Advanced Search (OLGA)

Gene: Sp1 (trans-acting transcription factor 1) Mus musculus

Subscribe to Updates

Analyze

Symbol:

Sp1

Name:

trans-acting transcription factor 1

RGD ID:

11334

MGI Page

MGI

Description:

Enables DNA-binding transcription activator activity, RNA polymerase II-specific; DNA-binding transcription factor binding activity; and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in positive regulation of transcription by RNA polymerase II and response to hydroperoxide. Acts upstream of or within several processes, including embryo development; hemopoiesis; and mRNA transcription by RNA polymerase II. Located in chromatin and nucleus. Is expressed in several structures, including central nervous system; early conceptus; epithelium; eye; and genitourinary system. Orthologous to human SP1 (Sp1 transcription factor).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

1110003E12Rik; AA450830; AI845540; Sp1-1; specificity protein 1; transcription factor Sp1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SP1 (Sp1 transcription factor)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):	Sp1 (Sp1 transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Sp1 (Sp1 transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SP1 (Sp1 transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SP1 (Sp1 transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Sp1 (Sp1 transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SP1 (Sp1 transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SP1 (Sp1 transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Sp1 (Sp1 transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Sp1 (Sp1 transcription factor)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	SP1 (Sp1 transcription factor)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	sp1 (sp1 transcription factor)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)
Caenorhabditis elegans (roundworm):	sptf-3	Alliance	DIOPT (OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Spps	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	sp1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)

Related Pseudogenes:

Gm18697

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	102,314,751 - 102,344,839 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	102,314,578 - 102,344,839 (+)	Ensembl		GRCm39 Ensembl
GRCm38	15	102,406,316 - 102,436,404 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	102,406,143 - 102,436,404 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	102,236,747 - 102,266,835 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	102,234,362 - 102,260,713 (+)	NCBI		MGSCv36	mm8
Celera	15	104,563,277 - 104,594,207 (+)	NCBI		Celera
Cytogenetic Map	15	F3	NCBI
cM Map	15	57.55	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sp1	Mouse	Carotid Artery Injuries		ISO	RGD:3738	9854624	protein:increased phosphorylation:smooth muscle cell:	RGD
Sp1	Mouse	Plaque, Atherosclerotic		ISO	RGD:732035	9854624	protein:increased phosphorylation:smooth muscle cell:	RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sp1	Mouse	Neurodevelopmental Disorders		ISO	RGD:732035	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sp1	Mouse	Colorectal Neoplasms		ISO	RGD:732035	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:35072892
Sp1	Mouse	Disease Progression		ISO	RGD:732035	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:35072892
Sp1	Mouse	hyperglycemia		ISO	RGD:732035	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:11696579
Sp1	Mouse	Neoplasm Invasiveness		ISO	RGD:732035	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:26317792\|PMID:35072892
Sp1	Mouse	Neoplasm Metastasis		ISO	RGD:732035	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:12538496\|PMID:35072892
Sp1	Mouse	Neoplastic Cell Transformation		ISO	RGD:732035	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:22009531
Sp1	Mouse	Skin Neoplasms		ISO	RGD:732035	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:22009531

