Symbol:
Pfas
Name:
phosphoribosylformylglycinamidine synthase
RGD ID:
1304926
Description:
Predicted to enable phosphoribosylformylglycinamidine synthase activity. Involved in glutamine metabolic process and response to xenobiotic stimulus. Predicted to be active in cytoplasm. Biomarker of hepatocellular carcinoma. Orthologous to human PFAS (phosphoribosylformylglycinamidine synthase); PARTICIPATES IN adenine phoshoribosyltransferase deficiency pathway; adenosine monophosphate deaminase deficiency pathway; adenylosuccinate lyase deficiency pathway; INTERACTS WITH 6-propyl-2-thiouracil; amphetamine; bisphenol A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
FGAM synthetase; LOC287420; phosphoribosylformylglycinamidine synthase (FGAR amidotransferase); similar to phosphoribosylformylglycinamidine synthase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 54,189,157 - 54,210,685 (-) NCBI GRCr8 mRatBN7.2 10 53,690,301 - 53,711,811 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 53,691,626 - 53,708,420 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 58,352,061 - 58,370,245 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 57,840,655 - 57,858,839 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 53,349,123 - 53,367,092 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 55,571,881 - 55,593,384 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 55,571,118 - 55,589,978 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 55,314,680 - 55,336,185 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 55,745,617 - 55,761,944 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 55,759,631 - 55,771,591 (-) NCBI Celera 10 52,858,284 - 52,874,638 (-) NCBI Celera Cytogenetic Map 10 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pfas Rat (-)-demecolcine decreases expression ISO RGD:1312648 6480464 Demecolcine results in decreased expression of PFAS mRNA CTD PMID:23649840 Pfas Rat 1,2-dichloroethane increases expression ISO RGD:1614154 6480464 ethylene dichloride results in increased expression of PFAS mRNA CTD PMID:28960355 Pfas Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1614154 6480464 1,2-Dimethylhydrazine results in decreased expression of PFAS mRNA CTD PMID:22206623 Pfas Rat 17beta-estradiol multiple interactions ISO RGD:1312648 6480464 [Progesterone co-treated with Estradiol] results in decreased expression of PFAS mRNA CTD PMID:17404688 Pfas Rat 17beta-estradiol increases expression ISO RGD:1312648 6480464 Estradiol results in increased expression of PFAS mRNA CTD PMID:23019147|PMID:31614463 Pfas Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO RGD:1312648 6480464 2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of PFAS protein CTD PMID:31675489 Pfas Rat 2,3',4,4',5-Pentachlorobiphenyl decreases expression ISO RGD:1614154 6480464 2,3',4,4',5-pentachlorobiphenyl results in decreased expression of PFAS mRNA CTD PMID:31388691 Pfas Rat 2,4,6-tribromophenol decreases expression ISO RGD:1312648 6480464 2,4,6-tribromophenol results in decreased expression of PFAS mRNA CTD PMID:31675489 Pfas Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO RGD:1312648 6480464 tetrabromobisphenol A results in decreased expression of PFAS protein CTD PMID:31675489 Pfas Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:1614154 6480464 bisphenol S results in decreased expression of PFAS mRNA CTD PMID:39298647 Pfas Rat 4,4'-sulfonyldiphenol decreases methylation ISO RGD:1614154 6480464 bisphenol S results in decreased methylation of PFAS promoter CTD PMID:33297965 Pfas Rat 5-aza-2'-deoxycytidine affects expression ISO RGD:1312648 6480464 Decitabine affects the expression of PFAS mRNA CTD PMID:23300844 Pfas Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of PFAS mRNA CTD PMID:30047161 Pfas Rat acrylamide decreases expression ISO RGD:1312648 6480464 Acrylamide results in decreased expression of PFAS mRNA CTD