Symbol:
Pabpc4
Name:
poly(A) binding protein, cytoplasmic 4
RGD ID:
1305015
Description:
Predicted to enable mRNA 3'-UTR binding activity; poly(A) binding activity; and poly(U) RNA binding activity. Predicted to act upstream of or within myeloid cell development and regulation of mRNA stability. Predicted to be located in cytoplasm. Predicted to be part of ribonucleoprotein complex. Predicted to be active in cytoplasmic stress granule; cytosol; and nucleus. Orthologous to human PABPC4 (poly(A) binding protein cytoplasmic 4); PARTICIPATES IN mRNA decay pathway; RNA degradation pathway; RNA transport pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC298510; poly A binding protein, cytoplasmic 4; poly(A) binding protein, cytoplasmic 4 (inducible form); polyadenylate-binding protein 4
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PABPC4 (poly(A) binding protein cytoplasmic 4) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Pabpc4 (poly(A) binding protein, cytoplasmic 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pabpc4 (poly(A) binding protein cytoplasmic 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PABPC4 (poly(A) binding protein cytoplasmic 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
HEYL (hes related family bHLH transcription factor with YRPW motif like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Pabpc4 (poly(A) binding protein cytoplasmic 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PABPC4 (poly(A) binding protein cytoplasmic 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PABPC4 (poly(A) binding protein cytoplasmic 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pabpc4 (poly(A) binding protein cytoplasmic 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
PABPC4 (poly(A) binding protein cytoplasmic 4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Pabpc4 (poly(A) binding protein, cytoplasmic 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
PAB1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG4612
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
pAbp
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
pab-1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
pab-2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
pabpc4
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Related Pseudogenes:
Pabpc4-ps1
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 140,847,835 - 140,864,089 (+) NCBI GRCr8 mRatBN7.2 5 135,563,142 - 135,578,985 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 135,563,562 - 135,578,979 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 138,269,597 - 138,284,890 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 140,039,563 - 140,054,856 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 140,046,708 - 140,062,001 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 140,978,893 - 140,994,732 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 140,979,435 - 140,994,732 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 144,768,558 - 144,784,395 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 142,599,706 - 142,615,003 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 142,604,839 - 142,620,228 (+) NCBI Celera 5 134,102,156 - 134,117,452 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pabpc4 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of PABPC4 mRNA] CTD PMID:31150632 Pabpc4 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO RGD:1312792 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of PABPC4 mRNA CTD PMID:22079256 Pabpc4 Rat 17beta-estradiol increases expression ISO RGD:1312793 6480464 Estradiol results in increased expression of PABPC4 mRNA CTD PMID:39298647 Pabpc4 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO RGD:1312793 6480464 2,2',4,4'-tetrabromodiphenyl ether affects the expression of PABPC4 mRNA CTD PMID:30294300 Pabpc4 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO RGD:1312792 6480464 2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of PABPC4 protein CTD PMID:31675489 Pabpc4 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1312793 6480464 Tetrachlorodibenzodioxin