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sp1	Mouse	(+)-catechin	multiple interactions	ISO	RGD:732035	6480464	Catechin inhibits the reaction [arsenic trioxide results in decreased expression of SP1 protein]	CTD	PMID:28768059
Sp1	Mouse	(+)-catechin	increases expression	ISO	RGD:732035	6480464	Catechin results in increased expression of SP1 protein	CTD	PMID:28768059
Sp1	Mouse	(-)-demecolcine	decreases expression	ISO	RGD:732035	6480464	Demecolcine results in decreased expression of SP1 mRNA	CTD	PMID:23649840
Sp1	Mouse	(-)-epigallocatechin 3-gallate	multiple interactions	ISO	RGD:732035	6480464	epigallocatechin gallate inhibits the reaction [EGF protein results in increased activity of SP1 protein]	CTD	PMID:12931129
Sp1	Mouse	(20S)-ginsenoside Rg3	multiple interactions	ISO	RGD:732035	6480464	ginsenoside Rg3 inhibits the reaction [cagA protein, Helicobacter pylori results in decreased expression of SP1 more ...	CTD	PMID:26427350
Sp1	Mouse	(R)-lipoic acid	multiple interactions	EXP		6480464	Thioctic Acid results in increased phosphorylation of and results in decreased activity of SP1 protein	CTD	PMID:21351249
Sp1	Mouse	(S)-nicotine	multiple interactions	ISO	RGD:732035	6480464	Nicotine promotes the reaction [[GATA4 protein binds to SP1 protein] which binds to CHRNA7 protein]; more ...	CTD	PMID:24089524
Sp1	Mouse	1,2-dimethylhydrazine	decreases expression	ISO	RGD:3738	6480464	1,2-Dimethylhydrazine results in decreased expression of SP1 mRNA	CTD	PMID:32387197
Sp1	Mouse	1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine	increases expression	ISO	RGD:3738	6480464	1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine results in increased expression of SP1 mRNA	CTD	PMID:23538867
Sp1	Mouse	1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine	affects response to substance	EXP		6480464	SP1 affects the susceptibility to 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine	CTD	PMID:25851821
Sp1	Mouse	1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine	multiple interactions	ISO	RGD:3738	6480464	1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine results in increased expression of and affects the localization of SP1 protein; [mithramycin A more ...	CTD	PMID:23538867
Sp1	Mouse	17alpha-ethynylestradiol	multiple interactions	ISO	RGD:732035	6480464	SP1 protein promotes the reaction [Ethinyl Estradiol results in increased expression of AGER mRNA]	CTD	PMID:15878629
Sp1	Mouse	17alpha-ethynylestradiol	increases activity	ISO	RGD:732035	6480464	Ethinyl Estradiol results in increased activity of SP1 protein	CTD	PMID:15878629
Sp1	Mouse	17beta-estradiol	multiple interactions	ISO	RGD:732035	6480464	[Estradiol co-treated with bisphenol A] results in increased expression of SP1 mRNA; Estradiol promotes the more ...	CTD	PMID:16675542\|PMID:17088408\|PMID:23733894\|PMID:29783106
Sp1	Mouse	17beta-estradiol	decreases expression	ISO	RGD:732035	6480464	Estradiol results in decreased expression of SP1 mRNA	CTD	PMID:29783106
Sp1	Mouse	17beta-estradiol	increases activity	ISO	RGD:732035	6480464	Estradiol results in increased activity of SP1 protein	CTD	PMID:17088408
Sp1	Mouse	2,2',4,4'-Tetrabromodiphenyl ether	increases expression	ISO	RGD:3738	6480464	2,2',4,4'-tetrabromodiphenyl ether results in increased expression of SP1 mRNA	CTD	PMID:27291303
Sp1	Mouse	2,2',4,4'-Tetrabromodiphenyl ether	decreases expression	ISO	RGD:3738	6480464	2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of SP1 mRNA	CTD	PMID:27291303
Sp1	Mouse	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of SP1 mRNA	CTD	PMID:14708085\|PMID:24058054
Sp1	Mouse	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:3738	6480464	Tetrachlorodibenzodioxin results in decreased expression of SP1 mRNA	CTD	PMID:33387578
Sp1	Mouse	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:3738	6480464	Tetrachlorodibenzodioxin results in increased expression of SP1 mRNA	CTD	PMID:34747641
Sp1	Mouse	2,3,7,8-tetrachlorodibenzodioxine	increases phosphorylation	ISO	RGD:732035	6480464	Tetrachlorodibenzodioxin results in increased phosphorylation of SP1 protein	CTD	PMID:20971882
Sp1	Mouse	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of SP1 mRNA	CTD	PMID:21570461
Sp1	Mouse	2,3,7,8-tetrachlorodibenzodioxine	affects activity	ISO	RGD:3738	6480464	Tetrachlorodibenzodioxin affects the activity of SP1 protein	CTD	PMID:11926288
Sp1	Mouse	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	EXP		6480464	[Tetrachlorodibenzodioxin co-treated with decitabine] results in increased expression of SP1 mRNA	CTD	PMID:15251184
Sp1	Mouse	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:732035	6480464	[SP1 protein binds to CYP1B1 enhancer] promotes the reaction [Tetrachlorodibenzodioxin results in increased expression of more ...	CTD	PMID:12801909\|PMID:16675542
Sp1	Mouse	2-chloroethanol	multiple interactions	ISO	RGD:3738	6480464	Ethylene Chlorohydrin results in increased expression of and results in increased phosphorylation of SP1 protein; more ...	CTD	PMID:31585129
Sp1	Mouse	2-chloroethanol	increases expression	ISO	RGD:3738	6480464	Ethylene Chlorohydrin results in increased expression of SP1 mRNA	CTD	PMID:31585129
Sp1	Mouse	2-tert-butylhydroquinone	increases expression	ISO	RGD:732035	6480464	2-tert-butylhydroquinone results in increased expression of SP1 protein	CTD	PMID:36206955
Sp1	Mouse	3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione	increases expression	ISO	RGD:732035	6480464	bisindolylmaleimide I results in increased expression of SP1 mRNA; bisindolylmaleimide I results in increased expression more ...	CTD	PMID:14653808
Sp1	Mouse	3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione	multiple interactions	ISO	RGD:3738	6480464	bisindolylmaleimide I inhibits the reaction [Cadmium Chloride results in increased phosphorylation of and results in more ...	CTD	PMID:12499119
Sp1	Mouse	3-methylcholanthrene	increases expression	ISO	RGD:3738	6480464	Methylcholanthrene results in increased expression of SP1 mRNA	CTD	PMID:29094188
Sp1	Mouse	3-methylcholanthrene	increases acetylation	ISO	RGD:3738	6480464	Methylcholanthrene results in increased acetylation of SP1 promoter	CTD	PMID:29094188
Sp1	Mouse	3-methylcholanthrene	multiple interactions	ISO	RGD:3738	6480464	alpha-naphthoflavone inhibits the reaction [Methylcholanthrene promotes the reaction [AHR protein binds to SP1 promoter]]; alpha-naphthoflavone more ...	CTD	PMID:29094188
Sp1	Mouse	4,4'-diaminodiphenylmethane	decreases expression	EXP		6480464	4,4'-diaminodiphenylmethane results in decreased expression of SP1 mRNA	CTD	PMID:18648102
Sp1	Mouse	4,4'-sulfonyldiphenol	decreases expression	EXP		6480464	bisphenol S results in decreased expression of SP1 mRNA	CTD	PMID:39298647
Sp1	Mouse	4-hydroxyphenyl retinamide	multiple interactions	EXP		6480464	Fenretinide results in increased cleavage of and results in decreased activity of SP1 protein	CTD	PMID:9343396
Sp1	Mouse	4-hydroxyphenyl retinamide	increases expression	EXP		6480464	Fenretinide results in increased expression of SP1 mRNA	CTD	PMID:28973697
Sp1	Mouse	4-nonylphenol	multiple interactions	EXP		6480464	[Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with 4-nonylphenol co-treated with more ...	CTD	PMID:29029336
Sp1	Mouse	4-tert-Octylphenol	multiple interactions	EXP		6480464	[Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with 4-nonylphenol co-treated with more ...	CTD	PMID:29029336
Sp1	Mouse	5-aza-2'-deoxycytidine	multiple interactions	ISO	RGD:732035	6480464	[[Decitabine co-treated with trichostatin A] promotes the reaction [SP1 protein binds to SLC25A1 promoter]] which more ...	CTD	PMID:17986852\|PMID:18033804\|PMID:18706393\|PMID:21246532
Sp1	Mouse	5-aza-2'-deoxycytidine	increases expression	ISO	RGD:732035	6480464	Decitabine results in increased expression of SP1 mRNA; Decitabine results in increased expression of SP1 more ...	CTD	PMID:19027835
Sp1	Mouse	5-aza-2'-deoxycytidine	multiple interactions	EXP		6480464	[Tetrachlorodibenzodioxin co-treated with Decitabine] results in increased expression of SP1 mRNA	CTD	PMID:15251184
Sp1	Mouse	5-aza-2'-deoxycytidine	increases expression	EXP		6480464	Decitabine results in increased expression of SP1 mRNA	CTD	PMID:15251184\|PMID:27915011
Sp1	Mouse	5-azacytidine	multiple interactions	ISO	RGD:732035	6480464	Azacitidine promotes the reaction [SP1 protein binds to KIR2DL2 promoter]; Azacitidine promotes the reaction [SP1 more ...	CTD	PMID:18945643
Sp1	Mouse	5-azacytidine	decreases expression	ISO	RGD:732035	6480464	Azacitidine results in decreased expression of SP1 mRNA	CTD	PMID:20823114
Sp1	Mouse	5-azacytidine	multiple interactions	EXP		6480464	Azacitidine promotes the reaction [SP1 protein binds to AQP5 promoter]	CTD	PMID:17198683
Sp1	Mouse	5-fluorouracil	multiple interactions	ISO	RGD:732035	6480464	Fluorouracil promotes the reaction [[TP53 protein binds to SP1 protein] which binds to CDKN1A promoter]; more ...	CTD	PMID:15489892\|PMID:18927307
Sp1	Mouse	6-propyl-2-thiouracil	decreases expression	ISO	RGD:3738	6480464	Propylthiouracil results in decreased expression of SP1 mRNA	CTD	PMID:30047161
Sp1	Mouse	7,12-dimethyltetraphene	multiple interactions	ISO	RGD:732035	6480464	[[9,10-Dimethyl-1,2-benzanthracene co-treated with 12-O-tetradecanoylphorbol-1,3-acetate] results in increased activity of TRP53 protein] inhibits the reaction [SP1 more ...	CTD	PMID:22009531\|PMID:29663660
Sp1	Mouse	7,12-dimethyltetraphene	increases expression	ISO	RGD:732035	6480464	9,10-Dimethyl-1,2-benzanthracene results in increased expression of SP1 mRNA; 9,10-Dimethyl-1,2-benzanthracene results in increased expression of SP1 more ...	CTD	PMID:29663660
Sp1	Mouse	7,12-dimethyltetraphene	increases expression	ISO	RGD:3738	6480464	9,10-Dimethyl-1,2-benzanthracene results in increased expression of SP1 mRNA; 9,10-Dimethyl-1,2-benzanthracene results in increased expression of SP1 more ...	CTD	PMID:36863560
Sp1	Mouse	acetaldehyde	multiple interactions	ISO	RGD:732035	6480464	SP1 protein promotes the reaction [Acetaldehyde results in increased expression of COL1A2 mRNA]	CTD	PMID:16025520
Sp1	Mouse	AH23848	multiple interactions	ISO	RGD:732035	6480464	[6-isopropoxy-9-oxoxanthene-2-carboxylic acid co-treated with AH 23848] results in decreased expression of SP1 protein	CTD	PMID:19407222
Sp1	Mouse	aldehydo-D-glucose	multiple interactions	ISO	RGD:732035	6480464	SOD2 protein inhibits the reaction [Glucose results in decreased phosphorylation of SP1 protein]; SOD2 protein more ...	CTD	PMID:11050244
Sp1	Mouse	aldehydo-D-glucose	multiple interactions	ISO	RGD:3738	6480464	UCP1 protein inhibits the reaction [Glucose results in decreased phosphorylation of SP1 protein]; UCP1 protein more ...	CTD	PMID:11050244
Sp1	Mouse	alendronic acid	increases expression	ISO	RGD:732035	6480464	Alendronate results in increased expression of SP1 mRNA; Alendronate results in increased expression of SP1 more ...	CTD	PMID:33522294
Sp1	Mouse	alendronic acid	multiple interactions	ISO	RGD:732035	6480464	SP1 protein affects the reaction [Alendronate results in increased expression of SOX9 mRNA]; SP1 protein more ...	CTD	PMID:33522294
Sp1	Mouse	all-trans-retinoic acid	increases activity	ISO	RGD:732035	6480464	Tretinoin results in increased activity of SP1 protein	CTD	PMID:16757381
Sp1	Mouse	all-trans-retinoic acid	increases expression	ISO	RGD:732035	6480464	Tretinoin results in increased expression of SP1 mRNA; Tretinoin results in increased expression of SP1 more ...	CTD	PMID:23724009\|PMID:26892147\|PMID:33167477
Sp1	Mouse	all-trans-retinoic acid	increases activity	EXP		6480464	Tretinoin results in increased activity of SP1 protein	CTD	PMID:17097063
Sp1	Mouse	all-trans-retinoic acid	multiple interactions	ISO	RGD:732035	6480464	arsenic trioxide promotes the reaction [Tretinoin results in increased expression of SP1 protein]; Tretinoin promotes more ...	CTD	PMID:16740727\|PMID:16757381\|PMID:17307735\|PMID:26892147
Sp1	Mouse	allethrin	increases activity	ISO	RGD:732035	6480464	Allethrins results in increased activity of SP1 protein	CTD	PMID:20143881
Sp1	Mouse	alpha-D-galactose	increases expression	ISO	RGD:3738	6480464	Galactose results in increased expression of SP1 protein	CTD	PMID:30367734
Sp1	Mouse	alpha-D-galactose	multiple interactions	ISO	RGD:3738	6480464	Alpinia oxyphylla fruit extract inhibits the reaction [Galactose results in increased expression of SP1 protein]	CTD	PMID:30367734
Sp1	Mouse	alpha-naphthoflavone	multiple interactions	ISO	RGD:3738	6480464	alpha-naphthoflavone inhibits the reaction [Methylcholanthrene promotes the reaction [AHR protein binds to SP1 promoter]]; alpha-naphthoflavone more ...	CTD	PMID:29094188
Sp1	Mouse	amitrole	decreases expression	ISO	RGD:3738	6480464	Amitrole results in decreased expression of SP1 mRNA	CTD	PMID:30047161\|PMID:38685447
Sp1	Mouse	ammonium chloride	decreases expression	ISO	RGD:3738	6480464	Ammonium Chloride results in decreased expression of SP1 mRNA; Ammonium Chloride results in decreased expression more ...	CTD	PMID:17442060
Sp1	Mouse	ammonium chloride	decreases phosphorylation	ISO	RGD:3738	6480464	Ammonium Chloride results in decreased phosphorylation of SP1 protein	CTD	PMID:17442060
Sp1	Mouse	ammonium chloride	affects expression	ISO	RGD:3738	6480464	Ammonium Chloride affects the expression of SP1 mRNA	CTD	PMID:16483693
Sp1	Mouse	anthra[1,9-cd]pyrazol-6(2H)-one	multiple interactions	ISO	RGD:732035	6480464	pyrazolanthrone inhibits the reaction [tricarbonyldichlororuthenium (II) dimer results in increased phosphorylation of SP1 protein]	CTD	PMID:26385185
Sp1	Mouse	anthra[1,9-cd]pyrazol-6(2H)-one	multiple interactions	ISO	RGD:3738	6480464	[cypermethrin co-treated with pyrazolanthrone] results in decreased phosphorylation of SP1 protein	CTD	PMID:34794910
Sp1	Mouse	antirheumatic drug	decreases expression	ISO	RGD:732035	6480464	Antirheumatic Agents results in decreased expression of SP1 mRNA	CTD	PMID:25339124
Sp1	Mouse	aristolochic acid A	decreases expression	ISO	RGD:732035	6480464	aristolochic acid I results in decreased expression of SP1 mRNA; aristolochic acid I results in more ...	CTD	PMID:33212167
Sp1	Mouse	Aroclor 1254	increases activity	ISO	RGD:3738	6480464	Chlorodiphenyl (54% Chlorine) results in increased activity of SP1 protein	CTD	PMID:16159668
Sp1	Mouse	arsane	multiple interactions	EXP		6480464	[[lead chloride results in increased abundance of Lead] co-treated with [sodium arsenite results in increased more ...	CTD	PMID:32179164
Sp1	Mouse	arsane	multiple interactions	ISO	RGD:732035	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of SP1 more ...	CTD	PMID:36669534
Sp1	Mouse	arsenic atom	multiple interactions	EXP		6480464	[[lead chloride results in increased abundance of Lead] co-treated with [sodium arsenite results in increased more ...	CTD	PMID:32179164
Sp1	Mouse	arsenic atom	multiple interactions	ISO	RGD:732035	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of SP1 more ...	CTD	PMID:36669534
Sp1	Mouse	arsenous acid	decreases expression	ISO	RGD:732035	6480464	Arsenic Trioxide results in decreased expression of SP1 mRNA; Arsenic Trioxide results in decreased expression more ...	CTD	PMID:17617380\|PMID:20435036\|PMID:25395240\|PMID:25436934\|PMID:28768059
Sp1	Mouse	arsenous acid	affects methylation	ISO	RGD:732035	6480464	Arsenic Trioxide affects the methylation of SP1 promoter	CTD	PMID:26046465
Sp1	Mouse	arsenous acid	decreases activity	ISO	RGD:732035	6480464	Arsenic Trioxide results in decreased activity of SP1 protein	CTD	PMID:11714746
Sp1	Mouse	arsenous acid	multiple interactions	ISO	RGD:732035	6480464	Arsenic Trioxide inhibits the reaction [SP1 protein binds to CYTL1 promoter]; Arsenic Trioxide inhibits the more ...	CTD	PMID:11714746\|PMID:15761015\|PMID:25395240\|PMID:26892147\|PMID:28768059
Sp1	Mouse	artesunate	decreases expression	ISO	RGD:732035	6480464	artesunate results in decreased expression of SP1 protein	CTD	PMID:19513562
Sp1	Mouse	asbestos	increases expression	ISO	RGD:732035	6480464	Asbestos results in increased expression of SP1	CTD	PMID:15636197
Sp1	Mouse	asiatic acid	multiple interactions	ISO	RGD:3738	6480464	asiatic acid inhibits the reaction [cypermethrin results in decreased phosphorylation of SP1 protein]	CTD	PMID:34794910
Sp1	Mouse	astaxanthin	multiple interactions	ISO	RGD:3738	6480464	[mithramycin A co-treated with astaxanthine] inhibits the reaction [1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine results in increased expression of and more ...	CTD	PMID:23538867
Sp1	Mouse	bathocuproine disulfonic acid	multiple interactions	ISO	RGD:732035	6480464	bathocuproine sulfonate promotes the reaction [SP1 protein results in increased expression of SLC31A1 mRNA]	CTD	PMID:18483225
Sp1	Mouse	benzene	decreases expression	ISO	RGD:732035	6480464	Benzene results in decreased expression of SP1 mRNA	CTD	PMID:21382456
Sp1	Mouse	benzo[a]pyrene	affects activity	ISO	RGD:732035	6480464	Benzo(a)pyrene affects the activity of SP1 protein	CTD	PMID:20624995
Sp1	Mouse	benzo[a]pyrene	increases expression	EXP		6480464	Benzo(a)pyrene results in increased expression of SP1 mRNA	CTD	PMID:22228805
Sp1	Mouse	benzo[a]pyrene	multiple interactions	EXP		6480464	POR protein affects the reaction [Benzo(a)pyrene affects the expression of SP1 protein]	CTD	PMID:21987461
Sp1	Mouse	benzo[a]pyrene	affects expression	EXP		6480464	Benzo(a)pyrene affects the expression of SP1 protein	CTD	PMID:21987461
Sp1	Mouse	Benzo[ghi]perylene	increases expression	ISO	RGD:732035	6480464	1,12-benzoperylene results in increased expression of SP1 mRNA	CTD	PMID:35182551
Sp1	Mouse	biotin	increases expression	EXP		6480464	Biotin results in increased expression of SP1 mRNA	CTD	PMID:34699867
Sp1	Mouse	bis(2-ethylhexyl) phthalate	multiple interactions	EXP		6480464	[Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with 4-nonylphenol co-treated with more ...	CTD	PMID:29029336
Sp1	Mouse	bisphenol A	increases expression	ISO	RGD:3738	6480464	bisphenol A results in increased expression of SP1 mRNA	CTD	PMID:25181051\|PMID:33296240
Sp1	Mouse	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of SP1 mRNA	CTD	PMID:33221593\|PMID:37894381
Sp1	Mouse	bisphenol A	increases expression	ISO	RGD:732035	6480464	bisphenol A results in increased expression of SP1 mRNA; bisphenol A results in increased expression more ...	CTD	PMID:29783106\|PMID:30206973
Sp1	Mouse	bisphenol A	multiple interactions	ISO	RGD:732035	6480464	[Estradiol co-treated with bisphenol A] results in increased expression of SP1 mRNA	CTD	PMID:29783106
Sp1	Mouse	bisphenol A	decreases expression	ISO	RGD:3738	6480464	bisphenol A results in decreased expression of SP1 mRNA	CTD	PMID:30816183\|PMID:32528016\|PMID:34947998
Sp1	Mouse	bisphenol A	affects methylation	EXP		6480464	bisphenol A affects the methylation of SP1 promoter	CTD	PMID:27334623
Sp1	Mouse	butan-1-ol	multiple interactions	ISO	RGD:732035	6480464	[[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic more ...	CTD	PMID:29432896
Sp1	Mouse	Butylbenzyl phthalate	multiple interactions	EXP		6480464	[Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with 4-nonylphenol co-treated with more ...	CTD	PMID:29029336
Sp1	Mouse	Butylbenzyl phthalate	decreases expression	EXP		6480464	butylbenzyl phthalate results in decreased expression of SP1 mRNA	CTD	PMID:29029336
Sp1	Mouse	cadmium acetate	decreases expression	ISO	RGD:732035	6480464	cadmium acetate results in decreased expression of SP1 mRNA	CTD	PMID:24132751
Sp1	Mouse	cadmium atom	multiple interactions	EXP		6480464	Cadmium inhibits the reaction [SP1 protein binds to SLC5A1 promoter]; Cadmium promotes the reaction [MTF1 more ...	CTD	PMID:15664265\|PMID:18458062
Sp1	Mouse	cadmium atom	multiple interactions	ISO	RGD:3738	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of SP1 more ...	CTD	PMID:35384129
Sp1	Mouse	cadmium atom	affects binding	ISO	RGD:732035	6480464	SP1 protein binds to Cadmium	CTD	PMID:20073493
Sp1	Mouse	cadmium atom	multiple interactions	ISO	RGD:732035	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of SP1 more ...	CTD	PMID:15760895\|PMID:18556457\|PMID:20073493\|PMID:24015267\|PMID:35384129
Sp1	Mouse	cadmium dichloride	multiple interactions	ISO	RGD:732035	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of SP1 more ...	CTD	PMID:18556457\|PMID:35384129
Sp1	Mouse	cadmium dichloride	increases expression	ISO	RGD:3738	6480464	Cadmium Chloride results in increased expression of SP1 mRNA	CTD	PMID:35525383
Sp1	Mouse	cadmium dichloride	decreases expression	ISO	RGD:3738	6480464	Cadmium Chloride results in decreased expression of SP1 mRNA; Cadmium Chloride results in decreased expression more ...	CTD	PMID:33865896
Sp1	Mouse	cadmium dichloride	increases cleavage	ISO	RGD:3738	6480464	Cadmium Chloride results in increased cleavage of SP1 protein	CTD	PMID:12499119
Sp1	Mouse	cadmium dichloride	multiple interactions	ISO	RGD:3738	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of SP1 more ...	CTD	PMID:12499119\|PMID:35384129
Sp1	Mouse	cadmium dichloride	multiple interactions	EXP		6480464	Cadmium Chloride inhibits the reaction [SP1 protein binds to and affects the expression of SLC5A1 more ...	CTD	PMID:20060848\|PMID:25046863
Sp1	Mouse	cadmium dichloride	affects response to substance	ISO	RGD:732035	6480464	SP1 affects the susceptibility to Cadmium Chloride	CTD	PMID:18556457
Sp1	Mouse	caffeine	affects phosphorylation	ISO	RGD:732035	6480464	Caffeine affects the phosphorylation of SP1 protein	CTD	PMID:35688186
Sp1	Mouse	Calcimycin	multiple interactions	ISO	RGD:732035	6480464	[Tetradecanoylphorbol Acetate co-treated with Calcimycin] affects the localization of SP1 protein	CTD	PMID:24244623
Sp1	Mouse	camptothecin	multiple interactions	ISO	RGD:732035	6480464	Acetylcysteine inhibits the reaction [Camptothecin results in increased expression of SP1 mRNA]; Camptothecin results in more ...	CTD	PMID:11261509\|PMID:30851366\|PMID:30885713
Sp1	Mouse	camptothecin	increases expression	ISO	RGD:732035	6480464	Camptothecin results in increased expression of SP1 mRNA	CTD	PMID:30851366
Sp1	Mouse	camptothecin	increases activity	ISO	RGD:732035	6480464	Camptothecin results in increased activity of SP1 protein	CTD	PMID:11261509
Sp1	Mouse	capsaicin	increases localization	ISO	RGD:732035	6480464	Capsaicin results in increased localization of SP1 protein	CTD	PMID:22200406
Sp1	Mouse	capsaicin	multiple interactions	ISO	RGD:732035	6480464	Capsaicin promotes the reaction [SP1 protein binds to TNFSF10 promoter]	CTD	PMID:22200406
Sp1	Mouse	carbon nanotube	decreases expression	EXP		6480464	Nanotubes, Carbon analog results in decreased expression of SP1 mRNA; Nanotubes, Carbon results in decreased more ...	CTD	PMID:25554681
Sp1	Mouse	carnosine	decreases expression	EXP		6480464	Carnosine results in decreased expression of SP1 mRNA	CTD	PMID:30485136
Sp1	Mouse	carnosine	decreases expression	ISO	RGD:3738	6480464	Carnosine results in decreased expression of SP1 mRNA	CTD	PMID:30485136
Sp1	Mouse	chloroprene	increases expression	ISO	RGD:3738	6480464	Chloroprene results in increased expression of SP1 mRNA	CTD	PMID:23125180
Sp1	Mouse	chloroquine	multiple interactions	ISO	RGD:732035	6480464	Chloroquine inhibits the reaction [[WEHI-539 co-treated with venetoclax] results in increased expression of SP1 protein]	CTD	PMID:35561756
Sp1	Mouse	chlorpyrifos	affects expression	ISO	RGD:3738	6480464	Chlorpyrifos affects the expression of SP1 mRNA	CTD	PMID:17452286
Sp1	Mouse	chlorpyrifos	decreases expression	EXP		6480464	Chlorpyrifos results in decreased expression of SP1 mRNA	CTD	PMID:37019170
Sp1	Mouse	chlorpyrifos	increases expression	ISO	RGD:732035	6480464	Chlorpyrifos results in increased expression of SP1 mRNA	CTD	PMID:24979751
Sp1	Mouse	choline	multiple interactions	EXP		6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ...	CTD	PMID:20938992
Sp1	Mouse	chromium(6+)	multiple interactions	ISO	RGD:3738	6480464	chromium hexavalent ion inhibits the reaction [SP1 protein binds to AR promoter]	CTD	PMID:32679048
Sp1	Mouse	cisplatin	decreases expression	EXP		6480464	Cisplatin results in decreased expression of SP1 mRNA	CTD	PMID:21151649
Sp1	Mouse	cisplatin	increases expression	EXP		6480464	Cisplatin results in increased expression of SP1 mRNA	CTD	PMID:38056807
Sp1	Mouse	cisplatin	increases expression	ISO	RGD:732035	6480464	[Cisplatin results in increased expression of SP1 protein] which results in increased expression of SLC31A1 more ...	CTD	PMID:22914438\|PMID:24132751
Sp1	Mouse	cisplatin	multiple interactions	ISO	RGD:732035	6480464	Copper Sulfate inhibits the reaction [Cisplatin results in increased expression of SP1 mRNA]	CTD	PMID:24132751
Sp1	Mouse	clofarabine	multiple interactions	ISO	RGD:732035	6480464	[resveratrol co-treated with clofarabine] affects the localization of SP1 protein; [resveratrol co-treated with clofarabine] results more ...	CTD	PMID:23146690
Sp1	Mouse	clofibrate	increases expression	EXP		6480464	Clofibrate results in increased expression of SP1 mRNA	CTD	PMID:17585979
Sp1	Mouse	cobalt dichloride	multiple interactions	ISO	RGD:732035	6480464	2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [cobaltous chloride results in increased expression of SP1 protein]; [Plicamycin results more ...	CTD	PMID:17307335