PMID:32763439 Pfas Rat aflatoxin B1 decreases methylation ISO RGD:1312648 6480464 Aflatoxin B1 results in decreased methylation of PFAS gene CTD PMID:27153756 Pfas Rat all-trans-retinoic acid decreases expression ISO RGD:1312648 6480464 Tretinoin results in decreased expression of PFAS mRNA CTD PMID:33167477 Pfas Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of PFAS mRNA CTD PMID:30779732 Pfas Rat arsane affects methylation ISO RGD:1312648 6480464 Arsenic affects the methylation of PFAS gene CTD PMID:25304211 Pfas Rat arsenic atom affects methylation ISO RGD:1312648 6480464 Arsenic affects the methylation of PFAS gene CTD PMID:25304211 Pfas Rat arsenite(3-) multiple interactions ISO RGD:1312648 6480464 arsenite inhibits the reaction [G3BP1 protein binds to PFAS mRNA] CTD PMID:32406909 Pfas Rat arsenous acid increases expression ISO RGD:1312648 6480464 Arsenic Trioxide results in increased expression of PFAS mRNA CTD PMID:25555879 Pfas Rat arsenous acid multiple interactions ISO RGD:1312648 6480464 [Arsenic Trioxide co-treated with Ascorbic Acid] results in increased expression of PFAS mRNA CTD PMID:25555879 Pfas Rat atrazine decreases expression ISO RGD:1312648 6480464 Atrazine results in decreased expression of PFAS mRNA CTD PMID:22378314 Pfas Rat benzo[a]pyrene decreases expression ISO RGD:1312648 6480464 Benzo(a)pyrene results in decreased expression of PFAS mRNA CTD PMID:20064835 Pfas Rat bis(2-chloroethyl) sulfide decreases expression ISO RGD:1312648 6480464 Mustard Gas results in decreased expression of PFAS mRNA CTD PMID:25102026 Pfas Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of PFAS mRNA CTD PMID:25181051 Pfas Rat bisphenol A increases expression ISO RGD:1614154 6480464 bisphenol A results in increased expression of PFAS mRNA CTD PMID:33221593 Pfas Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PFAS mRNA CTD PMID:32145629 Pfas Rat bisphenol A decreases expression ISO RGD:1312648 6480464 bisphenol A results in decreased expression of PFAS mRNA; bisphenol A results in decreased expression more ... CTD PMID:29275510|PMID:31675489|PMID:37567409 Pfas Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PFAS mRNA CTD PMID:30816183|PMID:32528016 Pfas Rat bisphenol AF increases expression ISO RGD:1312648 6480464 bisphenol AF results in increased expression of PFAS protein CTD PMID:34186270 Pfas Rat Bisphenol B increases expression ISO RGD:1312648 6480464 bisphenol B results in increased expression of PFAS protein CTD PMID:34186270 Pfas Rat bisphenol F increases expression ISO RGD:1312648 6480464 bisphenol F results in increased expression of PFAS protein CTD PMID:34186270 Pfas Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of PFAS mRNA CTD PMID:19167457 Pfas Rat calcitriol decreases expression ISO RGD:1312648 6480464 Calcitriol results in decreased expression of PFAS mRNA CTD PMID:21592394 Pfas Rat calcitriol multiple interactions ISO RGD:1312648 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of PFAS mRNA CTD PMID:21592394 Pfas Rat carbon nanotube increases expression ISO RGD:1614154 6480464 Nanotubes, Carbon results in increased expression of PFAS mRNA CTD PMID:25554681 Pfas Rat CGP 52608 multiple interactions ISO RGD:1312648 6480464 CGP 52608 promotes the reaction [RORA protein binds to PFAS gene] CTD PMID:28238834 Pfas Rat chlorpyrifos decreases expression ISO RGD:1614154 6480464 Chlorpyrifos results in decreased expression of PFAS mRNA CTD PMID:37019170 Pfas Rat cisplatin affects expression ISO RGD:1312648 6480464 Cisplatin affects the expression of PFAS mRNA CTD PMID:23300844 Pfas Rat cisplatin decreases expression ISO RGD:1312648 6480464 Cisplatin results in decreased expression of PFAS mRNA CTD PMID:27594783 Pfas Rat cobalt dichloride decreases expression ISO RGD:1312648 6480464 cobaltous chloride results in decreased expression of PFAS mRNA CTD PMID:19376846 Pfas Rat copper atom multiple interactions ISO