affects the expression of PABPC4 mRNA CTD PMID:21570461 Pabpc4 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PABPC4 mRNA CTD PMID:34747641 Pabpc4 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2,4-dinitrotoluene affects the expression of PABPC4 mRNA CTD PMID:21346803 Pabpc4 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2,6-dinitrotoluene affects the expression of PABPC4 mRNA CTD PMID:21346803 Pabpc4 Rat 2-hydroxypropanoic acid increases expression ISO RGD:1312792 6480464 Lactic Acid results in increased expression of PABPC4 mRNA CTD PMID:30851411 Pabpc4 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO RGD:1312793 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in decreased expression of PABPC4 mRNA CTD PMID:26251327 Pabpc4 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of PABPC4 protein CTD PMID:34915118 Pabpc4 Rat 4,4'-diaminodiphenylmethane increases expression ISO RGD:1312793 6480464 4,4'-diaminodiphenylmethane results in increased expression of PABPC4 mRNA CTD PMID:18648102 Pabpc4 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1312793 6480464 bisphenol S results in increased expression of PABPC4 mRNA CTD PMID:39298647 Pabpc4 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1312792 6480464 bisphenol S results in increased expression of PABPC4 protein CTD PMID:34186270 Pabpc4 Rat 4,4'-sulfonyldiphenol decreases methylation ISO RGD:1312792 6480464 bisphenol S results in decreased methylation of PABPC4 gene CTD PMID:31601247 Pabpc4 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2,6-dinitrotoluene affects the expression of PABPC4 mRNA CTD PMID:21346803 Pabpc4 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of PABPC4 mRNA CTD PMID:19483382 Pabpc4 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of PABPC4 mRNA CTD PMID:19483382 Pabpc4 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PABPC4 mRNA CTD PMID:24780913 Pabpc4 Rat aconitine decreases expression EXP 6480464 Aconitine results in decreased expression of PABPC4 protein CTD PMID:33236894 Pabpc4 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of PABPC4 mRNA CTD PMID:28959563 Pabpc4 Rat all-trans-retinoic acid decreases expression ISO RGD:1312792 6480464 Tretinoin results in decreased expression of PABPC4 mRNA CTD PMID:33167477 Pabpc4 Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of PABPC4 mRNA CTD PMID:19483382 Pabpc4 Rat aristolochic acid A decreases expression ISO RGD:1312792 6480464 aristolochic acid I results in decreased expression of PABPC4 mRNA CTD PMID:33212167 Pabpc4 Rat arsenous acid multiple interactions ISO RGD:1312792 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to PABPC4 protein] CTD PMID:26598702 Pabpc4 Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of PABPC4 mRNA CTD PMID:19483382 Pabpc4 Rat benzo[a]pyrene decreases expression ISO RGD:1312793 6480464 Benzo(a)pyrene results in decreased expression of PABPC4 mRNA CTD PMID:22228805 Pabpc4 Rat benzo[a]pyrene decreases expression ISO RGD:1312792 6480464 Benzo(a)pyrene results in decreased expression of PABPC4 mRNA CTD PMID:21632981 Pabpc4 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PABPC4 mRNA CTD PMID:25181051|PMID:30816183|PMID:32528016 Pabpc4 Rat bisphenol A decreases expression ISO RGD:1312792 6480464 bisphenol A results in decreased expression of PABPC4 protein CTD PMID:34186270 Pabpc4 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of PABPC4 gene CTD PMID:28505145 Pabpc4 Rat bisphenol AF increases expression ISO RGD:1312792 6480464 bisphenol AF results in increased expression of PABPC4 protein CTD PMID:34186270 Pabpc4 Rat Bisphenol B increases expression ISO RGD:1312792 6480464 bisphenol B results in increased expression of PABPC4 protein CTD PMID:34186270 Pabpc4 Rat bisphenol F increases expression ISO RGD:1312792 6480464 bisphenol F results in increased expression of PABPC4 protein CTD PMID:34186270 Pabpc4 Rat cadmium acetate decreases expression ISO RGD:1312792 6480464 cadmium acetate results in decreased expression of PABPC4 mRNA CTD PMID:18155341 Pabpc4 Rat carbon nanotube increases expression ISO RGD:1312793 6480464 