Sp1	Mouse	cobalt dichloride	increases phosphorylation	ISO	RGD:3738	6480464	cobaltous chloride results in increased phosphorylation of SP1 protein	CTD	PMID:23814049
Sp1	Mouse	cobalt dichloride	increases expression	ISO	RGD:732035	6480464	cobaltous chloride results in increased expression of SP1 protein	CTD	PMID:17307335
Sp1	Mouse	cobalt dichloride	increases activity	ISO	RGD:732035	6480464	cobaltous chloride results in increased activity of SP1 protein	CTD	PMID:17307335
Sp1	Mouse	cocaine	affects expression	ISO	RGD:3738	6480464	Cocaine affects the expression of SP1 mRNA; Cocaine affects the expression of SP1 protein	CTD	PMID:16179556\|PMID:20187946
Sp1	Mouse	copper atom	increases expression	ISO	RGD:732035	6480464	Copper deficiency results in increased expression of SP1 mRNA; Copper deficiency results in increased expression more ...	CTD	PMID:22172574\|PMID:24132751
Sp1	Mouse	copper atom	multiple interactions	ISO	RGD:732035	6480464	[neocuproine affects the abundance of Copper] inhibits the reaction [TNF protein results in increased activity more ...	CTD	PMID:12633744\|PMID:18483225\|PMID:22172574
Sp1	Mouse	copper(0)	increases expression	ISO	RGD:732035	6480464	Copper deficiency results in increased expression of SP1 mRNA; Copper deficiency results in increased expression more ...	CTD	PMID:22172574\|PMID:24132751
Sp1	Mouse	copper(0)	multiple interactions	ISO	RGD:732035	6480464	[neocuproine affects the abundance of Copper] inhibits the reaction [TNF protein results in increased activity more ...	CTD	PMID:12633744\|PMID:18483225\|PMID:22172574
Sp1	Mouse	copper(II) sulfate	multiple interactions	ISO	RGD:732035	6480464	Copper Sulfate inhibits the reaction [Cisplatin results in increased expression of SP1 mRNA]; Copper Sulfate more ...	CTD	PMID:22172574\|PMID:24132751\|PMID:26241054
Sp1	Mouse	copper(II) sulfate	decreases expression	ISO	RGD:732035	6480464	[Copper Sulfate results in decreased expression of SP1 mRNA] which results in decreased expression of more ...	CTD	PMID:22172574\|PMID:22914438
Sp1	Mouse	copper(II) sulfate	increases expression	ISO	RGD:732035	6480464	Copper Sulfate results in increased expression of SP1 mRNA	CTD	PMID:19549813
Sp1	Mouse	copper(II) sulfate	decreases activity	ISO	RGD:732035	6480464	Copper Sulfate results in decreased activity of SP1 protein	CTD	PMID:22172574\|PMID:26241054
Sp1	Mouse	cordycepin	multiple interactions	ISO	RGD:3738	6480464	cordycepin inhibits the reaction [Etoposide results in increased activity of SP1 protein]; cordycepin inhibits the more ...	CTD	PMID:23690541
Sp1	Mouse	cordycepin	decreases expression	EXP		6480464	cordycepin results in decreased expression of SP1 protein	CTD	PMID:33948356
Sp1	Mouse	cordycepin	affects metabolic processing	ISO	RGD:732035	6480464	cordycepin affects the metabolism of SP1 polyA tail	CTD	PMID:33948356
Sp1	Mouse	cordycepin	decreases expression	ISO	RGD:732035	6480464	cordycepin results in decreased expression of SP1 mRNA; cordycepin results in decreased expression of SP1 more ...	CTD	PMID:25282637\|PMID:33948356
Sp1	Mouse	cordycepin	multiple interactions	ISO	RGD:732035	6480464	cordycepin inhibits the reaction [[SP1 protein binds to TUBA1B promoter] which results in decreased expression more ...	CTD	PMID:33948356
Sp1	Mouse	cordycepin	increases activity	ISO	RGD:732035	6480464	cordycepin results in increased activity of SP1 protein	CTD	PMID:19051361
Sp1	Mouse	coumarin	decreases phosphorylation	ISO	RGD:732035	6480464	coumarin results in decreased phosphorylation of SP1 protein	CTD	PMID:35688186
Sp1	Mouse	crocidolite asbestos	affects expression	ISO	RGD:732035	6480464	Asbestos, Crocidolite affects the expression of SP1 mRNA	CTD	PMID:17331233
Sp1	Mouse	CU-O LINKAGE	increases expression	ISO	RGD:732035	6480464	cupric oxide results in increased expression of SP1 mRNA	CTD	PMID:22077320
Sp1	Mouse	curcumin	decreases expression	ISO	RGD:732035	6480464	Curcumin results in decreased expression of SP1 protein	CTD	PMID:18347134\|PMID:18593936
Sp1	Mouse	cyclosporin A	multiple interactions	ISO	RGD:732035	6480464	[Cyclosporine co-treated with NGF protein] affects the localization of SP1 protein; [Cyclosporine co-treated with NGF more ...	CTD	PMID:24244623
Sp1	Mouse	cypermethrin	decreases phosphorylation	EXP		6480464	cypermethrin results in decreased phosphorylation of SP1 protein	CTD	PMID:34794910
Sp1	Mouse	cypermethrin	decreases expression	ISO	RGD:3738	6480464	cypermethrin results in decreased expression of SP1 mRNA	CTD	PMID:34794910
Sp1	Mouse	cypermethrin	multiple interactions	ISO	RGD:3738	6480464	[cypermethrin co-treated with pyrazolanthrone] results in decreased phosphorylation of SP1 protein; asiatic acid inhibits the more ...	CTD	PMID:34794910
Sp1	Mouse	cypermethrin	decreases phosphorylation	ISO	RGD:3738	6480464	cypermethrin results in decreased phosphorylation of SP1 protein	CTD	PMID:34794910
Sp1	Mouse	D-glucose	multiple interactions	ISO	RGD:3738	6480464	UCP1 protein inhibits the reaction [Glucose results in decreased phosphorylation of SP1 protein]; UCP1 protein more ...	CTD	PMID:11050244
Sp1	Mouse	D-glucose	multiple interactions	ISO	RGD:732035	6480464	SOD2 protein inhibits the reaction [Glucose results in decreased phosphorylation of SP1 protein]; SOD2 protein more ...	CTD	PMID:11050244
Sp1	Mouse	D-penicillamine	increases expression	ISO	RGD:732035	6480464	Penicillamine results in increased expression of SP1 mRNA	CTD	PMID:22914438
Sp1	Mouse	daunorubicin	multiple interactions	ISO	RGD:732035	6480464	AKT1 protein inhibits the reaction [Daunorubicin results in decreased expression of SP1 protein]; benzyloxycarbonylleucyl-leucyl-leucine aldehyde more ...	CTD	PMID:34963561
Sp1	Mouse	daunorubicin	decreases expression	ISO	RGD:732035	6480464	Daunorubicin results in decreased expression of SP1 protein	CTD	PMID:34963561
Sp1	Mouse	decabromodiphenyl ether	increases expression	ISO	RGD:3738	6480464	decabromobiphenyl ether results in increased expression of SP1 mRNA	CTD	PMID:23640034
Sp1	Mouse	deoxynivalenol	multiple interactions	ISO	RGD:732035	6480464	deoxynivalenol promotes the reaction [SP1 protein binds to KMT2A promoter]; SP1 protein promotes the reaction more ...	CTD	PMID:19438726
Sp1	Mouse	deoxynivalenol	affects expression	ISO	RGD:732035	6480464	deoxynivalenol affects the expression of SP1 protein	CTD	PMID:33890134
Sp1	Mouse	deoxynivalenol	increases phosphorylation	ISO	RGD:732035	6480464	deoxynivalenol results in increased phosphorylation of SP1 protein	CTD	PMID:19438726
Sp1	Mouse	desferrioxamine B	multiple interactions	ISO	RGD:732035	6480464	[Deferoxamine affects the abundance of Iron] inhibits the reaction [TNF protein results in increased activity more ...	CTD	PMID:12633744
Sp1	Mouse	Diallyltetrasulfane	multiple interactions	ISO	RGD:3738	6480464	diallyl tetrasulfide inhibits the reaction [cypermethrin results in decreased phosphorylation of SP1 protein]	CTD	PMID:34794910
Sp1	Mouse	diarsenic trioxide	decreases activity	ISO	RGD:732035	6480464	Arsenic Trioxide results in decreased activity of SP1 protein	CTD	PMID:11714746
Sp1	Mouse	diarsenic trioxide	decreases expression	ISO	RGD:732035	6480464	Arsenic Trioxide results in decreased expression of SP1 mRNA; Arsenic Trioxide results in decreased expression more ...	CTD	PMID:17617380\|PMID:20435036\|PMID:25395240\|PMID:25436934\|PMID:28768059
Sp1	Mouse	diarsenic trioxide	affects methylation	ISO	RGD:732035	6480464	Arsenic Trioxide affects the methylation of SP1 promoter	CTD	PMID:26046465
Sp1	Mouse	diarsenic trioxide	multiple interactions	ISO	RGD:732035	6480464	Arsenic Trioxide inhibits the reaction [SP1 protein binds to CYTL1 promoter]; Arsenic Trioxide inhibits the more ...	CTD	PMID:11714746\|PMID:15761015\|PMID:25395240\|PMID:26892147\|PMID:28768059
Sp1	Mouse	diazinon	increases methylation	ISO	RGD:732035	6480464	Diazinon results in increased methylation of SP1 gene	CTD	PMID:22964155
Sp1	Mouse	Dibutyl phosphate	affects expression	ISO	RGD:732035	6480464	di-n-butylphosphoric acid affects the expression of SP1 mRNA	CTD	PMID:37042841
Sp1	Mouse	dibutyl phthalate	decreases expression	EXP		6480464	Dibutyl Phthalate results in decreased expression of SP1 mRNA	CTD	PMID:29029336
Sp1	Mouse	dibutyl phthalate	multiple interactions	ISO	RGD:732035	6480464	SP1 protein affects the reaction [Dibutyl Phthalate results in increased expression of CCL2 mRNA]	CTD	PMID:35397443
Sp1	Mouse	dibutyl phthalate	increases expression	ISO	RGD:732035	6480464	Dibutyl Phthalate results in increased expression of SP1 mRNA; Dibutyl Phthalate results in increased expression more ...	CTD	PMID:35397443
Sp1	Mouse	dibutyl phthalate	multiple interactions	EXP		6480464	[Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with 4-nonylphenol co-treated with more ...	CTD	PMID:29029336
Sp1	Mouse	dieldrin	decreases response to substance	ISO	RGD:732035	6480464	SP1 gene mutant form results in decreased susceptibility to Dieldrin	CTD	PMID:32421776
Sp1	Mouse	diethylstilbestrol	increases expression	EXP		6480464	Diethylstilbestrol results in increased expression of SP1 mRNA	CTD	PMID:16714842
Sp1	Mouse	dimethyl sulfoxide	multiple interactions	ISO	RGD:732035	6480464	Dimethyl Sulfoxide promotes the reaction [SP1 protein binds to CAD promoter]	CTD	PMID:16675542
Sp1	Mouse	dioxygen	increases expression	ISO	RGD:732035	6480464	Oxygen deficiency results in increased expression of SP1 protein	CTD	PMID:17307335
Sp1	Mouse	dioxygen	increases phosphorylation	ISO	RGD:3738	6480464	Oxygen deficiency results in increased phosphorylation of SP1 protein	CTD	PMID:23814049
Sp1	Mouse	dioxygen	multiple interactions	ISO	RGD:732035	6480464	2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [Oxygen deficiency results in increased expression of SP1 protein]; SP1 protein more ...	CTD	PMID:17307335
Sp1	Mouse	disodium selenite	multiple interactions	ISO	RGD:732035	6480464	[Sodium Selenite results in decreased activity of SP1 protein] which results in decreased expression of more ...	CTD	PMID:16928829\|PMID:35384129
Sp1	Mouse	disodium selenite	multiple interactions	ISO	RGD:3738	6480464	[Sodium Selenite results in increased abundance of Selenium] inhibits the reaction [[Cadmium Chloride results in more ...	CTD	PMID:35384129
Sp1	Mouse	disodium selenite	multiple interactions	EXP		6480464	Sodium Selenite inhibits the reaction [[Lipopolysaccharides co-treated with IFNG protein] results in increased activity of more ...	CTD	PMID:15650415
Sp1	Mouse	doxorubicin	affects activity	ISO	RGD:732035	6480464	Doxorubicin affects the activity of SP1 protein	CTD	PMID:17108358
Sp1	Mouse	doxorubicin	decreases phosphorylation	ISO	RGD:732035	6480464	Doxorubicin results in decreased phosphorylation of SP1 protein	CTD	PMID:38367682
Sp1	Mouse	doxorubicin	increases ribosylation	ISO	RGD:732035	6480464	Doxorubicin results in increased ribosylation of SP1 protein	CTD	PMID:22293659
Sp1	Mouse	doxorubicin	decreases expression	ISO	RGD:732035	6480464	Doxorubicin results in decreased expression of SP1 mRNA	CTD	PMID:29803840
Sp1	Mouse	doxorubicin	multiple interactions	ISO	RGD:732035	6480464	[Doxorubicin results in increased ribosylation of SP1 protein] affects the reaction [SP1 protein binds to more ...	CTD	PMID:17124180\|PMID:19351845\|PMID:22293659\|PMID:38367682
Sp1	Mouse	elemental selenium	multiple interactions	ISO	RGD:3738	6480464	[Sodium Selenite results in increased abundance of Selenium] inhibits the reaction [[Cadmium Chloride results in more ...	CTD	PMID:35384129
Sp1	Mouse	elemental selenium	multiple interactions	ISO	RGD:732035	6480464	[Sodium Selenite results in increased abundance of Selenium] inhibits the reaction [[Cadmium Chloride results in more ...	CTD	PMID:35384129
Sp1	Mouse	enzyme inhibitor	multiple interactions	ISO	RGD:732035	6480464	[Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ...	CTD	PMID:23301498
Sp1	Mouse	epoxomicin	multiple interactions	ISO	RGD:732035	6480464	epoxomicin inhibits the reaction [5-(4-((6-(allyloxy)-2,5,7,8-tetramethylchroman-2-yl)methoxy)-3-methoxybenzylidene)thiazolidine-2,4-dione results in decreased expression of SP1 protein]; epoxomicin inhibits the more ...	CTD	PMID:17409431
Sp1	Mouse	epoxomicin	increases ubiquitination	ISO	RGD:732035	6480464	epoxomicin results in increased ubiquitination of SP1 protein	CTD	PMID:17409431
Sp1	Mouse	esculetin	decreases expression	ISO	RGD:732035	6480464	esculetin results in decreased expression of SP1 protein	CTD	PMID:31313495
Sp1	Mouse	estrogen	increases expression	ISO	RGD:3738	152177689	estrogen increases expression of Sp1 mRNA in rat uterus	RGD
Sp1	Mouse	ethanol	multiple interactions	ISO	RGD:732035	6480464	Ethanol promotes the reaction [SP1 protein binds to FASLG promoter]	CTD	PMID:24899502
Sp1	Mouse	ethanol	multiple interactions	EXP		6480464	Ethanol promotes the reaction [SP1 protein binds to CYP2B10 promoter]; PPARD gene mutant form inhibits more ...	CTD	PMID:27765815
Sp1	Mouse	etoposide	increases phosphorylation	ISO	RGD:732035	6480464	Etoposide results in increased phosphorylation of SP1 protein	CTD	PMID:17441964
Sp1	Mouse	etoposide	increases expression	ISO	RGD:3738	6480464	Etoposide results in increased expression of SP1 mRNA	CTD	PMID:23690541
Sp1	Mouse	etoposide	increases activity	ISO	RGD:3738	6480464	Etoposide results in increased activity of SP1 protein	CTD	PMID:23690541
Sp1	Mouse	etoposide	multiple interactions	ISO	RGD:3738	6480464	cordycepin inhibits the reaction [Etoposide results in increased activity of SP1 protein]; cordycepin inhibits the more ...	CTD	PMID:23690541
Sp1	Mouse	etoposide	multiple interactions	ISO	RGD:732035	6480464	PRKDC protein promotes the reaction [Etoposide results in increased phosphorylation of SP1 protein]; wortmannin inhibits more ...	CTD	PMID:17441964
Sp1	Mouse	flutamide	increases expression	ISO	RGD:3738	6480464	Flutamide results in increased expression of SP1 mRNA	CTD	PMID:24793618
Sp1	Mouse	folic acid	multiple interactions	ISO	RGD:732035	6480464	Folic Acid inhibits the reaction [sodium arsenite results in decreased expression of SP1 protein]; Folic more ...	CTD	PMID:16728583\|PMID:33360347
Sp1	Mouse	folic acid	decreases expression	EXP		6480464	Folic Acid results in decreased expression of SP1 mRNA	CTD	PMID:25629700
Sp1	Mouse	folic acid	multiple interactions	EXP		6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ...	CTD	PMID:20938992
Sp1	Mouse	FR900359	increases phosphorylation	ISO	RGD:732035	6480464	FR900359 results in increased phosphorylation of SP1 protein	CTD	PMID:37730182
Sp1	Mouse	fulvestrant	multiple interactions	ISO	RGD:732035	6480464	fulvestrant promotes the reaction [SP1 protein binds to ESRRA promoter]	CTD	PMID:20211987
Sp1	Mouse	galactose	increases expression	ISO	RGD:3738	6480464	Galactose results in increased expression of SP1 protein	CTD	PMID:30367734
Sp1	Mouse	galactose	multiple interactions	ISO	RGD:3738	6480464	Alpinia oxyphylla fruit extract inhibits the reaction [Galactose results in increased expression of SP1 protein]	CTD	PMID:30367734
Sp1	Mouse	genistein	multiple interactions	ISO	RGD:732035	6480464	Genistein promotes the reaction [SP1 protein binds to VDR promoter]; U 0126 inhibits the reaction more ...	CTD	PMID:17088408
Sp1	Mouse	genistein	increases expression	ISO	RGD:732035	6480464	Genistein results in increased expression of SP1 protein	CTD	PMID:24685904
Sp1	Mouse	genistein	increases activity	ISO	RGD:732035	6480464	Genistein results in increased activity of SP1 protein	CTD	PMID:17088408
Sp1	Mouse	gentamycin	increases expression	ISO	RGD:3738	6480464	Gentamicins results in increased expression of SP1 mRNA	CTD	PMID:22061828
Sp1	Mouse	glucose	multiple interactions	ISO	RGD:3738	6480464	UCP1 protein inhibits the reaction [Glucose results in decreased phosphorylation of SP1 protein]; UCP1 protein more ...	CTD	PMID:11050244
Sp1	Mouse	glucose	multiple interactions	ISO	RGD:732035	6480464	SOD2 protein inhibits the reaction [Glucose results in decreased phosphorylation of SP1 protein]; SOD2 protein more ...	CTD	PMID:11050244
Sp1	Mouse	glutathione	multiple interactions	ISO	RGD:732035	6480464	Glutathione inhibits the reaction [Hydrogen Peroxide results in decreased expression of SP1 protein]	CTD	PMID:20435036
Sp1	Mouse	glutathione	decreases expression	ISO	RGD:732035	6480464	Glutathione results in decreased expression of SP1	CTD	PMID:18556457
Sp1	Mouse	glycitein	increases activity	ISO	RGD:732035	6480464	glycitein results in increased activity of SP1 protein	CTD	PMID:17088408
Sp1	Mouse	glycitein	multiple interactions	ISO	RGD:732035	6480464	glycitein promotes the reaction [SP1 protein binds to VDR promoter]; U 0126 inhibits the reaction more ...	CTD	PMID:17088408
Sp1	Mouse	glyphosate	increases expression	ISO	RGD:732035	6480464	Glyphosate results in increased expression of SP1 mRNA	CTD	PMID:31295307
Sp1	Mouse	homocysteic acid	increases activity	ISO	RGD:732035	6480464	homocysteic acid results in increased activity of SP1 protein	CTD	PMID:11261509
Sp1	Mouse	homocysteic acid	multiple interactions	ISO	RGD:732035	6480464	mithramycin A inhibits the reaction [homocysteic acid results in increased activity of SP1 protein]	CTD	PMID:11261509
Sp1	Mouse	hydrogen peroxide	multiple interactions	ISO	RGD:732035	6480464	[Hydrogen Peroxide results in increased activity of PARP1 protein] which results in decreased activity of more ...	CTD	PMID:17108117\|PMID:17961220\|PMID:19105596\|PMID:20435036\|PMID:33360347
Sp1	Mouse	hydrogen peroxide	increases phosphorylation	EXP		6480464	Hydrogen Peroxide results in increased phosphorylation of SP1 protein	CTD	PMID:31494107
Sp1	Mouse	hydrogen peroxide	affects expression	ISO	RGD:732035	6480464	Hydrogen Peroxide affects the expression of SP1 protein	CTD	PMID:17961220
Sp1	Mouse	hydrogen peroxide	multiple interactions	EXP		6480464	[Hydrogen Peroxide results in increased activity of and results in increased ADP-ribosylation of PARP1 protein] more ...	CTD	PMID:17108117\|PMID:17961220\|PMID:20478378\|PMID:21569840\|PMID:31494107
Sp1	Mouse	hydrogen peroxide	decreases expression	ISO	RGD:732035	6480464	Hydrogen Peroxide results in decreased expression of SP1 protein	CTD	PMID:20435036\|PMID:33360347
Sp1	Mouse	hydroquinone	multiple interactions	ISO	RGD:732035	6480464	4-(4-fluorophenyl)-2-(4-hydroxyphenyl)-5-(4-pyridyl)imidazole inhibits the reaction [[WEHI-539 co-treated with venetoclax co-treated with hydroquinone] results in increased expression more ...	CTD	PMID:35561756
Sp1	Mouse	indole-3-methanol	multiple interactions	ISO	RGD:732035	6480464	indole-3-carbinol analog inhibits the reaction [SP1 protein binds to CDK6 promoter]	CTD	PMID:20570586
Sp1	Mouse	indole-3-methanol	decreases activity	ISO	RGD:732035	6480464	indole-3-carbinol results in decreased activity of SP1 protein	CTD	PMID:16082211
Sp1	Mouse	irinotecan	increases phosphorylation	ISO	RGD:732035	6480464	Irinotecan results in increased phosphorylation of SP1 protein	CTD	PMID:17441964
Sp1	Mouse	irinotecan	decreases expression	ISO	RGD:732035	6480464	Irinotecan analog results in decreased expression of SP1 mRNA	CTD	PMID:18927307
Sp1	Mouse	irinotecan	multiple interactions	ISO	RGD:732035	6480464	SP1 protein affects the susceptibility to [Fluorouracil co-treated with Irinotecan analog]	CTD	PMID:18927307
Sp1	Mouse	iron atom	multiple interactions	ISO	RGD:732035	6480464	[Deferoxamine affects the abundance of Iron] inhibits the reaction [TNF protein results in increased activity more ...	CTD	PMID:12633744
Sp1	Mouse	iron(0)	multiple interactions	ISO	RGD:732035	6480464	[Deferoxamine affects the abundance of Iron] inhibits the reaction [TNF protein results in increased activity more ...	CTD	PMID:12633744
Sp1	Mouse	isoprenaline	multiple interactions	EXP		6480464	[Phenylephrine co-treated with Isoproterenol] results in increased expression of SP1 mRNA; EGR1 protein affects the more ...	CTD	PMID:10710348
Sp1	Mouse	jaceosidin	multiple interactions	ISO	RGD:732035	6480464	SP1 protein inhibits the reaction [jaceosidin results in decreased expression of CFLAR protein]; SP1 protein more ...	CTD	PMID:27729209
Sp1	Mouse	ketoconazole	decreases expression	ISO	RGD:3738	6480464	Ketoconazole results in decreased expression of SP1 mRNA	CTD	PMID:37077353
Sp1	Mouse	L-ascorbic acid	decreases expression	ISO	RGD:732035	6480464	Ascorbic Acid results in decreased expression of SP1 protein	CTD	PMID:21919647
Sp1	Mouse	L-methionine	multiple interactions	EXP		6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ...	CTD	PMID:20938992
Sp1	Mouse	lead diacetate	increases expression	EXP		6480464	lead acetate results in increased expression of SP1 mRNA; lead acetate results in increased expression more ...	CTD	PMID:23867794\|PMID:24260418
Sp1	Mouse	lead diacetate	increases expression	ISO	RGD:732035	6480464	lead acetate results in increased expression of SP1 protein	CTD	PMID:24462621
Sp1	Mouse	lead diacetate	multiple interactions	ISO	RGD:732035	6480464	tolfenamic acid inhibits the reaction [lead acetate results in increased expression of SP1 protein]	CTD	PMID:24462621
Sp1	Mouse	lead(0)	increases expression	ISO	RGD:732035	6480464	Lead results in increased expression of SP1 protein	CTD	PMID:22272629
Sp1	Mouse	lead(0)	multiple interactions	EXP		6480464	[[lead chloride results in increased abundance of Lead] co-treated with [sodium arsenite results in increased more ...	CTD	PMID:32179164
Sp1	Mouse	lead(II) chloride	multiple interactions	EXP		6480464	[[lead chloride results in increased abundance of Lead] co-treated with [sodium arsenite results in increased more ...	CTD	PMID:32179164
Sp1	Mouse	lipoic acid	multiple interactions	EXP		6480464	Thioctic Acid results in increased phosphorylation of and results in decreased activity of SP1 protein	CTD	PMID:21351249
Sp1	Mouse	lipopolysaccharide	multiple interactions	ISO	RGD:732035	6480464	Lipopolysaccharides promotes the reaction [SP1 protein binds to BAG3 promoter]; trichostatin A inhibits the reaction more ...	CTD	PMID:21911040\|PMID:22020323
Sp1	Mouse	lipopolysaccharide	multiple interactions	EXP		6480464	Sodium Selenite inhibits the reaction [[Lipopolysaccharides co-treated with IFNG protein] results in increased activity of more ...	CTD	PMID:15650415
Sp1	Mouse	lipopolysaccharide	increases expression	ISO	RGD:732035	6480464	Lipopolysaccharides results in increased expression of SP1 mRNA	CTD	PMID:21911040
Sp1	Mouse	LY294002	multiple interactions	ISO	RGD:732035	6480464	2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [cobaltous chloride results in increased expression of SP1 protein]; 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits more ...	CTD	PMID:17307335\|PMID:26385185
Sp1	Mouse	LY294002	increases phosphorylation	EXP		6480464	2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one results in increased phosphorylation of SP1 protein	CTD	PMID:21351249
Sp1	Mouse	manganese atom	multiple interactions	ISO	RGD:3738	6480464	Manganese promotes the reaction [SP1 protein modified form binds to CASP3 promoter]; Manganese results in more ...	CTD	PMID:22975163
Sp1	Mouse	manganese(0)	multiple interactions	ISO	RGD:3738	6480464	Manganese promotes the reaction [SP1 protein modified form binds to CASP3 promoter]; Manganese results in more ...	CTD	PMID:22975163
Sp1	Mouse	mercury dichloride	increases expression	ISO	RGD:3738	6480464	Mercuric Chloride results in increased expression of SP1 mRNA	CTD	PMID:16507785
Sp1	Mouse	metformin	multiple interactions	ISO	RGD:732035	6480464	[nickel chloride co-treated with Metformin] promotes the reaction [SP1 protein binds to GSTM2 promoter]; [nickel more ...	CTD	PMID:25110054\|PMID:38050843
Sp1	Mouse	metformin	decreases expression	ISO	RGD:732035	6480464	Metformin results in decreased expression of SP1 protein	CTD	PMID:25110054\|PMID:26317792
Sp1	Mouse	methapyrilene	decreases expression	ISO	RGD:3738	6480464	Methapyrilene results in decreased expression of SP1 mRNA	CTD	PMID:30467583
Sp1	Mouse	methimazole	decreases expression	ISO	RGD:3738	6480464	Methimazole results in decreased expression of SP1 mRNA	CTD	PMID:30047161\|PMID:38685447
Sp1	Mouse	methylmercury chloride	decreases expression	ISO	RGD:3738	6480464	methylmercuric chloride results in decreased expression of SP1 protein	CTD	PMID:28736149
Sp1	Mouse	methylmercury chloride	multiple interactions	EXP		6480464	[[lead chloride results in increased abundance of Lead] which co-treated with methylmercuric chloride] results in more ...	CTD	PMID:32179164
Sp1	Mouse	methylmercury chloride	decreases expression	ISO	RGD:732035	6480464	methylmercuric chloride results in decreased expression of SP1 mRNA	CTD	PMID:28001369
Sp1	Mouse	methylparaben	decreases expression	ISO	RGD:732035	6480464	methylparaben results in decreased expression of SP1 mRNA	CTD	PMID:31745603
Sp1	Mouse	methylseleninic acid	multiple interactions	ISO	RGD:732035	6480464	methylselenic acid inhibits the reaction [SP1 protein binds to BIRC5 promoter]	CTD	PMID:17876054
Sp1	Mouse	mibolerone	multiple interactions	ISO	RGD:732035	6480464	[Quercetin co-treated with mibolerone] promotes the reaction [SP1 protein binds to JUN protein binds to more ...	CTD	PMID:15661808\|PMID:20148354
Sp1	Mouse	microcystin-LR	decreases expression	EXP		6480464	cyanoginosin LR results in decreased expression of SP1 mRNA; cyanoginosin LR results in decreased expression more ...	CTD	PMID:36206955