RGD:1312648 6480464 [NSC 689534 binds to Copper] which results in decreased expression of PFAS mRNA CTD PMID:20971185 Pfas Rat copper(0) multiple interactions ISO RGD:1312648 6480464 [NSC 689534 binds to Copper] which results in decreased expression of PFAS mRNA CTD PMID:20971185 Pfas Rat cyclosporin A decreases expression ISO RGD:1312648 6480464 Cyclosporine results in decreased expression of PFAS mRNA CTD PMID:25562108 Pfas Rat DDE increases expression ISO RGD:1312648 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of PFAS mRNA CTD PMID:38568856 Pfas Rat decabromodiphenyl ether decreases expression ISO RGD:1312648 6480464 decabromobiphenyl ether results in decreased expression of PFAS protein CTD PMID:31675489 Pfas Rat diarsenic trioxide increases expression ISO RGD:1312648 6480464 Arsenic Trioxide results in increased expression of PFAS mRNA CTD PMID:25555879 Pfas Rat diarsenic trioxide multiple interactions ISO RGD:1312648 6480464 [Arsenic Trioxide co-treated with Ascorbic Acid] results in increased expression of PFAS mRNA CTD PMID:25555879 Pfas Rat dibutyl phthalate decreases expression ISO RGD:1614154 6480464 Dibutyl Phthalate results in decreased expression of PFAS mRNA CTD PMID:17361019|PMID:21266533 Pfas Rat dicrotophos increases expression ISO RGD:1312648 6480464 dicrotophos results in increased expression of PFAS mRNA CTD PMID:28302478 Pfas Rat dioxygen decreases expression ISO RGD:1312648 6480464 Oxygen deficiency results in decreased expression of PFAS mRNA CTD PMID:26516004 Pfas Rat doxorubicin decreases expression ISO RGD:1312648 6480464 Doxorubicin results in decreased expression of PFAS mRNA CTD PMID:29803840 Pfas Rat enzyme inhibitor multiple interactions ISO RGD:1312648 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 Pfas Rat ethyl methanesulfonate decreases expression ISO RGD:1312648 6480464 Ethyl Methanesulfonate results in decreased expression of PFAS mRNA CTD PMID:23649840 Pfas Rat folic acid decreases expression ISO RGD:1614154 6480464 Folic Acid results in decreased expression of PFAS mRNA CTD PMID:25629700 Pfas Rat formaldehyde decreases expression ISO RGD:1312648 6480464 Formaldehyde results in decreased expression of PFAS mRNA CTD PMID:23649840 Pfas Rat furan decreases expression EXP 6480464 furan results in decreased expression of PFAS mRNA CTD PMID:25539665 Pfas Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of PFAS mRNA CTD PMID:33387578 Pfas Rat GSK-J4 decreases expression ISO RGD:1312648 6480464 GSK-J4 results in decreased expression of PFAS mRNA CTD PMID:29301935 Pfas Rat ivermectin decreases expression ISO RGD:1312648 6480464 Ivermectin results in decreased expression of PFAS protein CTD PMID:32959892 Pfas Rat L-ascorbic acid multiple interactions ISO RGD:1312648 6480464 [arsenic trioxide co-treated with Ascorbic Acid] results in increased expression of PFAS mRNA CTD PMID:25555879 Pfas Rat L-ascorbic acid increases expression ISO RGD:1312648 6480464 Ascorbic Acid results in increased expression of PFAS mRNA CTD PMID:25555879 Pfas Rat methidathion decreases expression ISO RGD:1614154 6480464 methidathion results in decreased expression of PFAS mRNA CTD PMID:34813904 Pfas Rat methotrexate affects response to substance ISO RGD:1312648 6480464 PFAS gene mutant form affects the susceptibility to Methotrexate CTD PMID:19426680 Pfas Rat methyl methanesulfonate decreases expression ISO RGD:1312648 6480464 Methyl Methanesulfonate results in decreased expression of PFAS mRNA CTD PMID:23649840 Pfas Rat methylmercury chloride decreases expression ISO RGD:1312648 6480464 methylmercuric chloride results in decreased expression of PFAS mRNA CTD PMID:28001369 Pfas Rat mono(2-ethyl-5-hydroxyhexyl) phthalate multiple interactions ISO RGD:1312648 6480464 [mono(2-ethyl-5-hydroxyhexyl) phthalate co-treated with mono-(2-ethylhexyl)phthalate co-treated with mono(2-ethyl-5-oxohexyl)phthalate co-treated with 