Symbol:
COL1A1
Name:
collagen type I alpha 1 chain
RGD ID:
12307448
Description:
ENCODES a protein that exhibits extracellular matrix structural constituent (inferred); identical protein binding (inferred); metal ion binding (inferred); INVOLVED IN cellular response to epidermal growth factor stimulus (ortholog); cellular response to fibroblast growth factor stimulus (ortholog); cellular response to fluoride (ortholog); PARTICIPATES IN acenocoumarol pharmacodynamics pathway; alteplase pharmacodynamics pathway; aminocaproic acid pharmacodynamics pathway; ASSOCIATED WITH osteogenesis imperfecta type 3; aggressive periodontitis (ortholog); alcoholic hepatitis (ortholog); FOUND IN collagen-containing extracellular matrix (ortholog); extracellular space (ortholog); secretory granule (ortholog)
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
alpha-1 type I collagen; collagen alpha-1(I) chain; type I collagen pre-pro-alpha1(I) chain
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
COL1A1 (collagen type I alpha 1 chain) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Treefam
Mus musculus (house mouse):
Col1a1 (collagen, type I, alpha 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Rattus norvegicus (Norway rat):
Col1a1 (collagen type I alpha 1 chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Col1a1 (collagen type I alpha 1 chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
COL1A1 (collagen type I alpha 1 chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Col1a1 (collagen type I alpha 1 chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
COL1A1 (collagen type I alpha 1 chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
COL1A1 (collagen type I alpha 1 chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Col1a1 (collagen type I alpha 1 chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Latest Assembly:
CanFam3.1 - Dog CanFam3.1 Assembly
Position:
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 26,183,852 - 26,199,927 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 26,183,852 - 26,199,927 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 25,576,913 - 25,592,983 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 26,978,359 - 26,994,434 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 26,978,317 - 26,994,453 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 25,746,094 - 25,762,176 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 26,004,757 - 26,020,835 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 26,134,702 - 26,150,789 (-) NCBI UU_Cfam_GSD_1.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Imported Annotations - SMPDB
Imported Annotations - PID (archival)
COL1A1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 26,183,852 - 26,199,927 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 26,183,852 - 26,199,927 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 25,576,913 - 25,592,983 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 26,978,359 - 26,994,434 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 26,978,317 - 26,994,453 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 25,746,094 - 25,762,176 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 26,004,757 - 26,020,835 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 26,134,702 - 26,150,789 (-) NCBI UU_Cfam_GSD_1.0
COL1A1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 50,184,101 - 50,201,631 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 50,184,101 - 50,201,632 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 48,261,462 - 48,278,992 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 45,616,456 - 45,633,999 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 45,616,455 - 45,633,992 NCBI Celera 17 44,722,303 - 44,739,829 (-) NCBI Celera Cytogenetic Map 17 q21.33 NCBI HuRef 17 43,630,129 - 43,647,463 (-) NCBI HuRef CHM1_1 17 48,325,754 - 48,343,284 (-) NCBI CHM1_1 T2T-CHM13v2.0 17 51,051,162 - 51,068,680 (-) NCBI T2T-CHM13v2.0
Col1a1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 94,827,050 - 94,843,868 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 94,827,050 - 94,843,868 (+) Ensembl GRCm39 Ensembl GRCm38 11 94,936,224 - 94,953,042 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 94,936,224 - 94,953,042 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 94,797,584 - 94,813,181 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 94,752,360 - 94,767,957 (+) NCBI MGSCv36 mm8 Celera 11 104,549,617 - 104,565,301 (+) NCBI Celera Cytogenetic Map 11 D NCBI cM Map 11 59.01 NCBI
Col1a1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 80,380,458 - 80,397,461 (+) NCBI GRCr8 mRatBN7.2 10 79,883,622 - 79,900,625 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 79,883,622 - 79,900,624 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 84,832,832 - 84,849,838 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 84,330,903 - 84,347,909 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 79,723,993 - 79,740,998 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 82,745,801 - 82,762,790 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 82,745,801 - 82,762,789 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 82,563,434 - 82,580,364 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 83,622,438 - 83,639,368 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 83,636,918 - 83,653,733 (+) NCBI Celera 10 78,658,450 - 78,675,438 (+) NCBI Celera Cytogenetic Map 10 q26 NCBI
Col1a1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955451 11,468,290 - 11,483,073 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955451 11,468,156 - 11,484,410 (+) NCBI ChiLan1.0 ChiLan1.0
COL1A1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 66,373,893 - 66,390,381 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 71,180,391 - 71,196,792 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 44,274,349 - 44,291,764 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 49,149,277 - 49,166,833 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 49,150,677 - 49,166,677 (-) Ensembl panpan1.1 panPan2
Col1a1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 25,609,297 - 25,626,616 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936490 11,448,654 - 11,464,444 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936490 11,448,552 - 11,465,836 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
COL1A1
COL1A1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 43,134,648 - 43,152,313 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 43,134,779 - 43,150,930 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666077 13,850,099 - 13,867,746 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Col1a1
.