Sp1	Mouse	microcystin-LR	decreases expression	ISO	RGD:732035	6480464	cyanoginosin LR results in decreased expression of SP1 mRNA	CTD	PMID:36206955
Sp1	Mouse	mithramycin	decreases activity	ISO	RGD:732035	6480464	Plicamycin results in decreased activity of SP1 protein	CTD	PMID:15946989
Sp1	Mouse	mithramycin	decreases expression	EXP		6480464	Plicamycin results in decreased expression of SP1 protein	CTD	PMID:34087332
Sp1	Mouse	mithramycin	decreases expression	ISO	RGD:3738	6480464	Plicamycin results in decreased expression of SP1 mRNA	CTD	PMID:23814049
Sp1	Mouse	mithramycin	multiple interactions	ISO	RGD:732035	6480464	[Plicamycin inhibits the reaction [SP1 protein binds to TNFSF10 promoter]] which results in increased expression more ...	CTD	PMID:17307335\|PMID:21603612\|PMID:24244623
Sp1	Mouse	monosodium L-glutamate	increases expression	ISO	RGD:3738	6480464	Sodium Glutamate results in increased expression of SP1 mRNA	CTD	PMID:20928830
Sp1	Mouse	morin	multiple interactions	EXP		6480464	2-chloro-5-nitrobenzanilide inhibits the reaction [morin promotes the reaction [PPARG protein binds to SP1 protein]]; morin more ...	CTD	PMID:36121554
Sp1	Mouse	N-acetyl-L-cysteine	decreases expression	ISO	RGD:732035	6480464	Acetylcysteine results in decreased expression of SP1 protein	CTD	PMID:18556457
Sp1	Mouse	N-acetyl-L-cysteine	multiple interactions	ISO	RGD:3738	6480464	Acetylcysteine inhibits the reaction [sodium arsenite results in decreased expression of SP1 protein]	CTD	PMID:33360347
Sp1	Mouse	N-acetyl-L-cysteine	multiple interactions	ISO	RGD:732035	6480464	Acetylcysteine inhibits the reaction [Camptothecin results in increased expression of SP1 mRNA]; Acetylcysteine inhibits the more ...	CTD	PMID:16928829\|PMID:30851366\|PMID:33360347
Sp1	Mouse	N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal	multiple interactions	EXP		6480464	benzyloxycarbonylleucyl-leucyl-leucine aldehyde promotes the reaction [SP1 protein binds to ARNT promoter]; benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in more ...	CTD	PMID:14529614
Sp1	Mouse	N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal	multiple interactions	ISO	RGD:732035	6480464	benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [5-(4-((6-(allyloxy)-2,5,7,8-tetramethylchroman-2-yl)methoxy)-3-methoxybenzylidene)thiazolidine-2,4-dione results in decreased expression of SP1 protein]; benzyloxycarbonylleucyl-leucyl-leucine aldehyde more ...	CTD	PMID:17409431\|PMID:34963561
Sp1	Mouse	N-butyl-N-(4-hydroxybutyl)nitrosamine	increases expression	EXP		6480464	Butylhydroxybutylnitrosamine results in increased expression of SP1 protein	CTD	PMID:24998975
Sp1	Mouse	N-ethylmaleimide	multiple interactions	EXP		6480464	Ethylmaleimide inhibits the reaction [CD 437 results in increased cleavage of SP1 protein]	CTD	PMID:9343396
Sp1	Mouse	N-ethylmaleimide	multiple interactions	ISO	RGD:732035	6480464	Ethylmaleimide inhibits the reaction [CD 437 results in increased cleavage of SP1 protein]	CTD	PMID:9343396
Sp1	Mouse	N-methyl-4-phenylpyridinium	multiple interactions	ISO	RGD:3738	6480464	SP1 protein affects the reaction [1-Methyl-4-phenylpyridinium results in increased expression of TIGAR protein]	CTD	PMID:33359019
Sp1	Mouse	N-methyl-4-phenylpyridinium	increases expression	ISO	RGD:732035	6480464	1-Methyl-4-phenylpyridinium results in increased expression of SP1 mRNA; 1-Methyl-4-phenylpyridinium results in increased expression of SP1 more ...	CTD	PMID:34508910
Sp1	Mouse	N-methyl-4-phenylpyridinium	multiple interactions	ISO	RGD:732035	6480464	NEAT1 affects the reaction [1-Methyl-4-phenylpyridinium results in increased expression of SP1 mRNA]; NEAT1 affects the more ...	CTD	PMID:34508910
Sp1	Mouse	neocuproine	multiple interactions	ISO	RGD:732035	6480464	[neocuproine affects the abundance of Copper] inhibits the reaction [TNF protein results in increased activity more ...	CTD	PMID:12633744
Sp1	Mouse	nickel atom	increases activity	ISO	RGD:732035	6480464	Nickel results in increased activity of SP1 protein	CTD	PMID:19403854
Sp1	Mouse	nickel dichloride	multiple interactions	ISO	RGD:732035	6480464	[nickel chloride co-treated with Metformin] promotes the reaction [SP1 protein binds to GSTM2 promoter]; [nickel more ...	CTD	PMID:30055191\|PMID:38050843
Sp1	Mouse	nicotine	multiple interactions	ISO	RGD:732035	6480464	Nicotine promotes the reaction [[GATA4 protein binds to SP1 protein] which binds to CHRNA7 protein]; more ...	CTD	PMID:24089524
Sp1	Mouse	nimustine	multiple interactions	ISO	RGD:732035	6480464	[SP1 protein results in decreased susceptibility to Nimustine] which affects the expression of MGMT protein	CTD	PMID:29164620
Sp1	Mouse	nimustine	decreases response to substance	ISO	RGD:732035	6480464	SP1 protein results in decreased susceptibility to Nimustine	CTD	PMID:29164620
Sp1	Mouse	NORCANTHARIDIN	multiple interactions	EXP		6480464	SP1 protein affects the reaction [norcantharidin results in decreased expression of MMP9 mRNA]	CTD	PMID:19616522
Sp1	Mouse	NORCANTHARIDIN	decreases activity	EXP		6480464	norcantharidin results in decreased activity of SP1 protein	CTD	PMID:19616522
Sp1	Mouse	olomoucine	increases expression	ISO	RGD:732035	6480464	olomoucine results in increased expression of SP1 mRNA; olomoucine results in increased expression of SP1 more ...	CTD	PMID:14653808
Sp1	Mouse	oxaliplatin	multiple interactions	ISO	RGD:732035	6480464	oxaliplatin inhibits the reaction [SP1 protein binds to DUT promoter]	CTD	PMID:19015155
Sp1	Mouse	ozone	multiple interactions	ISO	RGD:732035	6480464	[Air Pollutants results in increased abundance of Ozone] which affects the expression of SP1 mRNA	CTD	PMID:35430440
Sp1	Mouse	p-tert-Amylphenol	multiple interactions	EXP		6480464	[Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with 4-nonylphenol co-treated with more ...	CTD	PMID:29029336
Sp1	Mouse	palbociclib	multiple interactions	ISO	RGD:732035	6480464	palbociclib inhibits the reaction [[PDGFB protein binds to PDGFB protein] inhibits the reaction [RB1 protein more ...	CTD	PMID:21880723
Sp1	Mouse	paracetamol	affects expression	EXP		6480464	Acetaminophen affects the expression of SP1 mRNA	CTD	PMID:17562736
Sp1	Mouse	PD 168393	multiple interactions	ISO	RGD:3738	6480464	PD168393 inhibits the reaction [AGT protein promotes the reaction [SP1 protein binds to TGFB1 promoter]]; more ...	CTD	PMID:25398788
Sp1	Mouse	pentachlorophenol	increases expression	EXP		6480464	Pentachlorophenol results in increased expression of SP1 mRNA	CTD	PMID:23892564
Sp1	Mouse	perfluorooctane-1-sulfonic acid	multiple interactions	EXP		6480464	[perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of SP1 mRNA	CTD	PMID:36331819
Sp1	Mouse	phenobarbital	affects expression	EXP		6480464	Phenobarbital affects the expression of SP1 mRNA	CTD	PMID:23091169
Sp1	Mouse	phenobarbital	decreases expression	ISO	RGD:3738	6480464	Phenobarbital results in decreased expression of SP1 mRNA	CTD	PMID:30047161
Sp1	Mouse	phenylephrine	multiple interactions	EXP		6480464	[Phenylephrine co-treated with Isoproterenol] results in increased expression of SP1 mRNA; EGR1 protein affects the more ...	CTD	PMID:10710348
Sp1	Mouse	PhIP	increases expression	ISO	RGD:732035	6480464	2-amino-1-methyl-6-phenylimidazo(4,5-b)pyridine results in increased expression of SP1 protein	CTD	PMID:22307971
Sp1	Mouse	phorbol 13-acetate 12-myristate	increases expression	EXP		6480464	Tetradecanoylphorbol Acetate results in increased expression of SP1 mRNA	CTD	PMID:27351882
Sp1	Mouse	phorbol 13-acetate 12-myristate	increases activity	ISO	RGD:732035	6480464	Tetradecanoylphorbol Acetate results in increased activity of SP1 protein	CTD	PMID:15978937
Sp1	Mouse	phorbol 13-acetate 12-myristate	multiple interactions	ISO	RGD:732035	6480464	[Tetradecanoylphorbol Acetate co-treated with Calcimycin] affects the localization of SP1 protein; Tetradecanoylphorbol Acetate promotes the more ...	CTD	PMID:10669635\|PMID:15978937\|PMID:24244623
Sp1	Mouse	platycodin D	multiple interactions	ISO	RGD:732035	6480464	platycodin D results in decreased expression of and results in decreased activity of SP1 protein	CTD	PMID:18093727
Sp1	Mouse	promegestone	increases expression	ISO	RGD:732035	6480464	Promegestone results in increased expression of SP1 mRNA; Promegestone results in increased expression of SP1 more ...	CTD	PMID:16807381
Sp1	Mouse	promegestone	multiple interactions	ISO	RGD:732035	6480464	mithramycin A inhibits the reaction [Promegestone promotes the reaction [SP1 protein binds to HSD17B2 promoter]]; more ...	CTD	PMID:16807381
Sp1	Mouse	propiconazole	decreases expression	EXP		6480464	propiconazole results in decreased expression of SP1 mRNA	CTD	PMID:21278054
Sp1	Mouse	protein kinase inhibitor	multiple interactions	ISO	RGD:732035	6480464	Protein Kinase Inhibitors inhibits the reaction [tricarbonyldichlororuthenium (II) dimer results in increased phosphorylation of SP1 more ...	CTD	PMID:26385185
Sp1	Mouse	pterostilbene	multiple interactions	ISO	RGD:732035	6480464	SP1 protein affects the reaction [[pterostilbene co-treated with Quercetin] results in increased expression of SOD2 more ...	CTD	PMID:18852136
Sp1	Mouse	quercetin	decreases expression	ISO	RGD:732035	6480464	Quercetin results in decreased expression of SP1 protein	CTD	PMID:18377872
Sp1	Mouse	quercetin	multiple interactions	ISO	RGD:732035	6480464	4-(4-fluorophenyl)-2-(4-hydroxyphenyl)-5-(4-pyridyl)imidazole inhibits the reaction [Quercetin promotes the reaction [SP1 protein binds to PLAT promoter]]; [Quercetin more ...	CTD	PMID:15661808\|PMID:18377872\|PMID:18419748\|PMID:18852136\|PMID:18980244\|PMID:20148354\|PMID:23530649\|PMID:24173369
Sp1	Mouse	quercetin	multiple interactions	EXP		6480464	MAPK14 protein promotes the reaction [Quercetin promotes the reaction [SP1 protein binds to ABCA1 promoter]]; more ...	CTD	PMID:22711909
Sp1	Mouse	quercetin	increases activity	ISO	RGD:732035	6480464	Quercetin results in increased activity of SP1 protein	CTD	PMID:18980244
Sp1	Mouse	quercetin 3-O-beta-D-galactopyranoside	multiple interactions	ISO	RGD:732035	6480464	[Quercetin co-treated with hyperoside] inhibits the reaction [MIR27A mRNA results in increased expression of SP1 more ...	CTD	PMID:24173369
Sp1	Mouse	quinacrine	multiple interactions	ISO	RGD:732035	6480464	4-(4-fluorophenyl)-2-(4-hydroxyphenyl)-5-(4-pyridyl)imidazole inhibits the reaction [Quinacrine results in increased expression of SP1 protein]; BTRC protein inhibits more ...	CTD	PMID:28867437
Sp1	Mouse	resveratrol	multiple interactions	ISO	RGD:732035	6480464	[resveratrol co-treated with clofarabine] affects the localization of SP1 protein; [resveratrol co-treated with clofarabine] results more ...	CTD	PMID:16614140\|PMID:17049495\|PMID:23146690\|PMID:23437203\|PMID:23530649\|PMID:25875864
Sp1	Mouse	resveratrol	decreases acetylation	ISO	RGD:732035	6480464	resveratrol results in decreased acetylation of SP1 protein	CTD	PMID:25875864
Sp1	Mouse	resveratrol	decreases expression	EXP		6480464	resveratrol results in decreased expression of SP1 protein	CTD	PMID:25505154
Sp1	Mouse	resveratrol	decreases expression	ISO	RGD:3738	6480464	resveratrol results in decreased expression of SP1 mRNA	CTD	PMID:25905778
Sp1	Mouse	resveratrol	affects localization	ISO	RGD:732035	6480464	resveratrol affects the localization of SP1 protein	CTD	PMID:23437203
Sp1	Mouse	resveratrol	decreases activity	ISO	RGD:732035	6480464	resveratrol results in decreased activity of SP1 protein	CTD	PMID:23437203
Sp1	Mouse	resveratrol	decreases activity	ISO	RGD:3738	6480464	resveratrol results in decreased activity of SP1 protein	CTD	PMID:18420994
Sp1	Mouse	resveratrol	increases activity	ISO	RGD:732035	6480464	resveratrol results in increased activity of SP1 protein	CTD	PMID:17049495
Sp1	Mouse	S-adenosyl-L-homocysteine	multiple interactions	ISO	RGD:3738	6480464	S-Adenosylhomocysteine promotes the reaction [SP1 protein binds to MMP2 promoter]	CTD	PMID:19770485
Sp1	Mouse	S-adenosyl-L-methioninate	multiple interactions	EXP		6480464	S-Adenosylmethionine inhibits the reaction [SP1 protein binds to COL1A2 promoter]	CTD	PMID:15983038
Sp1	Mouse	S-adenosyl-L-methioninate	multiple interactions	ISO	RGD:732035	6480464	S-Adenosylmethionine inhibits the reaction [TGFB1 protein promotes the reaction [SP1 protein binds to MAPK1 protein more ...	CTD	PMID:15983038
Sp1	Mouse	S-adenosyl-L-methionine	multiple interactions	ISO	RGD:732035	6480464	S-Adenosylmethionine inhibits the reaction [TGFB1 protein promotes the reaction [SP1 protein binds to MAPK1 protein more ...	CTD	PMID:15983038
Sp1	Mouse	S-adenosyl-L-methionine	multiple interactions	EXP		6480464	S-Adenosylmethionine inhibits the reaction [SP1 protein binds to COL1A2 promoter]	CTD	PMID:15983038
Sp1	Mouse	S-butyl-DL-homocysteine (S,R)-sulfoximine	increases activity	ISO	RGD:732035	6480464	Buthionine Sulfoximine results in increased activity of SP1 protein	CTD	PMID:11261509
Sp1	Mouse	S-butyl-DL-homocysteine (S,R)-sulfoximine	multiple interactions	ISO	RGD:732035	6480464	mithramycin A inhibits the reaction [Buthionine Sulfoximine results in increased activity of SP1 protein]	CTD	PMID:11261509
Sp1	Mouse	S-nitrosoglutathione	increases activity	ISO	RGD:732035	6480464	S-Nitrosoglutathione results in increased activity of SP1 protein	CTD	PMID:14766015
Sp1	Mouse	SB 203580	multiple interactions	ISO	RGD:732035	6480464	SB 203580 inhibits the reaction [Hydrogen Peroxide promotes the reaction [SP1 protein results in increased more ...	CTD	PMID:17108117
Sp1	Mouse	SCH772984	multiple interactions	ISO	RGD:3738	6480464	SCH772984 inhibits the reaction [Ethylene Chlorohydrin results in increased expression of and results in increased more ...	CTD	PMID:31585129
Sp1	Mouse	selenium atom	multiple interactions	ISO	RGD:3738	6480464	[Sodium Selenite results in increased abundance of Selenium] inhibits the reaction [[Cadmium Chloride results in more ...	CTD	PMID:35384129
Sp1	Mouse	selenium atom	multiple interactions	ISO	RGD:732035	6480464	[Sodium Selenite results in increased abundance of Selenium] inhibits the reaction [[Cadmium Chloride results in more ...	CTD	PMID:35384129
Sp1	Mouse	silicon dioxide	decreases expression	ISO	RGD:732035	6480464	Silicon Dioxide results in decreased expression of SP1 mRNA	CTD	PMID:25351596
Sp1	Mouse	silver atom	decreases expression	ISO	RGD:732035	6480464	Silver results in decreased expression of SP1 mRNA	CTD	PMID:26551752
Sp1	Mouse	silver(0)	decreases expression	ISO	RGD:732035	6480464	Silver results in decreased expression of SP1 mRNA	CTD	PMID:26551752
Sp1	Mouse	silver(1+) nitrate	increases expression	ISO	RGD:732035	6480464	Silver Nitrate results in increased expression of SP1 mRNA	CTD	PMID:24132751
Sp1	Mouse	simvastatin	multiple interactions	ISO	RGD:732035	6480464	Simvastatin inhibits the reaction [SP1 binds to COL1A1 promoter]	CTD	PMID:16575855
Sp1	Mouse	sodium arsenite	increases expression	ISO	RGD:732035	6480464	sodium arsenite results in increased expression of SP1 mRNA; sodium arsenite results in increased expression more ...	CTD	PMID:23562784\|PMID:31170415
Sp1	Mouse	sodium arsenite	multiple interactions	EXP		6480464	[[lead chloride results in increased abundance of Lead] co-treated with [sodium arsenite results in increased more ...	CTD	PMID:32179164
Sp1	Mouse	sodium arsenite	multiple interactions	ISO	RGD:3738	6480464	Acetylcysteine inhibits the reaction [sodium arsenite results in decreased expression of SP1 protein]	CTD	PMID:33360347
Sp1	Mouse	sodium arsenite	decreases expression	ISO	RGD:3738	6480464	sodium arsenite results in decreased expression of SP1 mRNA; sodium arsenite results in decreased expression more ...	CTD	PMID:33360347
Sp1	Mouse	sodium arsenite	decreases expression	ISO	RGD:732035	6480464	sodium arsenite results in decreased expression of SP1 mRNA; sodium arsenite results in decreased expression more ...	CTD	PMID:33360347
Sp1	Mouse	sodium arsenite	multiple interactions	ISO	RGD:732035	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of SP1 more ...	CTD	PMID:33360347\|PMID:36669534
Sp1	Mouse	sodium chloride	multiple interactions	ISO	RGD:3738	6480464	[[SP1 protein co-treated with JUN protein] binds to CLDN4 promoter] promotes the reaction [Sodium Chloride more ...	CTD	PMID:23816505
Sp1	Mouse	sodium dichromate	increases activity	ISO	RGD:732035	6480464	sodium bichromate results in increased activity of SP1 protein	CTD	PMID:10411148
Sp1	Mouse	T-2 toxin	multiple interactions	ISO	RGD:732035	6480464	T-2 Toxin promotes the reaction [SP1 protein binds to CYP1A1 promoter]	CTD	PMID:31470059
Sp1	Mouse	tamoxifen	multiple interactions	ISO	RGD:732035	6480464	Tamoxifen promotes the reaction [[[ESR1 protein binds to SP1 protein] which binds to E2F1 promoter] more ...	CTD	PMID:20211987\|PMID:20215421
Sp1	Mouse	tamoxifen	multiple interactions	EXP		6480464	Tamoxifen promotes the reaction [[SP1 protein binds to PEMT promoter] which results in decreased expression more ...	CTD	PMID:20150657
Sp1	Mouse	temozolomide	multiple interactions	ISO	RGD:732035	6480464	Temozolomide promotes the reaction [TP53 protein binds to SP1 protein]	CTD	PMID:29164620
Sp1	Mouse	terameprocol	multiple interactions	ISO	RGD:732035	6480464	terameprocol inhibits the reaction [SP1 protein results in increased expression of ABCB1 mRNA]	CTD	PMID:16544145
Sp1	Mouse	terameprocol	decreases activity	ISO	RGD:732035	6480464	terameprocol results in decreased activity of SP1 protein	CTD	PMID:16544145
Sp1	Mouse	tetrachloroethene	increases expression	EXP		6480464	Tetrachloroethylene results in increased expression of SP1 mRNA	CTD	PMID:28973375
Sp1	Mouse	tetrathiomolybdate(2-)	multiple interactions	ISO	RGD:732035	6480464	[tetrathiomolybdate results in decreased abundance of Copper] which results in increased expression of SP1 protein; more ...	CTD	PMID:22172574
Sp1	Mouse	tetrathiomolybdate(2-)	increases expression	ISO	RGD:732035	6480464	tetrathiomolybdate results in increased expression of SP1; tetrathiomolybdate results in increased expression of SP1 mRNA	CTD	PMID:22172574\|PMID:22914438
Sp1	Mouse	tetrathiomolybdate(2-)	increases activity	ISO	RGD:732035	6480464	tetrathiomolybdate results in increased activity of SP1 protein	CTD	PMID:22172574
Sp1	Mouse	thalidomide	decreases activity	ISO	RGD:732035	6480464	Thalidomide results in decreased activity of SP1 protein	CTD	PMID:10533722
Sp1	Mouse	thapsigargin	decreases expression	ISO	RGD:3738	6480464	Thapsigargin results in decreased expression of SP1 mRNA	CTD	PMID:25398788
Sp1	Mouse	Theaflavin 3,3'-digallate	multiple interactions	ISO	RGD:732035	6480464	theaflavin-3,3'-digallate inhibits the reaction [EGF protein results in increased activity of SP1 protein]	CTD	PMID:12931129
Sp1	Mouse	Tiron	multiple interactions	EXP		6480464	SP1 protein affects the reaction [1,2-Dihydroxybenzene-3,5-Disulfonic Acid Disodium Salt results in decreased expression of TGFB1 more ...	CTD	PMID:11163763
Sp1	Mouse	titanium dioxide	affects methylation	EXP		6480464	titanium dioxide affects the methylation of SP1 promoter	CTD	PMID:35295148
Sp1	Mouse	tolfenamic acid	multiple interactions	ISO	RGD:732035	6480464	tolfenamic acid inhibits the reaction [lead acetate results in increased expression of SP1 protein]	CTD	PMID:24462621
Sp1	Mouse	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of SP1 mRNA	CTD	PMID:21135412
Sp1	Mouse	trichostatin A	multiple interactions	ISO	RGD:732035	6480464	[[decitabine co-treated with trichostatin A] promotes the reaction [SP1 protein binds to SLC25A1 promoter]] which more ...	CTD	PMID:16740727\|PMID:16757381\|PMID:17986852\|PMID:18706393\|PMID:18801729\|PMID:21911040
Sp1	Mouse	trichostatin A	affects expression	ISO	RGD:732035	6480464	trichostatin A affects the expression of SP1 mRNA; trichostatin A affects the expression of SP1 more ...	CTD	PMID:18801729
Sp1	Mouse	trichostatin A	increases activity	ISO	RGD:732035	6480464	trichostatin A results in increased activity of SP1 protein	CTD	PMID:16757381
Sp1	Mouse	Triptolide	increases expression	EXP		6480464	triptolide results in increased expression of SP1 mRNA	CTD	PMID:32835833
Sp1	Mouse	Triptolide	decreases expression	EXP		6480464	triptolide results in decreased expression of SP1 protein	CTD	PMID:34087332
Sp1	Mouse	triptonide	decreases expression	EXP		6480464	triptonide results in decreased expression of SP1 mRNA	CTD	PMID:33045310
Sp1	Mouse	troglitazone	decreases expression	ISO	RGD:732035	6480464	troglitazone results in decreased expression of SP1 protein	CTD	PMID:15908479\|PMID:17409431
Sp1	Mouse	troglitazone	decreases expression	EXP		6480464	troglitazone results in decreased expression of SP1 mRNA	CTD	PMID:28973697
Sp1	Mouse	troglitazone	multiple interactions	ISO	RGD:732035	6480464	[troglitazone results in increased degradation of SP1 protein] which results in decreased expression of AR more ...	CTD	PMID:17409431
Sp1	Mouse	troglitazone	increases degradation	ISO	RGD:732035	6480464	troglitazone results in increased degradation of SP1 protein	CTD	PMID:17409431
Sp1	Mouse	tunicamycin	decreases expression	ISO	RGD:3738	6480464	Tunicamycin results in decreased expression of SP1 mRNA	CTD	PMID:25398788
Sp1	Mouse	tyrphostin AG 1478	multiple interactions	ISO	RGD:3738	6480464	RTKI cpd inhibits the reaction [AGT protein promotes the reaction [SP1 protein binds to TGFB1 more ...	CTD	PMID:25398788
Sp1	Mouse	urethane	decreases expression	ISO	RGD:732035	6480464	Urethane results in decreased expression of SP1 mRNA	CTD	PMID:28818685
Sp1	Mouse	valproic acid	multiple interactions	ISO	RGD:732035	6480464	Valproic Acid promotes the reaction [SP1 protein binds to XPC promoter]	CTD	PMID:21507255
Sp1	Mouse	valproic acid	decreases expression	ISO	RGD:732035	6480464	Valproic Acid results in decreased expression of SP1 mRNA	CTD	PMID:23179753\|PMID:28001369
Sp1	Mouse	valproic acid	decreases expression	EXP		6480464	Valproic Acid results in decreased expression of SP1 mRNA	CTD	PMID:21427059
Sp1	Mouse	venetoclax	multiple interactions	ISO	RGD:732035	6480464	4-(4-fluorophenyl)-2-(4-hydroxyphenyl)-5-(4-pyridyl)imidazole inhibits the reaction [[WEHI-539 co-treated with venetoclax co-treated with hydroquinone] results in increased expression more ...	CTD	PMID:35561756
Sp1	Mouse	vincristine	decreases expression	ISO	RGD:732035	6480464	Vincristine results in decreased expression of SP1 mRNA	CTD	PMID:23649840
Sp1	Mouse	vorinostat	multiple interactions	ISO	RGD:732035	6480464	SP1 protein promotes the reaction [vorinostat results in increased expression of CDKN1A mRNA]	CTD	PMID:11126357
Sp1	Mouse	wortmannin	multiple interactions	ISO	RGD:732035	6480464	wortmannin inhibits the reaction [Etoposide results in increased phosphorylation of SP1 protein]	CTD	PMID:17441964
Sp1	Mouse	wortmannin	decreases reaction	ISO	RGD:3738	152177689	wortmannin inhibits the reaction [estrogen increases expression of Sp1 mRNA] in rat uterus	RGD
Sp1	Mouse	zinc acetate	increases expression	ISO	RGD:732035	6480464	Zinc Acetate results in increased expression of SP1 mRNA	CTD	PMID:24132751
Sp1	Mouse	zinc atom	multiple interactions	ISO	RGD:732035	6480464	Cadmium inhibits the reaction [[SP1 protein binds to Zinc] which binds to SLC5A1 promoter]; Cadmium more ...	CTD	PMID:20073493
Sp1	Mouse	zinc atom	decreases expression	ISO	RGD:3738	6480464	Zinc deficiency results in decreased expression of SP1 protein	CTD	PMID:21893222
Sp1	Mouse	zinc atom	multiple interactions	EXP		6480464	Zinc promotes the reaction [MTF1 protein binds to SP1 protein]; Zinc promotes the reaction [MTF1 more ...	CTD	PMID:18458062
Sp1	Mouse	zinc atom	increases activity	ISO	RGD:732035	6480464	Zinc deficiency results in increased activity of SP1 protein	CTD	PMID:18356318
Sp1	Mouse	zinc atom	affects binding	ISO	RGD:732035	6480464	SP1 protein binds to Zinc	CTD	PMID:20073493
Sp1	Mouse	zinc dichloride	multiple interactions	EXP		6480464	zinc chloride inhibits the reaction [Cadmium Chloride inhibits the reaction [SP1 protein binds to and more ...	CTD	PMID:20060848
Sp1	Mouse	zinc dichloride	increases activity	ISO	RGD:732035	6480464	zinc chloride results in increased activity of SP1 protein	CTD	PMID:9330853
Sp1	Mouse	zinc sulfate	multiple interactions	ISO	RGD:732035	6480464	Zinc Sulfate inhibits the reaction [Copper Sulfate results in decreased activity of SP1 protein]	CTD	PMID:26241054
Sp1	Mouse	zinc(0)	multiple interactions	ISO	RGD:732035	6480464	Cadmium inhibits the reaction [[SP1 protein binds to Zinc] which binds to SLC5A1 promoter]; Cadmium more ...	CTD	PMID:20073493
Sp1	Mouse	zinc(0)	affects binding	ISO	RGD:732035	6480464	SP1 protein binds to Zinc	CTD	PMID:20073493
Sp1	Mouse	zinc(0)	increases activity	ISO	RGD:732035	6480464	Zinc deficiency results in increased activity of SP1 protein	CTD	PMID:18356318
Sp1	Mouse	zinc(0)	multiple interactions	EXP		6480464	Zinc promotes the reaction [MTF1 protein binds to SP1 protein]; Zinc promotes the reaction [MTF1 more ...	CTD	PMID:18458062
Sp1	Mouse	zinc(0)	decreases expression	ISO	RGD:3738	6480464	Zinc deficiency results in decreased expression of SP1 protein	CTD	PMID:21893222
Sp1	Mouse	zoledronic acid	increases expression	ISO	RGD:732035	6480464	zoledronic acid results in increased expression of SP1 mRNA	CTD	PMID:20977926