Nanotubes, Carbon results in increased expression of PABPC4 mRNA CTD PMID:25554681 Pabpc4 Rat chlormequat chloride increases expression EXP 6480464 Chlormequat results in increased expression of PABPC4 protein CTD PMID:34958886 Pabpc4 Rat chloropicrin decreases expression ISO RGD:1312792 6480464 chloropicrin results in decreased expression of PABPC4 mRNA CTD PMID:26352163 Pabpc4 Rat chlorpyrifos decreases expression ISO RGD:1312793 6480464 Chlorpyrifos results in decreased expression of PABPC4 mRNA CTD PMID:37019170 Pabpc4 Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of PABPC4 mRNA CTD PMID:19483382 Pabpc4 Rat copper(II) sulfate decreases expression ISO RGD:1312792 6480464 Copper Sulfate results in decreased expression of PABPC4 mRNA CTD PMID:19549813 Pabpc4 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of PABPC4 mRNA CTD PMID:26577399 Pabpc4 Rat diarsenic trioxide multiple interactions ISO RGD:1312792 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to PABPC4 protein] CTD PMID:26598702 Pabpc4 Rat Dibutyl phosphate affects expression ISO RGD:1312792 6480464 di-n-butylphosphoric acid affects the expression of PABPC4 mRNA CTD PMID:37042841 Pabpc4 Rat dicrotophos increases expression ISO RGD:1312792 6480464 dicrotophos results in increased expression of PABPC4 mRNA CTD PMID:28302478 Pabpc4 Rat dioxygen multiple interactions ISO RGD:1312793 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of PABPC4 mRNA CTD PMID:30529165 Pabpc4 Rat diuron decreases expression ISO RGD:1312792 6480464 Diuron results in decreased expression of PABPC4 mRNA CTD PMID:35967413 Pabpc4 Rat enzyme inhibitor multiple interactions ISO RGD:1312792 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 Pabpc4 Rat ethyl methanesulfonate decreases expression ISO RGD:1312792 6480464 Ethyl Methanesulfonate results in decreased expression of PABPC4 mRNA CTD PMID:23649840 Pabpc4 Rat furan increases expression EXP 6480464 furan results in increased expression of PABPC4 mRNA CTD PMID:26194646 Pabpc4 Rat ivermectin decreases expression ISO RGD:1312792 6480464 Ivermectin results in decreased expression of PABPC4 protein CTD PMID:32959892 Pabpc4 Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of PABPC4 mRNA CTD PMID:19483382 Pabpc4 Rat methotrexate affects expression ISO RGD:1312793 6480464 Methotrexate affects the expression of PABPC4 mRNA CTD PMID:18502557 Pabpc4 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of PABPC4 gene CTD PMID:35440735 Pabpc4 Rat methyl methanesulfonate decreases expression ISO RGD:1312792 6480464 Methyl Methanesulfonate results in decreased expression of PABPC4 mRNA CTD PMID:23649840 Pabpc4 Rat methylparaben increases expression ISO RGD:1312792 6480464 methylparaben results in increased expression of PABPC4 mRNA CTD PMID:31745603 Pabpc4 Rat N-methyl-4-phenylpyridinium decreases expression ISO RGD:1312793 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of PABPC4 protein CTD PMID:26558463 Pabpc4 Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of PABPC4 mRNA CTD PMID:19483382 Pabpc4 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of PABPC4 mRNA CTD PMID:25729387 Pabpc4 Rat oxaliplatin decreases expression EXP 6480464 oxaliplatin results in decreased expression of PABPC4 mRNA CTD PMID:25729387 Pabpc4 Rat paracetamol increases expression ISO RGD:1312792 6480464 Acetaminophen results in increased expression of PABPC4 mRNA CTD PMID:29067470 Pabpc4 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of PABPC4 mRNA CTD PMID:33387578 Pabpc4 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of PABPC4 mRNA CTD PMID:32680482 Pabpc4 Rat phenethyl isothiocyanate decreases expression EXP 6480464 phenethyl isothiocyanate results in decreased expression of PABPC4 mRNA CTD PMID:17616710 Pabpc4 Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of PABPC4 mRNA CTD PMID:19483382 Pabpc4 Rat pirinixic acid increases expression ISO RGD:1312793 6480464 pirinixic acid results in increased expression of PABPC4 mRNA CTD PMID:18301758 Pabpc4 Rat potassium chromate increases expression ISO RGD:1312792 6480464 potassium chromate(VI) results in increased expression