRef	13	11,152,796 - 11,238,892 (-)	NCBI		HuRef
CHM1_1	13	30,306,077 - 30,392,355 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	13	28,987,070 - 29,073,260 (-)	NCBI		T2T-CHM13v2.0

Ubl3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	148,441,441 - 148,489,689 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	148,441,445 - 148,489,599 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	148,504,631 - 148,552,879 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	148,504,635 - 148,552,789 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	149,316,207 - 149,364,364 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	148,814,996 - 148,862,982 (-)	NCBI		MGSCv36	mm8
Celera	5	146,505,918 - 146,554,062 (-)	NCBI		Celera
Cytogenetic Map	5	G3	NCBI
cM Map	5	88.66	NCBI

Ubl3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955431	15,992,353 - 16,046,647 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955431	15,991,559 - 16,046,647 (+)	NCBI	ChiLan1.0	ChiLan1.0

UBL3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	14	29,351,149 - 29,437,420 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	13	20,457,885 - 20,544,192 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	13	11,044,601 - 11,130,825 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	13	29,082,854 - 29,169,035 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	13	29,082,851 - 29,169,061 (-)	Ensembl	panpan1.1		panPan2

UBL3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	25	10,100,524 - 10,169,042 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	25	9,982,021 - 10,166,750 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	25	10,145,022 - 10,213,974 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	25	10,213,367 - 10,282,343 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	25	10,095,255 - 10,282,334 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	25	10,107,839 - 10,176,782 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	25	10,115,261 - 10,184,204 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	25	10,157,090 - 10,226,057 (+)	NCBI		UU_Cfam_GSD_1.0

Ubl3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	171,244,403 - 171,304,268 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936472	24,647,887 - 24,707,758 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936472	24,647,763 - 24,707,752 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

UBL3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	11	6,698,003 - 6,763,612 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	11	6,453,534 - 6,518,347 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

UBL3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	3	8,706,211 - 8,778,894 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	3	8,705,131 - 8,778,062 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666057	35,586,728 - 35,659,815 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ubl3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624776	8,594,333 - 8,664,899 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624776	8,561,188 - 8,662,943 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Ubl3
146 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	219
Count of miRNA genes:	146
Interacting mature miRNAs:	186
Transcripts:	ENSRNOT00000061229
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312418	Kidm41	Kidney mass QTL 41	3.7	0.0001	kidney mass (VT:0002707)	single kidney wet weight to body weight ratio (CMO:0000622)	12	1	19611090	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
9590147	Scort7	Serum corticosterone level QTL 7	13.61	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	12	1	42110980	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564498	46669029	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	6107579	46669029	Rat
1581516	Cm56	Cardiac mass QTL 56	4.2	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	1	29333307	Rat
9590086	Insglur6	Insulin/glucose ratio QTL 6	18.97	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	12	1	42110980	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
6893681	Bw109	Body weight QTL 109	2.3	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	12	1	23297788	Rat
1300174	Bw15	Body weight QTL 15	2.93		body mass (VT:0001259)	body weight loss (CMO:0001399)	12	1	9318387	Rat
1598855	Bp294	Blood pressure QTL 294	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	1	34851688	Rat
10755457	Coatc14	Coat color QTL 14		0.01759	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	12	1	22591684	Rat
724526	Uae3	Urinary albumin excretion QTL 3	4.9	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	12	3906969	10373166	Rat
634351	Apr5	Acute phase response QTL 5	6.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	12	1	44503507	Rat
8694179	Bw150	Body weight QTL 150	2.9	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
634350	Apr4	Acute phase response QTL 4	6		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	1172005	46172005	Rat
7411545	Bw128	Body weight QTL 128	5.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	5564495	46669029	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	36247923	Rat
737979	Pia22	Pristane induced arthritis QTL 22	53.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	1	44465750	Rat
7411586	Foco5	Food consumption QTL 5	5.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	1	42450532	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
7243862	Mcs30	Mammary carcinoma susceptibility QTL 30	8.62		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	12	797729	8525593	Rat
2302042	Pia38	Pristane induced arthritis QTL 38	3.5	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	1	44503507	Rat
7411595	Foco9	Food consumption QTL 9	4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
7411660	Foco28	Food consumption QTL 28	10.9	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat

AA924604

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	6,517,961 - 6,518,167 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	7,911,157 - 7,911,362	NCBI	Rnor6.0
Rnor_5.0	12	9,997,279 - 9,997,484	UniSTS	Rnor5.0
RGSC_v3.4	12	7,063,449 - 7,063,654	UniSTS	RGSC3.4
Celera	12	8,266,394 - 8,266,599	UniSTS
RH 3.4 Map	12	72.6	UniSTS
Cytogenetic Map	12	p11	UniSTS

AU049526

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	6,481,849 - 6,482,021 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	7,874,197 - 7,874,368	NCBI	Rnor6.0
Rnor_5.0	12	9,961,581 - 9,961,752	UniSTS	Rnor5.0
RGSC_v3.4	12	7,027,853 - 7,028,024	UniSTS	RGSC3.4
Celera	12	8,230,345 - 8,230,516	UniSTS
Cytogenetic Map	12	p11	UniSTS

AU049955

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	6,476,562 - 6,476,817 (+)	MAPPER	mRatBN7.2
mRatBN7.2	12	6,476,614 - 6,476,817 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	7,868,869 - 7,869,164	NCBI	Rnor6.0
Rnor_6.0	12	7,868,962 - 7,869,164	NCBI	Rnor6.0
Rnor_5.0	12	9,956,346 - 9,956,548	UniSTS	Rnor5.0
Rnor_5.0	12	9,956,253 - 9,956,548	UniSTS	Rnor5.0
RGSC_v3.4	12	7,022,416 - 7,022,820	UniSTS	RGSC3.4
Celera	12	8,225,110 - 8,225,312	UniSTS
Cytogenetic Map	12	p11	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001015030	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC091342	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000061229 ⟹ ENSRNOP00000057940

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	6,473,460 - 6,518,862 (+)	Ensembl
Rnor_6.0 Ensembl	12	7,865,938 - 7,911,525 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000113822

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	6,514,354 - 6,518,550 (+)	Ensembl

RefSeq Acc Id:

NM_001015030 ⟹ NP_001015030

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	11,509,912 - 11,554,548 (+)	NCBI
mRatBN7.2	12	6,473,684 - 6,518,331 (+)	NCBI
Rnor_6.0	12	7,865,938 - 7,911,526 (+)	NCBI
Rnor_5.0	12	9,953,322 - 9,997,648 (+)	NCBI
RGSC_v3.4	12	7,019,485 - 7,063,818 (+)	RGD
Celera	12	8,222,177 - 8,266,763 (+)	RGD

Sequence:

show sequence

CAGGAGGCGGCCGGGGCGTGTGGGATTGAGGAGTGGAGGAGGAGGCGGAGAGTCAGGGCTCTGAGGGGGAGCTGTTCCCAAGCTAAGGGAGGAGCCCCCGGAAGACGCCGCGGAAGGCAGCGAGGCGG
AGGCGGCCGGAGTACGGACGCGATGTGGCCCGACCCGCGCTGCTGCGCTGAGGCGCCCGCGGCCTGAGCCCCCCGGCGCTGCGCTCGGTTCGGCTCGGCCCGGTTCGGCTCGGCTCGGCGGCCGGCGA
GGTCGATGCCCTTGAGCGCGGCTGCGCGCAGCTCGGCTGTGCGGCCCCGCGGCGCGCGCTGAGCTTCTCGGCGGCCCCGGCCGCTCTCAGCTCGGCGCTCGATGTGTAGCCACATAGTTATCTGTACA
CTTCGTCGCCGGGGCTTTAATGAGGACCTGAGTCGCGAGCGCGAGTGAATCACCGCCTGGGCCGGGGAAAGAGGACGGCGCATTTAACCCCCTCCCACCCCACTCCATGTCCCTGTGTCACTCGGCTC
TGTCCACCTGGCGCGGCGGGTCCTGGAGCTGCTACTGCTGCTGACGATCGACTCCCCTCGCGCCTCTCGCCCCAGAAGCTCTTGTGCTCCCACGTAACTTCTACTTTTTTTTTTTCCTTTTGAGAAAG
CTCAGCACGAACCGATCAGAATTGTGAAGGGTTTTTGTTTTTTTTTTGTTTTTTGTTTTGCTTTTGGGTTTTCCGAAGCTCCAGCACTTCTGCTCTTGTTTTTGTTTTGTTTTCTGCGTAAACCTCTG
GCCCACTCTCAAAAGGCAAGATGTCCAGTCATGTCCCGGCGGATATGATTAATTTGCGCCTCATCTTGGTGAGTGGAAAGACGAAAGAGTTCCTCTTCTCCCCAAACGACTCTGCCTCTGACATCGCA
AAGCACGTGTATGACAACTGGCCCATGGACTGGGAAGAAGAGCAGGTCAGCAGCCCGAACATTCTTCGACTCATTTATCAAGGCAGATTTCTACACGGAAACGTCACCCTAGGAGCATTAAAACTTCC
TTTTGGCAAAACAACAGTGATGCATTTGGTGGCCAGAGAGACCCTGCCAGAGCCCAATTCACAAGGTCAGAGAAACCGGGAGAAAACTGGTGAGAGCAACTGCTGTGTGATCCTGTAACATCGTCGCC
AGCGCAGGTGTGGCAGTCTGTTACCACTGCGGGGACAGAGGAGACTCGGCAGCTTCCGACACCTGTGGGACAGTCGCCCGCACATCCAGACTGAACCACTCATGAGCTCTGTGATCTCTCCTCACAAA
GTAAAAAGAACCAAGAACATTTCCAGTCTGGTCCTTTATTCCTGTATCTCTTGTCTGTGTTGAGCAGTCTGAAATGCACAGTGGTCTCCAGGGGAAATAGCAAGTCTCTCAAGTCTCTCTCTGCAGAA
ACCGCCTTGCTGCCACAAAGACTCCTCCACAGAAGTCAGAAGGCGAGTGCTGCAAGTTCAATTTGCACTAAAAACATTATTATTTTCCTCATCAGCGTAATCTGCACATGTCTGTGGCGCCCAGACGT
TCTCCTGTGTGGAGTTCACCCTGGAGGACGCCCATCATCAGTGCAGTTAATACCAGGCCAGTTGGACCGGGGAAATGGGAAGGAATCTAACATGCTGGGTGAATTCTACCAAAGTCAGCCACAGTGGC
TGTCCTCGAAGGATGTCAGACTGGGCATGACTCTTGTCACCACAGCAAATGAGAAGCCATGCCTGCTGCTCACAGCACTCTGTAGAGGGTGCCCCTGCTGCCTGCCCACCGAGTCCTCCCCACAGGGG
GCTCATGCAGACAGCACAGAGGGGCCGCAGTGTGTCCCTAGCCTTAATGTGGAGGGGCCAGTGTCTCGGTGCCATCACTGTGCAGAACTGGTGGGAAGCCTCAGCGGTTGTGTACTTGAGTATCAGAA
GATTGATAGCTTGCGCCACCATCACTCATTCGAACCCTGCCGAGTGTACTCGCTCACTAGAGCAGAGGGATCCTTTTAAAGTCTCCAGATGCTAATTTTGTTACTTTCTGTAGTTTGCATTCGGAATC
AGTGCTTGCAATTGTATTAAAATCACAAGCTGAGTTTTAAGGCATACATGATCAATAGCGCCACTCTTATTTTTACCAATAATTTAAAGATTGAGATGCTATAAATAAACAATTTGCACAGCACTAAA
GCATGAGCTAATTTCATCTAAACCTGTAAAAAAAAGATTTTATATTTTTTTCACTGGGAAGAAATCTTCCTGGATGAAATTACAAATATGTGTAGATTATATTTAATAAAAAAGACATAATAAAATAT
CTAACTGTAGAATGCAAATATAGATTGGCGTGTAGCATATAGACCAGTATTCCATATCAATAACTTTATCCAGCCTTTTAAAAGATGAAGTTGCAGACTACGTTGTGTTCTGTATTTAATGAGGGTTC
TTGGCCCTCGGCAGCATTAAATGTAAATGGTCTCTATGGTCATCTTTGTTTAAATGCAATCAGGTTACTTTATTCATTGTTAATGCTTCCATGAGAAGGCTTTATATGCAGTAGATCTACGAAAATAT
TGTTCATACTGATCAGAATTAAATTTGTATAGAGCAGAGTTTTAAAATGAATGTAAATAGCACTAAACCTTTTCTTTCTGCAGCCTGTACTTAATAGATTTCTTCTGTAAACTAAATAAAAAAAAATT
GTAGTGCAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_001015030	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH91342	(Get FASTA)	NCBI Sequence Viewer
	EDL89544	(Get FASTA)	NCBI Sequence Viewer
	EDL89545	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000109338
GenBank Protein	Q5BJT2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001015030 ⟸ NM_001015030
- UniProtKB:	Q5BJT2 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MSSHVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL hide sequence