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sp1	Mouse	cellular response to estrogen stimulus		ISO	RGD:3738	9068941		RGD	PMID:17272396\|REF_RGD_ID:152177689
Sp1	Mouse	cellular response to insulin stimulus	involved_in	ISO	RGD:3738	2290270		GO_Central	GO_REF:0000096
Sp1	Mouse	cellular response to wortmannin		ISO	RGD:3738	9068941		RGD	PMID:17272396\|REF_RGD_ID:152177689
Sp1	Mouse	cellular response to zinc ion starvation		ISO	RGD:3738	9068941		RGD	PMID:21893222\|REF_RGD_ID:151667428
Sp1	Mouse	definitive hemopoiesis	acts_upstream_of_or_within	IGI	MGI:1277166	2290270	PMID:17584888	MGI	PMID:17584888
Sp1	Mouse	embryonic camera-type eye morphogenesis	acts_upstream_of_or_within	IGI	MGI:1277166	2290270	PMID:17584888	MGI	PMID:17584888
Sp1	Mouse	embryonic placenta development	acts_upstream_of_or_within	IGI	MGI:1277166	2290270	PMID:17584888	MGI	PMID:17584888
Sp1	Mouse	embryonic process involved in female pregnancy	acts_upstream_of_or_within	IGI	MGI:1277166	2290270	PMID:17584888	MGI	PMID:17584888
Sp1	Mouse	embryonic skeletal system development	acts_upstream_of_or_within	IGI	MGI:1277166	2290270	PMID:17584888	MGI	PMID:17584888
Sp1	Mouse	enucleate erythrocyte differentiation	acts_upstream_of_or_within	IGI	MGI:1277166	2290270	PMID:17584888	MGI	PMID:17584888
Sp1	Mouse	gene expression	acts_upstream_of_or_within	ISS	UniProtKB:P08047	2290270	PMID:24736457	MGI	PMID:24736457
Sp1	Mouse	in utero embryonic development	acts_upstream_of_or_within	IGI	MGI:1277166	2290270	PMID:17584888	MGI	PMID:17584888
Sp1	Mouse	liver development	acts_upstream_of_or_within	IGI	MGI:1277166	2290270	PMID:17584888	MGI	PMID:17584888
Sp1	Mouse	lung development	acts_upstream_of_or_within	IGI	MGI:1277166	2290270	PMID:17584888	MGI	PMID:17584888
Sp1	Mouse	megakaryocyte differentiation	acts_upstream_of_or_within	IGI	MGI:1277166	2290270	PMID:17584888	MGI	PMID:17584888
Sp1	Mouse	mRNA transcription by RNA polymerase II	acts_upstream_of_or_within	IDA		2290270	PMID:22331133	MGI	PMID:22331133
Sp1	Mouse	myeloid progenitor cell differentiation	acts_upstream_of_or_within	IGI	MGI:1277166	2290270	PMID:17584888	MGI	PMID:17584888
Sp1	Mouse	neuron differentiation	acts_upstream_of_or_within	IMP		2290270	PMID:29781215	MGI	PMID:29781215
Sp1	Mouse	ossification	acts_upstream_of_or_within	IGI	MGI:1277166	2290270	PMID:17584888	MGI	PMID:17584888
Sp1	Mouse	positive regulation by host of viral transcription	involved_in	ISO	UniProtKB:P08047	2290270		GO_Central	GO_REF:0000119
Sp1	Mouse	positive regulation of amyloid-beta formation	acts_upstream_of	ISO	UniProtKB:P08047	2290270		GO_Central	GO_REF:0000119
Sp1	Mouse	positive regulation of angiogenesis	involved_in	ISO	UniProtKB:P08047	2290270		GO_Central	GO_REF:0000119
Sp1	Mouse	positive regulation of apoptotic signaling pathway	involved_in	ISO	RGD:732035	9068941	PMID:18293083	BHF-UCL	PMID:18293083
Sp1	Mouse	positive regulation of blood vessel endothelial cell migration	involved_in	ISO	UniProtKB:P08047	2290270		GO_Central	GO_REF:0000119
Sp1	Mouse	positive regulation of DNA-templated transcription	involved_in	ISO	UniProtKB:P08047	2290270		GO_Central	GO_REF:0000119
Sp1	Mouse	positive regulation of DNA-templated transcription	acts_upstream_of_or_within	ISO	UniProtKB:P08047	2290270	PMID:14580349	MGI	PMID:14580349
Sp1	Mouse	positive regulation of DNA-templated transcription	acts_upstream_of_or_within	IDA		2290270	PMID:15282343, PMID:15589828	MGI	PMID:15282343\|PMID:15589828
Sp1	Mouse	positive regulation of DNA-templated transcription	involved_in	IDA		2290270	PMID:24030830	UniProt	PMID:24030830
Sp1	Mouse	positive regulation of gene expression	involved_in	ISO	UniProtKB:P08047	2290270		GO_Central	GO_REF:0000119
Sp1	Mouse	positive regulation of hydrogen sulfide biosynthetic process	involved_in	ISO	UniProtKB:P08047	2290270		GO_Central	GO_REF:0000119
Sp1	Mouse	positive regulation of transcription by RNA polymerase II	involved_in	IDA		2290270	PMID:14701757	ARUK-UCL	PMID:14701757
Sp1	Mouse	positive regulation of transcription by RNA polymerase II	acts_upstream_of_or_within	IDA		2290270	PMID:1524678	MGI	PMID:1524678
Sp1	Mouse	positive regulation of transcription by RNA polymerase II	acts_upstream_of_or_within	IGI	MGI:106587	2290270	PMID:15663180	MGI	PMID:15663180
Sp1	Mouse	positive regulation of transcription by RNA polymerase II	involved_in	ISO	RGD:3738	2290270		GO_Central	GO_REF:0000096
Sp1	Mouse	positive regulation of transcription by RNA polymerase II	involved_in	IMP		2290270	PMID:21029371	BHF-UCL	PMID:21029371
Sp1	Mouse	positive regulation of transcription by RNA polymerase II	involved_in	ISO	UniProtKB:P08047	2290270		GO_Central	GO_REF:0000119
Sp1	Mouse	positive regulation of vascular endothelial cell proliferation	involved_in	ISO	UniProtKB:P08047	2290270		GO_Central	GO_REF:0000119
Sp1	Mouse	regulation of DNA-templated transcription	involved_in	IMP		2290270	PMID:27918959	UniProt	PMID:27918959
Sp1	Mouse	regulation of DNA-templated transcription	acts_upstream_of_or_within	IMP		2290270	PMID:12119294	MGI	PMID:12119294
Sp1	Mouse	regulation of DNA-templated transcription	involved_in	ISO	UniProtKB:P08047	2290270		GO_Central	GO_REF:0000119
Sp1	Mouse	regulation of transcription by RNA polymerase II		ISO	RGD:3738	9068941		RGD	PMID:11457835\|REF_RGD_ID:737656
Sp1	Mouse	regulation of transcription by RNA polymerase II	involved_in	ISO	RGD:3738	2290270		GO_Central	GO_REF:0000096
Sp1	Mouse	regulation of transcription by RNA polymerase II	involved_in	IBA	PANTHER:PTN004619861\|UniProtKB:P19544\|UniProtKB:Q13118\|UniProtKB:Q9Y5W3\|MGI:2181068\|MGI:1333856\|MGI:95296\|MGI:2153049\|UniProtKB:P08047\|UniProtKB:O14901\|UniProtKB:Q02446\|UniProtKB:Q05215\|FB:FBgn0263239\|MGI:2153568\|MGI:1342771\|RGD:3974\|WB:WBGene00012735\|ZFIN:ZDB-GENE-021115-9\|MGI:1354948\|FB:FBgn0043364\|MGI:95295\|MGI:1927715\|CGD:CAL0000177853\|UniProtKB:Q9Y4X4\|MGI:1333796\|FB:FBgn0261434\|UniProtKB:A0A8J1MUN6\|MGI:1306780\|UniProtKB:O95600\|UniProtKB:Q13887\|MGI:1342287\|UniProtKB:Q8TDD2\|UniProtKB:Q02086\|RGD:2544\|MGI:1342772\|MGI:98968\|UniProtKB:O43474\|MGI:3577024\|WB:WBGene00018990\|UniProtKB:O75840\|ZFIN:ZDB-GENE-980526-55\|UniProtKB:Q8TD94\|UniProtKB:Q99612\|RGD:2546\|UniProtKB:P18146\|RGD:3738\|UniProtKB:Q02447\|MGI:1338056\|SGD:S000004972\|MGI:98372\|FB:FBgn0000233\|RGD:621445\|RGD:62389\|UniProtKB:Q7RTV3\|MGI:1342773\|UniProtKB:Q9UIH9\|UniProtKB:P11161	2290270		GO_Central	GO_REF:0000033
Sp1	Mouse	response to hydroperoxide	involved_in	IDA		2290270	PMID:27918959	UniProt	PMID:27918959
Sp1	Mouse	retinoic acid catabolic process	acts_upstream_of_or_within	IDA		2290270	PMID:9250660	MGI	PMID:9250660
Sp1	Mouse	retinoic acid receptor signaling pathway	acts_upstream_of	IDA		2290270	PMID:9250660	MGI	PMID:9250660
Sp1	Mouse	rhythmic process	involved_in	IEA	UniProtKB-KW:KW-0090	2290270		UniProt	GO_REF:0000043
Sp1	Mouse	trophectodermal cell differentiation	acts_upstream_of_or_within	IGI	MGI:1277166	2290270	PMID:17584888	MGI	PMID:17584888