of PABPC4 mRNA CTD PMID:22079256 Pabpc4 Rat potassium chromate multiple interactions ISO RGD:1312792 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of PABPC4 mRNA CTD PMID:22079256 Pabpc4 Rat rac-lactic acid increases expression ISO RGD:1312792 6480464 Lactic Acid results in increased expression of PABPC4 mRNA CTD PMID:30851411 Pabpc4 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of PABPC4 mRNA CTD PMID:19013527|PMID:28374803 Pabpc4 Rat sodium arsenite decreases expression ISO RGD:1312792 6480464 sodium arsenite results in decreased expression of PABPC4 mRNA; sodium arsenite results in decreased expression more ... CTD PMID:25879800|PMID:30528433|PMID:38568856 Pabpc4 Rat sodium arsenite multiple interactions ISO RGD:1312792 6480464 sodium arsenite promotes the reaction [PABPC4 protein binds to CAPRIN1 protein] CTD PMID:33939924 Pabpc4 Rat sodium arsenite decreases expression ISO RGD:1312793 6480464 sodium arsenite results in decreased expression of PABPC4 mRNA CTD PMID:25270620 Pabpc4 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of PABPC4 mRNA CTD PMID:25993096 Pabpc4 Rat tetrachloroethene increases expression ISO RGD:1312793 6480464 Tetrachloroethylene results in increased expression of PABPC4 mRNA CTD PMID:28973375 Pabpc4 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of PABPC4 mRNA CTD PMID:31150632 Pabpc4 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of PABPC4 mRNA] CTD PMID:31150632 Pabpc4 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of PABPC4 mRNA CTD PMID:19483382 Pabpc4 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PABPC4 mRNA CTD PMID:34492290 Pabpc4 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of PABPC4 mRNA CTD PMID:25729387 Pabpc4 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of PABPC4 mRNA CTD PMID:25729387 Pabpc4 Rat trichloroethene increases expression ISO RGD:1312793 6480464 Trichloroethylene results in increased expression of PABPC4 mRNA CTD PMID:19448997 Pabpc4 Rat trimellitic anhydride increases expression ISO RGD:1312793 6480464 trimellitic anhydride results in increased expression of PABPC4 mRNA CTD PMID:19042947 Pabpc4 Rat urethane increases expression ISO RGD:1312792 6480464 Urethane results in increased expression of PABPC4 mRNA CTD PMID:28818685 Pabpc4 Rat valproic acid decreases expression ISO RGD:1312792 6480464 Valproic Acid results in decreased expression of PABPC4 mRNA CTD PMID:19101580 Pabpc4 Rat valproic acid affects expression ISO RGD:1312793 6480464 Valproic Acid affects the expression of PABPC4 mRNA CTD PMID:17292431 Pabpc4 Rat valproic acid decreases methylation ISO RGD:1312792 6480464 Valproic Acid results in decreased methylation of PABPC4 gene CTD PMID:29154799 Pabpc4 Rat valproic acid affects expression ISO RGD:1312792 6480464 Valproic Acid affects the expression of PABPC4 mRNA CTD PMID:25979313 Pabpc4 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of PABPC4 mRNA CTD PMID:23034163
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) (-)-epigallocatechin 3-gallate (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-amino-2,6-dinitrotoluene (EXP) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) aconitine (EXP) acrylamide (EXP) all-trans-retinoic acid (ISO) amiodarone (EXP) aristolochic acid A (ISO) arsenous acid (ISO) benzbromarone (EXP) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) cadmium acetate (ISO) carbon nanotube (ISO) chlormequat chloride (EXP) chloropicrin (ISO) chlorpyrifos (ISO) clofibrate (EXP) copper(II) sulfate (ISO) Cuprizon (EXP) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dicrotophos (ISO) dioxygen (ISO) diuron (ISO) enzyme inhibitor (ISO) ethyl methanesulfonate (ISO) furan (EXP) ivermectin (ISO) L-ethionine (EXP) methotrexate (ISO) methoxychlor (EXP) methyl methanesulfonate (ISO) methylparaben (ISO) N-methyl-4-phenylpyridinium (ISO) omeprazole (EXP) oxaliplatin (EXP) paracetamol (EXP,ISO) paraquat (EXP) phenethyl isothiocyanate (EXP) pirinixic acid (EXP,ISO) potassium chromate (ISO) rac-lactic acid (ISO) rotenone (EXP) sodium arsenite (ISO) sodium dichromate (EXP) tetrachloroethene (ISO) tetrachloromethane (EXP) thioacetamide (EXP) topotecan (EXP) trichloroethene (ISO) trimellitic anhydride (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (EXP)