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
6
5
5
23
22
16
6
6
6
6
33
22
12
14
10
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSCAFT00000026953 ⟹ ENSCAFP00000025056
Type:
CODING
Position:
Dog Assembly Chr Position (strand) Source CanFam3.1 Ensembl 9 26,183,852 - 26,199,927 (-) Ensembl
Ensembl Acc Id:
ENSCAFT00000084988 ⟹ ENSCAFP00000059901
Type:
CODING
Position:
Dog Assembly Chr Position (strand) Source CanFam3.1 Ensembl 9 26,183,852 - 26,199,927 (-) Ensembl
Ensembl Acc Id:
ENSCAFT00845022288 ⟹ ENSCAFP00845017526
Type:
CODING
Position:
Dog Assembly Chr Position (strand) Source ROS_Cfam_1.0 Ensembl 9 26,978,317 - 26,994,453 (-) Ensembl
RefSeq Acc Id:
NM_001003090 ⟹ NP_001003090
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Dog Assembly Chr Position (strand) Source CanFam3.1 9 26,183,852 - 26,199,927 (-) NCBI Dog10K_Boxer_Tasha 9 25,576,913 - 25,592,983 (-) NCBI ROS_Cfam_1.0 9 26,978,359 - 26,994,434 (-) NCBI UMICH_Zoey_3.1 9 25,746,094 - 25,762,176 (-) NCBI UNSW_CanFamBas_1.0 9 26,004,757 - 26,020,835 (-) NCBI UU_Cfam_GSD_1.0 9 26,134,702 - 26,150,789 (-) NCBI
Sequence:
CAGGAGGCACGCGGAGTGTGAGGCCACGCATGAGCCGACGCTAACCCCCACCCCAGCCGCAAAGAGTCTACATGTCTAGGATCTAGACATGTTCAGCTTTGTGGACCTCCGGCTCCTGCTCCTCTTAG
hide sequence
RefSeq Acc Id:
NP_001003090 ⟸ NM_001003090
- Peptide Label:
precursor
- UniProtKB:
Q9XSJ7 (UniProtKB/Swiss-Prot)
- Sequence:
MFSFVDLRLLLLLAATALLTHGQEEGQEEDIPPVTCVQNGLRYYDRDVWKPEACRICVCDNGNVLCDDVICDETKNCPGAQVPPGECCPVCPDGEASPTDQETTGVEGPKGDTGPRGPRGPAGPPGRD
hide sequence
Ensembl Acc Id:
ENSCAFP00000059901 ⟸ ENSCAFT00000084988
Ensembl Acc Id:
ENSCAFP00000025056 ⟸ ENSCAFT00000026953
Ensembl Acc Id:
ENSCAFP00845017526 ⟸ ENSCAFT00845022288
RGD ID: 13684588 Promoter ID: EPDNEW_C2657 Type: multiple initiation site Name: COL1A1_1 Description: collagen type I alpha 1 chain SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Dog Assembly Chr Position (strand) Source CanFam3.1 9 26,199,957 - 26,200,017 EPDNEW