Ensembl Acc Id:

ENSRNOP00000057940 ⟸ ENSRNOT00000061229

Protein Domains

Ubiquitin-like

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5BJT2-F1-model_v2	AlphaFold	Q5BJT2	1-117	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13698394

Promoter ID:

EPDNEW_R8919

Type:

initiation region

Name:

Ubl3_1

Description:

ubiquitin-like 3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R8920

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	7,865,899 - 7,865,959	EPDNEW

RGD ID:

13698395

Promoter ID:

EPDNEW_R8920

Type:

single initiation site

Name:

Ubl3_2

Description:

ubiquitin-like 3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R8919

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	7,866,638 - 7,866,698	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-20136	BioCyc
Ensembl Genes	ENSRNOG00000000921	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000061229	ENTREZGENE
Gene3D-CATH	Phosphatidylinositol 3-kinase Catalytic Subunit, Chain A, domain 1	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7315459	IMAGE-MGC_LOAD
InterPro	MUB	UniProtKB/Swiss-Prot
	Ubiquitin-like_domsf	UniProtKB/Swiss-Prot
	Ubiquitin_dom	UniProtKB/Swiss-Prot
	UBL3-like	UniProtKB/Swiss-Prot
	UBL3-like_ubiquitin_dom	UniProtKB/Swiss-Prot
	UBL3_Ubl_met	UniProtKB/Swiss-Prot
KEGG Report	rno:363869	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:109350	IMAGE-MGC_LOAD
NCBI Gene	363869	ENTREZGENE
PANTHER	PTHR13169	UniProtKB/Swiss-Prot
	UBIQUITIN-LIKE PROTEIN 3	UniProtKB/Swiss-Prot
Pfam	Rad60-SLD_2	UniProtKB/Swiss-Prot
PhenoGen	Ubl3	PhenoGen
PIRSF	MUB	UniProtKB/Swiss-Prot
PROSITE	UBIQUITIN_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000000921	RatGTEx
RNAcentral	URS00022AF64D	RNACentral
	URS00022AFABC	RNACentral
Superfamily-SCOP	SSF54236	UniProtKB/Swiss-Prot
UniProt	A6K187_RAT	UniProtKB/TrEMBL
	Q5BJT2	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-12-06	Ubl3	ubiquitin-like 3	Ubl3_predicted	ubiquitin-like 3 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Ubl3_predicted	ubiquitin-like 3 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message