Pabpc4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 140,847,835 - 140,864,089 (+) NCBI GRCr8 mRatBN7.2 5 135,563,142 - 135,578,985 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 135,563,562 - 135,578,979 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 138,269,597 - 138,284,890 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 140,039,563 - 140,054,856 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 140,046,708 - 140,062,001 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 140,978,893 - 140,994,732 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 140,979,435 - 140,994,732 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 144,768,558 - 144,784,395 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 142,599,706 - 142,615,003 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 142,604,839 - 142,620,228 (+) NCBI Celera 5 134,102,156 - 134,117,452 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
PABPC4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 39,560,816 - 39,576,790 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 39,560,709 - 39,576,790 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 40,026,488 - 40,042,462 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 39,799,075 - 39,815,003 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 39,695,580 - 39,711,509 NCBI Celera 1 38,308,199 - 38,324,232 (-) NCBI Celera Cytogenetic Map 1 p34.3 NCBI HuRef 1 38,145,698 - 38,161,736 (-) NCBI HuRef CHM1_1 1 40,141,859 - 40,157,895 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 39,429,194 - 39,445,168 (-) NCBI T2T-CHM13v2.0
Pabpc4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 123,172,722 - 123,192,718 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 123,156,144 - 123,192,718 (+) Ensembl GRCm39 Ensembl GRCm38 4 123,282,303 - 123,298,925 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 123,262,351 - 123,298,925 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 122,960,154 - 122,976,075 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 122,785,214 - 122,801,135 (+) NCBI MGSCv36 mm8 Celera 4 121,615,267 - 121,631,202 (+) NCBI Celera Cytogenetic Map 4 D2.2 NCBI cM Map 4 57.42 NCBI
Pabpc4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955452 17,084,805 - 17,101,026 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955452 17,083,679 - 17,101,436 (-) NCBI ChiLan1.0 ChiLan1.0
PABPC4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 187,249,907 - 187,265,980 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 186,387,478 - 186,405,157 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 38,846,296 - 38,862,371 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 40,172,651 - 40,188,308 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 40,172,657 - 40,188,308 (-) Ensembl panpan1.1 panPan2
HEYL Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 3,242,738 - 3,257,275 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 3,235,611 - 3,303,445 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 3,501,443 - 3,516,003 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 3,362,836 - 3,377,395 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 3,362,852 - 3,377,380 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 3,238,950 - 3,253,501 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 3,299,982 - 3,314,518 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 3,315,601 - 3,330,164 (+) NCBI UU_Cfam_GSD_1.0
Pabpc4 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 55,627,296 - 55,643,277 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 21,452,005 - 21,468,065 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 21,453,244 - 21,468,059 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PABPC4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 95,382,302 - 95,399,080 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 95,382,295 - 95,399,452 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 88,468,836 - 88,485,979 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PABPC4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 93,161,868 - 93,177,863 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 93,161,877 - 93,177,839 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 23,501,232 - 23,517,166 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pabpc4