2-ethyl-5-carboxypentyl phthalate co-treated with mono-isobutyl more ... CTD PMID:37160244 Pfas Rat mono(2-ethyl-5-oxohexyl) phthalate multiple interactions ISO RGD:1312648 6480464 [mono(2-ethyl-5-hydroxyhexyl) phthalate co-treated with mono-(2-ethylhexyl)phthalate co-treated with mono(2-ethyl-5-oxohexyl)phthalate co-treated with 2-ethyl-5-carboxypentyl phthalate co-treated with mono-isobutyl more ... CTD PMID:37160244 Pfas Rat mono(2-ethylhexyl) phthalate multiple interactions ISO RGD:1312648 6480464 [mono(2-ethyl-5-hydroxyhexyl) phthalate co-treated with mono-(2-ethylhexyl)phthalate co-treated with mono(2-ethyl-5-oxohexyl)phthalate co-treated with 2-ethyl-5-carboxypentyl phthalate co-treated with mono-isobutyl more ... CTD PMID:37160244 Pfas Rat mono(5-carboxy-2-ethylpentyl) phthalate multiple interactions ISO RGD:1312648 6480464 [mono(2-ethyl-5-hydroxyhexyl) phthalate co-treated with mono-(2-ethylhexyl)phthalate co-treated with mono(2-ethyl-5-oxohexyl)phthalate co-treated with 2-ethyl-5-carboxypentyl phthalate co-treated with mono-isobutyl more ... CTD PMID:37160244 Pfas Rat monobenzyl phthalate multiple interactions ISO RGD:1312648 6480464 [mono(2-ethyl-5-hydroxyhexyl) phthalate co-treated with mono-(2-ethylhexyl)phthalate co-treated with mono(2-ethyl-5-oxohexyl)phthalate co-treated with 2-ethyl-5-carboxypentyl phthalate co-treated with mono-isobutyl more ... CTD PMID:37160244 Pfas Rat Monobutylphthalate multiple interactions ISO RGD:1312648 6480464 [mono(2-ethyl-5-hydroxyhexyl) phthalate co-treated with mono-(2-ethylhexyl)phthalate co-treated with mono(2-ethyl-5-oxohexyl)phthalate co-treated with 2-ethyl-5-carboxypentyl phthalate co-treated with mono-isobutyl more ... CTD PMID:37160244 Pfas Rat monoethyl phthalate multiple interactions ISO RGD:1312648 6480464 [mono(2-ethyl-5-hydroxyhexyl) phthalate co-treated with mono-(2-ethylhexyl)phthalate co-treated with mono(2-ethyl-5-oxohexyl)phthalate co-treated with 2-ethyl-5-carboxypentyl phthalate co-treated with mono-isobutyl more ... CTD PMID:37160244 Pfas Rat nickel dichloride decreases expression ISO RGD:1312648 6480464 nickel chloride results in decreased expression of PFAS mRNA CTD PMID:17312168 Pfas Rat oxaliplatin decreases expression EXP 6480464 oxaliplatin results in decreased expression of PFAS mRNA CTD PMID:25729387 Pfas Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of PFAS mRNA CTD PMID:25729387 Pfas Rat p-toluidine increases expression EXP 6480464 4-toluidine results in increased expression of PFAS mRNA CTD PMID:27638505 Pfas Rat paracetamol decreases expression ISO RGD:1312648 6480464 Acetaminophen results in decreased expression of PFAS mRNA CTD PMID:21420995 Pfas Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of PFAS mRNA CTD PMID:33387578 Pfas Rat potassium chromate increases expression ISO RGD:1312648 6480464 potassium chromate(VI) results in increased expression of PFAS mRNA CTD PMID:22714537 Pfas Rat progesterone multiple interactions ISO RGD:1312648 6480464 [Progesterone co-treated with Estradiol] results in decreased expression of PFAS mRNA CTD PMID:17404688 Pfas Rat S-butyl-DL-homocysteine (S,R)-sulfoximine increases expression EXP 6480464 Buthionine Sulfoximine results in increased expression of PFAS protein CTD PMID:23736079 Pfas Rat SB 431542 multiple interactions ISO RGD:1312648 6480464 [LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of PFAS more ... CTD PMID:37664457 Pfas Rat silicon dioxide increases expression ISO RGD:1312648 6480464 Silicon Dioxide analog results in increased expression of PFAS mRNA CTD PMID:25895662 Pfas Rat sodium arsenite decreases expression ISO RGD:1312648 6480464 sodium arsenite results in decreased expression of PFAS mRNA CTD PMID:38568856 Pfas Rat sodium arsenite increases expression ISO RGD:1312648 6480464 sodium arsenite results in increased expression of PFAS mRNA CTD PMID:34032870 Pfas Rat sunitinib increases expression ISO