Symbol:
Msh6
Name:
mutS homolog 6
RGD ID:
12581863
Description:
ENCODES a protein that exhibits guanine/thymine mispair binding (ortholog); protein homodimerization activity (ortholog); INVOLVED IN maintenance of DNA repeat elements (ortholog); mismatch repair (ortholog); spermatogenesis (ortholog); PARTICIPATES IN altered mismatch repair pathway; colorectal cancer pathway; endometrial cancer pathway; ASSOCIATED WITH ataxia telangiectasia (ortholog); autosomal recessive limb-girdle muscular dystrophy type 2B (ortholog); autosomal recessive progressive external ophthalmoplegia 1 (ortholog); FOUND IN chromatin (inferred); cytosol (inferred); Golgi apparatus (inferred)
Type:
protein-coding
RefSeq Status:
MODEL
Previously known as:
DNA mismatch repair protein Msh6
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MSH6 (mutS homolog 6) NCBI
Ortholog
Mus musculus (house mouse):
Msh6 (mutS homolog 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Rattus norvegicus (Norway rat):
Msh6 (mutS homolog 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Msh6 (mutS homolog 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MSH6 (mutS homolog 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MSH6 (mutS homolog 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MSH6 (mutS homolog 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MSH6 (mutS homolog 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Msh6 (mutS homolog 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Latest Assembly:
SpeTri2.0 - Squirrel SpeTri2.0 Assembly
Position:
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024406292 33,280,052 - 33,300,065 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936508 4,708,661 - 4,728,787 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936508 4,708,661 - 4,728,671 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Msh6 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024406292 33,280,052 - 33,300,065 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936508 4,708,661 - 4,728,787 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936508 4,708,661 - 4,728,671 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MSH6 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 47,783,145 - 47,810,101 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 47,695,530 - 47,810,063 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 48,010,284 - 48,037,240 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 47,863,725 - 47,887,596 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 47,921,936 - 47,945,743 NCBI Celera 2 47,849,755 - 47,873,614 (+) NCBI Celera Cytogenetic Map 2 p16.3 NCBI HuRef 2 47,746,516 - 47,770,575 (+) NCBI HuRef CHM1_1 2 47,940,665 - 47,964,487 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 47,789,083 - 47,816,050 (+) NCBI T2T-CHM13v2.0
Msh6 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 88,282,478 - 88,298,320 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 88,282,490 - 88,298,320 (+) Ensembl GRCm39 Ensembl GRCm38 17 87,975,050 - 87,990,892 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 87,975,062 - 87,990,892 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 88,374,390 - 88,390,232 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 87,883,410 - 87,899,389 (+) NCBI MGSCv36 mm8 Celera 17 92,385,348 - 92,401,193 (+) NCBI Celera Cytogenetic Map 17 E4 NCBI cM Map 17 57.87 NCBI
Msh6 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 12,316,190 - 12,333,505 (-) NCBI GRCr8 mRatBN7.2 6 6,562,631 - 6,579,995 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 6,562,632 - 6,579,956 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 6,844,774 - 6,862,085 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 7,154,179 - 7,171,490 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 6,681,324 - 6,698,635 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 11,644,565 - 11,662,389 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 11,644,578 - 11,662,499 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 21,616,672 - 21,634,338 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 11,525,292 - 11,542,592 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 6 6,326,162 - 6,343,370 (-) NCBI Celera Cytogenetic Map 6 q12 NCBI
Msh6 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955441 14,451,307 - 14,471,227 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955441 14,451,207 - 14,471,316 (+) NCBI ChiLan1.0 ChiLan1.0
MSH6 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 12 78,578,235 - 78,603,381 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2A 78,582,203 - 78,607,350 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2A 47,901,591 - 47,926,662 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2A 48,824,469 - 48,849,779 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2A 48,824,350 - 48,849,779 (+) Ensembl panpan1.1 panPan2
MSH6 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 49,825,330 - 49,838,036 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 49,803,898 - 49,838,028 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 49,669,446 - 49,693,588 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 50,687,723 - 50,711,873 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 50,687,741 - 50,711,873 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 50,394,939 - 50,419,090 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 50,681,795 - 50,705,920 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 50,869,560 - 50,893,685 (+) NCBI UU_Cfam_GSD_1.0
MSH6 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 92,785,664 - 92,814,238 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 92,792,590 - 92,814,154 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 98,710,956 - 98,732,503 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MSH6 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 14 59,375,602 - 59,400,252 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 14 59,375,691 - 59,400,174 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 52,443,508 - 52,468,664 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Msh6
.
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSSTOT00000028714 ⟹ ENSSTOP00000016600
Type:
CODING
Position:
Squirrel Assembly Chr Position (strand) Source SpeTri2.0 Ensembl NW_004936508 4,708,661 - 4,728,787 (-) Ensembl
RefSeq Acc Id:
XM_005324480 ⟹ XP_005324537
Type:
CODING
Position:
Squirrel Assembly Chr Position (strand) Source HiC_Itri_2 NW_024406292 33,280,052 - 33,300,064 (-) NCBI SpeTri2.0 NW_004936508 4,708,661 - 4,728,670 (-) NCBI
Sequence:
CGCCTGCCGATTGGCCCCCCGGGCCAGGGTCCCTGAGGCTGAACGCGCCTCCCCCCGAGATTTCCCGCCAGCCGGAGCCGCGCGGTGGATGCGGAGTCTTTAAGCGATCCGCCCGTAGAACGGTTGGG
hide sequence
RefSeq Acc Id:
XM_013358255 ⟹ XP_013213709
Type:
CODING
Position:
Squirrel Assembly Chr Position (strand) Source HiC_Itri_2 NW_024406292 33,280,052 - 33,300,065 (-) NCBI SpeTri2.0 NW_004936508 4,708,661 - 4,728,671 (-) NCBI
Sequence:
GCGCCTGCCGATTGGCCCCCCGGGCCAGGGTCCCTGAGGCTGAACGCGCCTCCCCCCGAGATTTCCCGCCAGCCGGAGCCGCGCGGTGGATGCGGAGTCTTTAAGCGATCCGCCCGTAGAACGGTTGG
hide sequence
RefSeq Acc Id:
XP_013213709 ⟸ XM_013358255
- Peptide Label:
isoform X2
- Sequence:
MSRQSTLYSFFPKSPALNNANKASTRASRESGGAAAAATRASPSPGGDVARSEAGPGHRPLGSSASPPEAKNLNGRLRSSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFIREKGKSVRVHVQFFD
hide sequence
RefSeq Acc Id:
XP_005324537 ⟸ XM_005324480
- Peptide Label:
isoform X1
- UniProtKB:
I3MWV5 (UniProtKB/TrEMBL)
- Sequence:
MSRQSTLYSFFPKSPALNNANKASTRASRESGGAAAAATRASPSPGGDVARSEAGPGHRPLGSSASPPEAKNLNGRLRRSAAPAVPASSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFIREKGKS
hide sequence
Ensembl Acc Id:
ENSSTOP00000016600 ⟸ ENSSTOT00000028714