.
Predicted Target Of
Count of predictions: 229 Count of miRNA genes: 155 Interacting mature miRNAs: 174 Transcripts: ENSRNOT00000056592 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 1300122 Wbc1 White blood cell count QTL 1 2.75 leukocyte quantity (VT:0000217) total white blood cell count (CMO:0000365) 5 125392826 139989768 Rat 61452 Ciaa5 CIA Autoantibody QTL 5 3.5 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 5 94858972 143070159 Rat 70156 Niddm30 Non-insulin dependent diabetes mellitus QTL 30 3.98 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 5 129132447 151006154 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 1331803 Rf32 Renal function QTL 32 2.798 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 129132428 143070159 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 2317753 Glom24 Glomerulus QTL 24 3.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 5 97570330 136479578 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1581510 Cm54 Cardiac mass QTL 54 3.4 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 5 120740824 143608494 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 2293642 Bss37 Bone structure and strength QTL 37 4.64 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 120740824 151018848 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 7411722 Strs6 Sensitivity to stroke QTL 6 3.9 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 5 134972980 138113556 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
A001T47
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 135,578,722 - 135,578,827 (+) MAPPER mRatBN7.2 mRatBN7.2 12 3,119,189 - 3,119,294 (+) MAPPER mRatBN7.2 mRatBN7.2 5 135,578,722 - 135,578,827 (-) MAPPER mRatBN7.2 mRatBN7.2 12 3,119,189 - 3,119,294 (-) MAPPER mRatBN7.2 Rnor_6.0 5 140,994,470 - 140,994,574 NCBI Rnor6.0 Rnor_6.0 12 3,921,767 - 3,921,871 NCBI Rnor6.0 Rnor_5.0 5 144,784,133 - 144,784,237 UniSTS Rnor5.0 Rnor_5.0 12 6,052,808 - 6,052,912 UniSTS Rnor5.0 RGSC_v3.4 5 142,614,741 - 142,614,845 UniSTS RGSC3.4 RGSC_v3.4 12 1,017,446 - 1,017,550 UniSTS RGSC3.4 Celera 12 4,938,060 - 4,938,164 UniSTS Celera 5 134,117,190 - 134,117,294 UniSTS Cytogenetic Map 5 q36 UniSTS Cytogenetic Map 12 p12 UniSTS
UniSTS:479187
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 3,117,723 - 3,118,323 (-) MAPPER mRatBN7.2 Rnor_6.0 12 3,922,738 - 3,923,337 NCBI Rnor6.0 Rnor_5.0 12 6,053,779 - 6,054,378 UniSTS Rnor5.0 RGSC_v3.4 12 1,018,417 - 1,019,016 UniSTS RGSC3.4 Celera 12 4,936,594 - 4,937,193 UniSTS Cytogenetic Map 5 q36 UniSTS Cytogenetic Map 12 p12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000056592 ⟹ ENSRNOP00000053432
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 135,563,562 - 135,578,979 (+) Ensembl Rnor_6.0 Ensembl 5 140,979,435 - 140,994,732 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000106428 ⟹ ENSRNOP00000090731
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 135,563,562 - 135,578,979 (+) Ensembl
RefSeq Acc Id:
NM_001100538 ⟹ NP_001094008
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 140,848,792 - 140,864,089 (+) NCBI mRatBN7.2 5 135,563,687 - 135,578,985 (+) NCBI Rnor_6.0 5 140,979,435 - 140,994,732 (+) NCBI Rnor_5.0 5 144,768,558 - 144,784,395 (+) NCBI RGSC_v3.4 5 142,599,706 - 142,615,003 (+) RGD Celera 5 134,102,156 - 134,117,452 (+) RGD
Sequence:
GTGTCCCCAAGGCCGCTGTGAGCGCAGCATCTGGCTGCCTCTAGAAAAAATTTTTGCCCCCTCTGCAAGGGGATTCCCTACTTCAATTTTTATCTTTTAAGCTCCAAGCCAGGACAGCTGGAGAGTAC
hide sequence
RefSeq Acc Id:
XM_006238798 ⟹ XP_006238860
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 140,847,835 - 140,863,928 (+) NCBI mRatBN7.2 5 135,563,143 - 135,578,985 (+) NCBI Rnor_6.0 5 140,978,893 - 140,994,732 (+) NCBI Rnor_5.0 5 144,768,558 - 144,784,395 (+) NCBI