RGD:1312648 6480464 Sunitinib results in increased expression of PFAS mRNA CTD PMID:31533062 Pfas Rat temozolomide increases expression ISO RGD:1312648 6480464 Temozolomide results in increased expression of PFAS mRNA CTD PMID:31758290 Pfas Rat testosterone multiple interactions ISO RGD:1312648 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of PFAS mRNA CTD PMID:21592394 Pfas Rat testosterone decreases expression ISO RGD:1312648 6480464 Testosterone results in decreased expression of PFAS mRNA CTD PMID:21592394 Pfas Rat tetrachloromethane increases expression ISO RGD:1614154 6480464 Carbon Tetrachloride results in increased expression of PFAS mRNA CTD PMID:31919559 Pfas Rat thapsigargin decreases expression ISO RGD:1312648 6480464 Thapsigargin results in decreased expression of PFAS mRNA CTD PMID:22378314 Pfas Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PFAS mRNA CTD PMID:34492290 Pfas Rat titanium dioxide decreases methylation ISO RGD:1614154 6480464 titanium dioxide results in decreased methylation of PFAS gene CTD PMID:35295148 Pfas Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of PFAS mRNA CTD PMID:25729387 Pfas Rat trimellitic anhydride increases expression ISO RGD:1614154 6480464 trimellitic anhydride results in increased expression of PFAS mRNA CTD PMID:19042947 Pfas Rat triphenyl phosphate affects expression ISO RGD:1312648 6480464 triphenyl phosphate affects the expression of PFAS mRNA CTD PMID:37042841 Pfas Rat tunicamycin decreases expression ISO RGD:1312648 6480464 Tunicamycin results in decreased expression of PFAS mRNA CTD PMID:22378314 Pfas Rat urethane decreases expression ISO RGD:1312648 6480464 Urethane results in decreased expression of PFAS mRNA CTD PMID:28818685 Pfas Rat valproic acid decreases expression ISO RGD:1312648 6480464 Valproic Acid results in decreased expression of PFAS mRNA CTD PMID:29154799 Pfas Rat valproic acid increases expression ISO RGD:1312648 6480464 Valproic Acid results in increased expression of PFAS mRNA CTD PMID:23179753 Pfas Rat vincristine decreases expression ISO RGD:1312648 6480464 Vincristine results in decreased expression of PFAS mRNA CTD PMID:23649840
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(-)-demecolcine (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,4,6-tribromophenol (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) amphetamine (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (ISO) benzo[a]pyrene (ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) C60 fullerene (EXP) calcitriol (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) cisplatin (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) cyclosporin A (ISO) DDE (ISO) decabromodiphenyl ether (ISO) diarsenic trioxide (ISO) dibutyl phthalate (ISO) dicrotophos (ISO) dioxygen (ISO) doxorubicin (ISO) enzyme inhibitor (ISO) ethyl methanesulfonate (ISO) folic acid (ISO) formaldehyde (ISO) furan (EXP) gentamycin (EXP) GSK-J4 (ISO) ivermectin (ISO) L-ascorbic acid (ISO) methidathion (ISO) methotrexate (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) mono(2-ethyl-5-hydroxyhexyl) phthalate (ISO) mono(2-ethyl-5-oxohexyl) phthalate (ISO) mono(2-ethylhexyl) phthalate (ISO) mono(5-carboxy-2-ethylpentyl) phthalate (ISO) monobenzyl phthalate (ISO) Monobutylphthalate (ISO) monoethyl phthalate (ISO) nickel dichloride (ISO) oxaliplatin (EXP) p-toluidine (EXP) paracetamol (EXP,ISO) potassium chromate (ISO) progesterone (ISO) S-butyl-DL-homocysteine (S,R)-sulfoximine (EXP) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sunitinib (ISO) temozolomide (ISO) testosterone (ISO) tetrachloromethane (ISO) thapsigargin (ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) trimellitic anhydride (ISO) triphenyl phosphate (ISO) tunicamycin (ISO) urethane (ISO) valproic acid (ISO) vincristine (ISO)