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sp1	Mouse	chromatin	located_in	IDA		2290270	PMID:21029371	BHF-UCL	PMID:21029371
Sp1	Mouse	chromatin	located_in	ISO	RGD:3738	2290270		GO_Central	GO_REF:0000096
Sp1	Mouse	chromatin	located_in	ISO	UniProtKB:P08047	2290270		GO_Central	GO_REF:0000119
Sp1	Mouse	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	2290270		UniProt	GO_REF:0000044
Sp1	Mouse	euchromatin	is_active_in	ISO	UniProtKB:P08047	2290270		GO_Central	GO_REF:0000119
Sp1	Mouse	nucleoplasm	located_in	ISO	UniProtKB:P08047	2290270		GO_Central	GO_REF:0000119
Sp1	Mouse	nucleus	located_in	ISO	UniProtKB:P08047	2290270		GO_Central	GO_REF:0000119
Sp1	Mouse	nucleus	located_in	ISO	RGD:3738	2290270		GO_Central	GO_REF:0000096
Sp1	Mouse	nucleus	located_in	IDA		2290270	PMID:11004506, PMID:12119294, PMID:15016652, PMID:15282343, PMID:15817708, PMID:16141233, PMID:27918959, PMID:9705320	MGI	PMID:11004506\|PMID:12119294\|PMID:15016652\|PMID:15282343\|PMID:15817708\|PMID:16141233\|PMID:27918959\|PMID:9705320
Sp1	Mouse	protein-containing complex	part_of	ISS	UniProtKB:P08047	2290270	PMID:24736457	MGI	PMID:24736457
Sp1	Mouse	protein-DNA complex		ISO	RGD:3738	9068941		RGD	PMID:19765194\|REF_RGD_ID:2316171
Sp1	Mouse	protein-DNA complex	part_of	ISO	RGD:3738	2290270		GO_Central	GO_REF:0000096
Sp1	Mouse	transcription repressor complex	part_of	ISO	UniProtKB:P08047	2290270		GO_Central	GO_REF:0000119