Sequence:
CGACTGCGCCCAGGTCGCGAGGCGCCCTTCGACCAGCAGCGCCCGGGGCGGGAGGGTATAAATG
hide sequence
RefSeq Acc Id:
XM_006238799 ⟹ XP_006238861
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 140,847,835 - 140,864,089 (+) NCBI mRatBN7.2 5 135,563,142 - 135,578,985 (+) NCBI Rnor_6.0 5 140,978,893 - 140,994,732 (+) NCBI Rnor_5.0 5 144,768,558 - 144,784,395 (+) NCBI
Sequence:
CGACTGCGCCCAGGTCGCGAGGCGCCCTTCGACCAGCAGCGCCCGGGGCGGGAGGGTATAAATGGAGCGGTGGCTGCTTCAGCCGCCTCTCTCCGCCCCGGGTCGCAGTCGCTAGTGCTGCGTTTGGG
hide sequence
RefSeq Acc Id:
XM_006238800 ⟹ XP_006238862
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 140,847,835 - 140,863,928 (+) NCBI mRatBN7.2 5 135,563,144 - 135,578,985 (+) NCBI Rnor_6.0 5 140,978,894 - 140,994,732 (+) NCBI Rnor_5.0 5 144,768,558 - 144,784,395 (+) NCBI
Sequence:
GACTGCGCCCAGGTCGCGAGGCGCCCTTCGACCAGCAGCGCCCGGGGCGGGAGGGTATAAATGGAGCGGTGGCTGCTTCAGCCGCCTCTCTCCGCCCCGGGTCGCAGTCGCTAGTGCTGCGTTTGGGC
hide sequence
RefSeq Acc Id:
XM_006238801 ⟹ XP_006238863
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 140,847,835 - 140,863,928 (+) NCBI mRatBN7.2 5 135,563,143 - 135,578,985 (+) NCBI Rnor_6.0 5 140,978,894 - 140,994,732 (+) NCBI Rnor_5.0 5 144,768,558 - 144,784,395 (+) NCBI
Sequence:
GACTGCGCCCAGGTCGCGAGGCGCCCTTCGACCAGCAGCGCCCGGGGCGGGAGGGTATAAATGG
hide sequence
RefSeq Acc Id:
XM_039109613 ⟹ XP_038965541
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 140,847,835 - 140,864,089 (+) NCBI mRatBN7.2 5 135,563,143 - 135,578,985 (+) NCBI
RefSeq Acc Id:
XM_039109614 ⟹ XP_038965542
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 140,854,787 - 140,863,928 (+) NCBI mRatBN7.2 5 135,569,685 - 135,578,985 (+) NCBI
RefSeq Acc Id:
XM_063287433 ⟹ XP_063143503
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 140,847,835 - 140,864,089 (+) NCBI
RefSeq Acc Id:
XM_063287434 ⟹ XP_063143504
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 140,847,835 - 140,864,089 (+) NCBI
RefSeq Acc Id:
NP_001094008 ⟸ NM_001100538
- UniProtKB:
A0A8J8XGC4 (UniProtKB/TrEMBL), A6IS24 (UniProtKB/TrEMBL)
- Sequence:
MNAAASSYPMASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFSAFGNILSC
hide sequence
RefSeq Acc Id:
XP_006238860 ⟸ XM_006238798
- Peptide Label:
isoform X1
- UniProtKB:
B2GUY3 (UniProtKB/TrEMBL), G3V9N0 (UniProtKB/TrEMBL), A6IS26 (UniProtKB/TrEMBL), A6IS24 (UniProtKB/TrEMBL)
- Sequence:
MNAAASSYPMASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPAD
hide sequence
RefSeq Acc Id:
XP_006238861 ⟸ XM_006238799
- Peptide Label:
isoform X2
- UniProtKB:
A6IS25 (UniProtKB/TrEMBL), A6IS24 (UniProtKB/TrEMBL)
- Sequence:
MNAAASSYPMASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFSAFGNILSC
hide sequence
RefSeq Acc Id:
XP_006238862 ⟸ XM_006238800
- Peptide Label:
isoform X4
- UniProtKB:
A6IS24 (UniProtKB/TrEMBL)
- Sequence:
MNAAASSYPMASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPAD
hide sequence
RefSeq Acc Id:
XP_006238863 ⟸ XM_006238801
- Peptide Label:
isoform X6
- UniProtKB:
A6IS24 (UniProtKB/TrEMBL)
- Sequence:
MNAAASSYPMASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPAD
hide sequence
Ensembl Acc Id:
ENSRNOP00000053432 ⟸ ENSRNOT00000056592
RefSeq Acc Id:
XP_038965541 ⟸ XM_039109613
- Peptide Label:
isoform X5
- UniProtKB:
A6IS24 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038965542 ⟸ XM_039109614
- Peptide Label:
isoform X8
- UniProtKB:
Q5I0G7 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000090731 ⟸ ENSRNOT00000106428
RefSeq Acc Id:
XP_063143503 ⟸ XM_063287433
- Peptide Label:
isoform X3
- UniProtKB:
A6IS24 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063143504 ⟸ XM_063287434
- Peptide Label:
isoform X7
- UniProtKB:
A6IS24 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2009-12-15
Pabpc4
poly(A) binding protein, cytoplasmic 4
Pabpc4
poly A binding protein, cytoplasmic 4
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Pabpc4
poly A binding protein, cytoplasmic 4
Pabpc4_predicted
poly A binding protein, cytoplasmic 4 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Pabpc4_predicted
poly A binding protein, cytoplasmic 4 (predicted)
Symbol and Name status set to approved
70820 APPROVED