Pfas Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 54,189,157 - 54,210,685 (-) NCBI GRCr8 mRatBN7.2 10 53,690,301 - 53,711,811 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 53,691,626 - 53,708,420 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 58,352,061 - 58,370,245 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 57,840,655 - 57,858,839 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 53,349,123 - 53,367,092 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 55,571,881 - 55,593,384 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 55,571,118 - 55,589,978 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 55,314,680 - 55,336,185 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 55,745,617 - 55,761,944 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 55,759,631 - 55,771,591 (-) NCBI Celera 10 52,858,284 - 52,874,638 (-) NCBI Celera Cytogenetic Map 10 q24 NCBI
PFAS Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 8,247,608 - 8,270,486 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 8,247,618 - 8,270,491 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 8,152,607 - 8,173,804 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 8,093,362 - 8,114,528 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 8,093,361 - 8,114,528 NCBI Celera 17 8,181,466 - 8,202,639 (+) NCBI Celera Cytogenetic Map 17 p13.1 NCBI HuRef 17 8,048,239 - 8,069,519 (+) NCBI HuRef CHM1_1 17 8,161,523 - 8,182,731 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 8,153,834 - 8,176,708 (+) NCBI T2T-CHM13v2.0
Pfas Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 68,876,527 - 68,899,286 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 68,876,523 - 68,899,286 (-) Ensembl GRCm39 Ensembl GRCm38 11 68,985,701 - 69,008,460 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 68,985,697 - 69,008,460 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 68,799,203 - 68,821,962 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 68,803,482 - 68,824,649 (-) NCBI MGSCv36 mm8 Celera 11 75,928,697 - 75,951,460 (-) NCBI Celera Cytogenetic Map 11 B3 NCBI cM Map 11 42.26 NCBI
Pfas Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955467 8,640,044 - 8,660,979 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955467 8,640,044 - 8,660,950 (-) NCBI ChiLan1.0 ChiLan1.0
PFAS Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 65,484,101 - 65,504,296 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 70,293,598 - 70,313,731 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 43,389,389 - 43,409,454 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 48,121,601 - 48,141,728 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 48,121,606 - 48,141,720 (-) Ensembl panpan1.1 panPan2
PFAS Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 33,055,144 - 33,076,823 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 33,060,929 - 33,076,287 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 33,191,282 - 33,212,476 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 33,158,221 - 33,179,437 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 33,162,526 - 33,179,478 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 33,124,973 - 33,146,201 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 33,080,723 - 33,102,164 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 33,260,701 - 33,281,894 (+) NCBI UU_Cfam_GSD_1.0
Pfas Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 48,009,422 - 48,025,476 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936595 1,483,689 - 1,501,364 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936595 1,483,688 - 1,499,716 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PFAS
PFAS Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 7,618,952 - 7,639,700 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 7,623,817 - 7,638,594 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 13,760,889 - 13,781,648 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pfas
.
