Symbol:
PHB1
Name:
prohibitin 1
RGD ID:
11671283
Description:
ENCODES a protein that exhibits complement component C3a binding (inferred); complement component C3b binding (inferred); enzyme binding (inferred); INVOLVED IN animal organ regeneration (ortholog); B cell activation (ortholog); DNA biosynthetic process (ortholog); ASSOCIATED WITH adenocarcinoma (ortholog); Animal Mammary Neoplasms (ortholog); Brain Injuries (ortholog); FOUND IN exocytic vesicle (ortholog); extrinsic component of presynaptic active zone membrane (ortholog); GABA-ergic synapse (ortholog)
Type:
protein-coding
RefSeq Status:
MODEL
Previously known as:
PHB; prohibitin
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PHB1 (prohibitin 1) NCBI
Ortholog
Mus musculus (house mouse):
Phb1 (prohibitin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Rattus norvegicus (Norway rat):
Phb1 (prohibitin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Phb1 (prohibitin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PHB1 (prohibitin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Phb1 (prohibitin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PHB1 (prohibitin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PHB1 (prohibitin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Phb1 (prohibitin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Latest Assembly:
Mhudiblu_PPA_v0 - Bonobo Mhudiblu_PPA_v0 Assembly
Position:
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 15,752,626 - 15,762,789 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 17,718,717 - 17,728,876 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 8,189,555 - 8,200,491 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 8,175,912 - 8,186,790 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 8,175,968 - 8,186,790 (+) Ensembl panpan1.1 panPan2
JBrowse:
View Region in Genome Browser (JBrowse)
Model
PHB1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 15,752,626 - 15,762,789 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 17,718,717 - 17,728,876 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 8,189,555 - 8,200,491 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 8,175,912 - 8,186,790 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 8,175,968 - 8,186,790 (+) Ensembl panpan1.1 panPan2
PHB1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 49,404,052 - 49,414,882 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 49,404,049 - 49,414,905 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 47,481,414 - 47,492,244 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 44,836,419 - 44,847,241 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 44,836,418 - 44,847,241 NCBI Celera 17 43,936,440 - 43,947,262 (-) NCBI Celera Cytogenetic Map 17 q21.33 NCBI HuRef 17 42,846,458 - 42,857,310 (-) NCBI HuRef CHM1_1 17 47,546,565 - 47,557,421 (-) NCBI CHM1_1 T2T-CHM13v2.0 17 50,267,083 - 50,277,908 (-) NCBI T2T-CHM13v2.0
Phb1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 95,557,783 - 95,571,599 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 95,557,783 - 95,571,599 (+) Ensembl GRCm39 Ensembl GRCm38 11 95,666,957 - 95,680,773 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 95,666,957 - 95,680,773 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 95,528,271 - 95,542,087 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 95,483,105 - 95,496,855 (+) NCBI MGSCv36 mm8 Celera 11 105,306,168 - 105,322,388 (+) NCBI Celera Cytogenetic Map 11 D NCBI cM Map 11 59.01 NCBI
Phb1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 81,102,043 - 81,114,815 (+) NCBI GRCr8 mRatBN7.2 10 80,605,268 - 80,618,043 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 80,605,251 - 80,618,042 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 85,553,897 - 85,566,665 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 85,051,939 - 85,064,707 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 80,444,228 - 80,456,976 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 83,476,107 - 83,488,878 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 83,476,107 - 83,488,878 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 83,284,048 - 83,296,819 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.1 19 9,127,730 - 9,128,666 (+) NCBI Celera 10 79,373,802 - 79,386,571 (+) NCBI Celera Cytogenetic Map 10 q26 NCBI
Phb1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955451 12,110,290 - 12,120,124 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955451 12,110,290 - 12,119,870 (+) NCBI ChiLan1.0 ChiLan1.0
PHB1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 25,525,711 - 25,536,722 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 25,526,649 - 25,536,722 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 24,985,397 - 24,996,403 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 26,321,934 - 26,332,949 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 26,185,622 - 26,347,114 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 25,089,828 - 25,100,839 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 25,349,147 - 25,360,155 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 25,478,042 - 25,489,037 (-) NCBI UU_Cfam_GSD_1.0
Phb1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 24,936,269 - 24,948,093 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936490 12,127,065 - 12,138,870 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936490 12,127,065 - 12,138,870 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PHB1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 25,596,523 - 25,609,706 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 25,596,520 - 25,609,693 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 25,535,912 - 25,549,084 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PHB1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 69,805,968 - 69,816,792 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 69,806,923 - 69,816,754 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666077 40,910,348 - 40,921,223 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Phb1
.