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sp1	Mouse	bHLH transcription factor binding	enables	IPI	UniProtKB:Q99PV5	2290270	PMID:12657651	BHF-UCL	PMID:12657651
Sp1	Mouse	cis-regulatory region sequence-specific DNA binding	enables	IDA		2290270	PMID:15511642, PMID:19943855, PMID:9705320	MGI	PMID:15511642\|PMID:19943855\|PMID:9705320
Sp1	Mouse	DNA binding	enables	ISO	UniProtKB:P08047	2290270		GO_Central	GO_REF:0000119
Sp1	Mouse	DNA binding	enables	ISS		2290270	PMID:15820306	MGI	PMID:15820306
Sp1	Mouse	DNA binding	enables	IDA		2290270	PMID:12119294, PMID:14630713, PMID:14667815, PMID:15589828, PMID:16886906, PMID:9738004	MGI	PMID:12119294\|PMID:14630713\|PMID:14667815\|PMID:15589828\|PMID:16886906\|PMID:9738004
Sp1	Mouse	DNA-binding transcription activator activity, RNA polymerase II-specific	enables	IDA		2290270	PMID:19943855	MGI	PMID:19943855
Sp1	Mouse	DNA-binding transcription activator activity, RNA polymerase II-specific	enables	ISO	UniProtKB:P08047	2290270		GO_Central	GO_REF:0000119
Sp1	Mouse	DNA-binding transcription factor activity	enables	IMP		2290270	PMID:12119294	MGI	PMID:12119294
Sp1	Mouse	DNA-binding transcription factor activity	enables	IDA		2290270	PMID:1524678, PMID:15282343, PMID:15589828, PMID:29781215	MGI	PMID:1524678\|PMID:15282343\|PMID:15589828\|PMID:29781215
Sp1	Mouse	DNA-binding transcription factor activity	enables	ISO	UniProtKB:P08047	2290270		GO_Central	GO_REF:0000119
Sp1	Mouse	DNA-binding transcription factor activity, RNA polymerase II-specific	enables	IBA	PANTHER:PTN004619861\|FB:FBgn0000233\|RGD:621445\|MGI:1306780\|UniProtKB:O95600\|UniProtKB:Q9UIH9\|UniProtKB:Q13887\|MGI:1342287\|UniProtKB:P11161\|MGI:1354948\|ZFIN:ZDB-GENE-021115-9\|MGI:95295\|UniProtKB:Q99612\|MGI:1333796\|MGI:1277166\|UniProtKB:Q9Y4X4\|UniProtKB:P18146\|MGI:1927715\|MGI:1338056\|SGD:S000004972\|MGI:98372\|UniProtKB:Q05215\|MGI:2153568\|MGI:1342771\|WB:WBGene00012735\|UniProtKB:O75840\|ZFIN:ZDB-GENE-980526-55\|UniProtKB:P19544\|ZFIN:ZDB-GENE-011116-1\|UniProtKB:Q02086\|UniProtKB:Q9Y5W3\|MGI:98968\|RGD:2544\|UniProtKB:Q13118\|RGD:1583765\|MGI:2153049\|MGI:2181068\|MGI:1333856\|MGI:95296\|UniProtKB:O43474\|UniProtKB:O14901\|UniProtKB:P08047	2290270		GO_Central	GO_REF:0000033
Sp1	Mouse	DNA-binding transcription factor activity, RNA polymerase II-specific	enables	IDA		2290270	PMID:22331133	MGI	PMID:22331133
Sp1	Mouse	double-stranded DNA binding		ISO	RGD:3738	9068941		RGD	PMID:10837920\|REF_RGD_ID:1626488
Sp1	Mouse	double-stranded DNA binding	enables	IDA		2290270	PMID:15282343	MGI	PMID:15282343
Sp1	Mouse	double-stranded DNA binding	enables	ISO	RGD:3738	2290270		GO_Central	GO_REF:0000096
Sp1	Mouse	double-stranded DNA binding	enables	ISO	UniProtKB:P08047	2290270		GO_Central	GO_REF:0000119
Sp1	Mouse	histone acetyltransferase binding		ISO	RGD:620036	9068941		RGD	PMID:19765194\|REF_RGD_ID:2316171
Sp1	Mouse	histone acetyltransferase binding	enables	ISO	RGD:3738	2290270		GO_Central	GO_REF:0000096
Sp1	Mouse	histone deacetylase binding	enables	ISO	UniProtKB:P08047	2290270		GO_Central	GO_REF:0000119
Sp1	Mouse	identical protein binding	enables	ISO	UniProtKB:P08047	2290270		GO_Central	GO_REF:0000119
Sp1	Mouse	molecular adaptor activity	enables	ISO	UniProtKB:P08047	2290270		GO_Central	GO_REF:0000119
Sp1	Mouse	protein binding	enables	IPI	UniProtKB:Q96DY5	2290270	PMID:27918959	UniProt	PMID:27918959
Sp1	Mouse	protein binding	enables	IPI	PR:O35295\|PR:P42669	2290270	PMID:15282343	MGI	PMID:15282343
Sp1	Mouse	protein binding	enables	IPI	PR:P70354	2290270	PMID:1909605	MGI	PMID:1909605
Sp1	Mouse	protein binding	contributes_to	IPI	UniProtKB:P13297\|UniProtKB:P70354	2290270	PMID:10215616	UniProt	PMID:10215616
Sp1	Mouse	protein homodimerization activity	enables	ISO	UniProtKB:P08047	2290270		GO_Central	GO_REF:0000119
Sp1	Mouse	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	IDA		2290270	PMID:11004506, PMID:12657651, PMID:15094381, PMID:17670746, PMID:18434628, PMID:21029371, PMID:22331133, PMID:24030830, PMID:8617793	UniProt	PMID:11004506\|PMID:12657651\|PMID:15094381\|PMID:17670746\|PMID:18434628\|PMID:21029371\|PMID:22331133\|PMID:24030830\|PMID:8617793
Sp1	Mouse	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	ISO	UniProtKB:P08047	2290270		GO_Central	GO_REF:0000119
Sp1	Mouse	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	ISO	RGD:3738	2290270		GO_Central	GO_REF:0000096
Sp1	Mouse	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	IBA	PANTHER:PTN004619861\|UniProtKB:O95600\|UniProtKB:Q9UIH9\|UniProtKB:Q13887\|UniProtKB:P11161\|MGI:1342287\|UniProtKB:Q99612\|MGI:1354948\|MGI:95295\|UniProtKB:P18146\|MGI:1277166\|UniProtKB:Q9Y4X4\|RGD:3738\|MGI:1338056\|UniProtKB:Q13351\|MGI:98372\|MGI:2153568\|WB:WBGene00018990\|MGI:1342771\|ZFIN:ZDB-GENE-980526-55\|UniProtKB:O75840\|UniProtKB:P19544\|UniProtKB:Q13118\|RGD:2544\|UniProtKB:Q02086\|MGI:2181068\|UniProtKB:O43474\|MGI:95296\|RGD:1583765\|MGI:2153049\|UniProtKB:P08047	2290270		GO_Central	GO_REF:0000033
Sp1	Mouse	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	ISS	UniProtKB:P08047	2290270	PMID:24736457	MGI	PMID:24736457
Sp1	Mouse	RNA polymerase II transcription regulatory region sequence-specific DNA binding	enables	ISO	UniProtKB:P08047	2290270		GO_Central	GO_REF:0000119
Sp1	Mouse	RNA polymerase II transcription regulatory region sequence-specific DNA binding	enables	ISO	RGD:3738	2290270		GO_Central	GO_REF:0000096
Sp1	Mouse	RNA polymerase II-specific DNA-binding transcription factor binding	enables	IPI	UniProtKB:Q99PV5	2290270	PMID:12657651	BHF-UCL	PMID:12657651
Sp1	Mouse	sequence-specific DNA binding	enables	ISO	RGD:3738	2290270		GO_Central	GO_REF:0000096
Sp1	Mouse	sequence-specific DNA binding	enables	ISO	UniProtKB:P08047	2290270		GO_Central	GO_REF:0000119
Sp1	Mouse	sequence-specific DNA binding	enables	IDA		2290270	PMID:11071760	MGI	PMID:11071760
Sp1	Mouse	sequence-specific DNA binding		ISO	RGD:3738	9068941		RGD	PMID:10837920\|PMID:12753154\|REF_RGD_ID:1599299\|REF_RGD_ID:1626488
Sp1	Mouse	sequence-specific double-stranded DNA binding	enables	ISO	UniProtKB:P08047	2290270		GO_Central	GO_REF:0000119
Sp1	Mouse	transcription cis-regulatory region binding	enables	ISO	UniProtKB:P08047	2290270		GO_Central	GO_REF:0000119
Sp1	Mouse	transcription coregulator binding	enables	ISO	RGD:3738	2290270		GO_Central	GO_REF:0000096
Sp1	Mouse	transcription coregulator binding	enables	ISO	UniProtKB:P08047	2290270		GO_Central	GO_REF:0000119
Sp1	Mouse	zinc ion binding	enables	IEA	UniProtKB-KW:KW-0863	2290270		UniProt	GO_REF:0000043