Predicted Target Of
Count of predictions: 280 Count of miRNA genes: 182 Interacting mature miRNAs: 208 Transcripts: ENSRNOT00000007087 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61441 Btemp1 Thermal response to stress QTL 1 4 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 10 35392457 63642539 Rat 1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 152025229 Scl83 Serum cholesterol level QTL 83 4.33 blood cholesterol amount (VT:0000180) 10 35710580 68663659 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 152025227 Bw195 Body weight QTL 195 5.73 body mass (VT:0001259) 10 46989699 68663659 Rat 631564 Apr3 Acute phase response QTL 3 3.9 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 10 15275955 60275955 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 2293669 Bmd33 Bone mineral density QTL 33 4.5 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 10 49444551 81709989 Rat 152025224 Bw193 Body weight QTL 193 6.47 body mass (VT:0001259) 10 51663405 75085664 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 2293679 Bmd30 Bone mineral density QTL 30 3.5 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 1578762 Toxo1 Toxoplasma gondii resistance QTL 1 brain integrity trait (VT:0010579) percentage of study population displaying Toxoplasma gondii brain cysts at a point in time (CMO:0002028) 10 52200030 59378278 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 1581497 Esta1 Estrogen-induced thymic atrophy QTL 1 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 21329805 61345413 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 1358897 Stresp6 Stress response QTL 6 4.17 0.022 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 35392267 64155584 Rat 1331762 Rf40 Renal function QTL 40 3.873 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 10 29299504 64155584 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2293652 Bmd22 Bone mineral density QTL 22 4.9 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 6893352 Bw100 Body weight QTL 100 0.33 0.6 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 1354587 Kidm21 Kidney mass QTL 21 3.3 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 10 15028513 60430477 Rat 6893350 Bw99 Body weight QTL 99 0.87 0.16 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 70224 Eae3 Experimental allergic encephalomyelitis QTL 3 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 26521957 61345413 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 8552805 Bw145 Body weight QTL 145 2.2 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 10 41944526 78307017 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2293705 Bmd25 Bone mineral density QTL 25 7.1 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 49444551 81709989 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 7207811 Bmd90 Bone mineral density QTL 90 5.2 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 10 49444551 81709989 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 6893342 Cm78 Cardiac mass QTL 78 0.1 0.88 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 42876766 79813922 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000007087 ⟹ ENSRNOP00000007087
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 53,691,626 - 53,708,420 (-) Ensembl Rnor_6.0 Ensembl 10 55,573,651 - 55,589,978 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000080769 ⟹ ENSRNOP00000068779
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 10 55,571,118 - 55,586,034 (-) Ensembl
RefSeq Acc Id:
NM_001395097 ⟹ NP_001382026
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 54,189,157 - 54,207,272 (-) NCBI mRatBN7.2 10 53,690,301 - 53,708,420 (-) NCBI
RefSeq Acc Id:
XM_006246610 ⟹ XP_006246672
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 54,190,220 - 54,210,684 (-) NCBI mRatBN7.2 10 53,690,301 - 53,711,811 (-) NCBI Rnor_6.0 10 55,571,881 - 55,593,384 (-) NCBI Rnor_5.0 10 55,314,680 - 55,336,185 (-) NCBI
Sequence:
CAATTGCTGGGCGAAGGTGGGACTTCCGAGTCCCATTAAAGTATCAGACACCAAAAGAAGAGAGTTTCCACCAGACTTTGGAACAAGAAGGACACAACAACCATGTTTCACTGTACATCCTTAACTGG
hide sequence
RefSeq Acc Id:
XM_006246611 ⟹ XP_006246673