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSPPAT00000029757 ⟹ ENSPPAP00000007416
Type:
CODING
Position:
Bonobo Assembly Chr Position (strand) Source PanPan1.1 Ensembl 17 8,175,968 - 8,186,790 (+) Ensembl
Ensembl Acc Id:
ENSPPAT00000029766 ⟹ ENSPPAP00000007420
Type:
CODING
Position:
Bonobo Assembly Chr Position (strand) Source PanPan1.1 Ensembl 17 8,177,585 - 8,185,854 (+) Ensembl
RefSeq Acc Id:
XM_003810048 ⟹ XP_003810096
Type:
CODING
Position:
Bonobo Assembly Chr Position (strand) Source NHGRI_mPanPan1-v2 19 15,752,626 - 15,762,789 (+) NCBI NHGRI_mPanPan1 17 17,718,717 - 17,728,876 (+) NCBI Mhudiblu_PPA_v0 17 8,189,555 - 8,199,719 (+) NCBI PanPan1.1 17 8,175,912 - 8,186,790 (+) NCBI
Sequence:
AAGCGGGCAGGGCAGAGGAGCGCATGCGCAGTATGTGTGGTTGGGGAATTCATGTGGAGGTCAGAGTGGAAGCAGGTGTGAGAGGGTCCAGCAGAAGGAAACATGGCTGCCAAAGTGTTTGAGTCCAT
hide sequence
RefSeq Acc Id:
XM_003810049 ⟹ XP_003810097
Type:
CODING
Position:
Bonobo Assembly Chr Position (strand) Source NHGRI_mPanPan1-v2 19 15,752,706 - 15,762,789 (+) NCBI NHGRI_mPanPan1 17 17,718,798 - 17,728,876 (+) NCBI Mhudiblu_PPA_v0 17 8,189,665 - 8,200,491 (+) NCBI PanPan1.1 17 8,175,968 - 8,186,790 (+) NCBI
Sequence:
GAGGTCAGAGTGGAAGCAGGTGAGAATGGAGGGGGCGGCAAAGGCCCGTTTCTGGGCATCTCTGCAGTCCTCCTCTGCTCCATGATGTGCACTTTGGGCGAGGAGCGTGCGTGCGTGTGAGAGGGTCC
hide sequence
RefSeq Acc Id:
XM_034941499 ⟹ XP_034797390
Type:
CODING
Position:
Bonobo Assembly Chr Position (strand) Source NHGRI_mPanPan1-v2 19 15,752,693 - 15,762,789 (+) NCBI NHGRI_mPanPan1 17 17,718,797 - 17,728,876 (+) NCBI Mhudiblu_PPA_v0 17 8,189,618 - 8,200,491 (+) NCBI
RefSeq Acc Id:
XP_003810096 ⟸ XM_003810048
- UniProtKB:
A0A2R8ZR25 (UniProtKB/TrEMBL)
- Sequence:
MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILK
hide sequence
RefSeq Acc Id:
XP_003810097 ⟸ XM_003810049
- UniProtKB:
A0A2R8ZR25 (UniProtKB/TrEMBL)
- Sequence:
MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKP
hide sequence
RefSeq Acc Id:
XP_034797390 ⟸ XM_034941499
- UniProtKB:
A0A2R8ZR25 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSPPAP00000007420 ⟸ ENSPPAT00000029766
Ensembl Acc Id:
ENSPPAP00000007416 ⟸ ENSPPAT00000029757
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-11-09
PHB1
prohibitin 1
PHB
prohibitin
Symbol and/or name change
5135510 APPROVED