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 54,190,220 - 54,210,684 (-) NCBI mRatBN7.2 10 53,692,347 - 53,711,811 (-) NCBI Rnor_6.0 10 55,573,927 - 55,593,384 (-) NCBI Rnor_5.0 10 55,314,680 - 55,336,185 (-) NCBI
Sequence:
CAATTGCTGGGCGAAGGTGGGACTTCCGAGTCCCATTAAAGTATCAGACACCAAAAGAAGAGAGTTTCCACCAGACTTTGGAACAAGAAGGACACAACAACCATGTTTCACTGTACATCCTTAACTGG
hide sequence
RefSeq Acc Id:
XM_006246612 ⟹ XP_006246674
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 54,190,220 - 54,210,648 (-) NCBI mRatBN7.2 10 53,692,347 - 53,711,778 (-) NCBI Rnor_6.0 10 55,573,927 - 55,593,380 (-) NCBI Rnor_5.0 10 55,314,680 - 55,336,185 (-) NCBI
Sequence:
TGCTGGGCGAAGGTGGGACTTCCGAGTCCCATTAAAGTATCAGACACCAAAAGAAGAGAGTTTC
hide sequence
RefSeq Acc Id:
XM_063268632 ⟹ XP_063124702
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 54,190,220 - 54,210,592 (-) NCBI
RefSeq Acc Id:
XM_063268633 ⟹ XP_063124703
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 54,190,220 - 54,210,514 (-) NCBI
RefSeq Acc Id:
XM_063268634 ⟹ XP_063124704
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 54,195,400 - 54,210,685 (-) NCBI
RefSeq Acc Id:
XP_006246674 ⟸ XM_006246612
- Peptide Label:
isoform X2
- UniProtKB:
A6HFM5 (UniProtKB/TrEMBL)
- Sequence:
MKKLLWLFGCPLLQDDVARESWLVPGSNDLLLEVGPRLNFSTPASTNIVSVCQAAGLRAVDRVETTRRYRLSFAKQPTAEMEAISLAALHDRMTEQHYPDPIQSFSPQSIPAPLKDSINILAEGRPAL
hide sequence
RefSeq Acc Id:
XP_006246673 ⟸ XM_006246611
- Peptide Label:
isoform X2
- UniProtKB:
A6HFM5 (UniProtKB/TrEMBL)
- Sequence:
MKKLLWLFGCPLLQDDVARESWLVPGSNDLLLEVGPRLNFSTPASTNIVSVCQAAGLRAVDRVE
hide sequence
RefSeq Acc Id:
XP_006246672 ⟸ XM_006246610
- Peptide Label:
isoform X1
- UniProtKB:
D4AB17 (UniProtKB/TrEMBL), A6HFM5 (UniProtKB/TrEMBL)
- Sequence:
MAPVLHFYVRPSGHEGAASGHVLRRLQEKLPTLQNVETELCYNVHWAAETLPWAEEMKKLLWLFGCPLLQDDVARESWLVPGSNDLLLEVGPRLNFSTPASTNIVSVCQAAGLRAVDRVETTRRYRLS
hide sequence
Ensembl Acc Id:
ENSRNOP00000068779 ⟸ ENSRNOT00000080769
Ensembl Acc Id:
ENSRNOP00000007087 ⟸ ENSRNOT00000007087
RefSeq Acc Id:
NP_001382026 ⟸ NM_001395097
- UniProtKB:
D4AB17 (UniProtKB/TrEMBL), A6HFM5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063124702 ⟸ XM_063268632
- Peptide Label:
isoform X1
- UniProtKB:
A6HFM5 (UniProtKB/TrEMBL), D4AB17 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063124703 ⟸ XM_063268633
- Peptide Label:
isoform X1
- UniProtKB:
A6HFM5 (UniProtKB/TrEMBL), D4AB17 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063124704 ⟸ XM_063268634
- Peptide Label:
isoform X3
RGD ID: 13697305 Promoter ID: EPDNEW_R7827 Type: multiple initiation site Name: Pfas_1 Description: phosphoribosylformylglycinamidine synthase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 55,589,993 - 55,590,053 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-05-24
Pfas
phosphoribosylformylglycinamidine synthase
LOC687570
similar to phosphoribosylformylglycinamidine synthase
Data merged from RGD:1584195
1643240 APPROVED
2009-02-26
Pfas
phosphoribosylformylglycinamidine synthase
Pfas
phosphoribosylformylglycinamidine synthase (FGAR amidotransferase)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Pfas
phosphoribosylformylglycinamidine synthase (FGAR amidotransferase)
Pfas_predicted
phosphoribosylformylglycinamidine synthase (FGAR amidotransferase) (predicted)
'predicted' is removed
2292626 APPROVED
2008-01-09
Pfas_predicted
phosphoribosylformylglycinamidine synthase (FGAR amidotransferase) (predicted)
LOC687787
similar to Phosphoribosylformylglycinamidine synthase (FGAM synthase) (FGAMS) (Formylglycinamide ribotide amidotransferase) (FGARAT) (Formylglycinamide ribotide synthetase)
Data merged from RGD:1597498
1643240 APPROVED
2006-11-20
LOC687787
similar to Phosphoribosylformylglycinamidine synthase (FGAM synthase) (FGAMS) (Formylglycinamide ribotide amidotransferase) (FGARAT) (Formylglycinamide ribotide synthetase)
Symbol and Name status set to provisional
70820 PROVISIONAL
2006-11-19
LOC687570
similar to phosphoribosylformylglycinamidine synthase
Symbol and Name status set to provisional
70820 PROVISIONAL
2005-01-12
Pfas_predicted
phosphoribosylformylglycinamidine synthase (FGAR amidotransferase) (predicted)
Symbol and Name status set to approved
70820 APPROVED