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sp1	Mouse	phosphatidylinositol 3-kinase-Akt signaling pathway		ISO	RGD:3738	152177689		RGD

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sp1	Mouse	Huntington's disease pathway		IEA		6907045		KEGG	mmu:05016
Sp1	Mouse	transforming growth factor-beta superfamily mediated signaling pathway		IEA		6907045		KEGG	mmu:04350

Imported Annotations - PID (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sp1	Mouse	forkhead class A signaling pathway		ISO	RGD:732035	6484113		PID	PID:200226
Sp1	Mouse	forkhead class A signaling pathway		ISO	RGD:732035	6484113		PID	PID:200087
Sp1	Mouse	hypoxia inducible factor pathway		ISO	RGD:732035	6484113		PID	PID:200202
Sp1	Mouse	hypoxia inducible factor pathway		ISO	RGD:732035	6484113		PID	PID:200036
Sp1	Mouse	interleukin-4 signaling pathway		ISO	RGD:732035	6484113		PID	PID:200022

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sp1	Mouse	abnormal bone ossification		IAGP		5509061		MGI	PMID:17584888
Sp1	Mouse	abnormal cranium morphology		IAGP		5509061		MGI	PMID:17584888
Sp1	Mouse	abnormal embryonic tissue morphology		IAGP		5509061		MGI	PMID:9160753
Sp1	Mouse	abnormal erythropoiesis		IAGP		5509061		MGI	PMID:17584888
Sp1	Mouse	abnormal liver sinusoid morphology		IAGP		5509061		MGI	PMID:17584888
Sp1	Mouse	abnormal lung morphology		IAGP		5509061		MGI	PMID:17584888
Sp1	Mouse	abnormal phalanx morphology		IAGP		5509061		MGI	PMID:17584888
Sp1	Mouse	abnormal placenta intervillous maternal lacunae morphology		IAGP		5509061		MGI	PMID:17584888
Sp1	Mouse	abnormal placenta morphology		IAGP		5509061		MGI	PMID:17584888
Sp1	Mouse	anemia		IAGP		5509061		MGI	PMID:17584888
Sp1	Mouse	anophthalmia		IAGP		5509061		MGI	PMID:17584888
Sp1	Mouse	decreased body size		IAGP		5509061		MGI	PMID:17584888
Sp1	Mouse	decreased embryo size		IAGP		5509061		MGI	PMID:9160753
Sp1	Mouse	decreased erythroid progenitor cell number		IAGP		5509061		MGI	PMID:17584888
Sp1	Mouse	decreased fetal weight		IAGP		5509061		MGI	PMID:17584888
Sp1	Mouse	decreased liver weight		IAGP		5509061		MGI	PMID:17584888
Sp1	Mouse	decreased placenta weight		IAGP		5509061		MGI	PMID:17584888
Sp1	Mouse	decreased spongiotrophoblast cell number		IAGP		5509061		MGI	PMID:17584888
Sp1	Mouse	decreased spongiotrophoblast size		IAGP		5509061		MGI	PMID:17584888
Sp1	Mouse	decreased trophoblast glycogen cell number		IAGP		5509061		MGI	PMID:17584888
Sp1	Mouse	disorganized placental labyrinth		IAGP		5509061		MGI	PMID:17584888
Sp1	Mouse	embryonic lethality during organogenesis, complete penetrance		IAGP		5509061		MGI	PMID:9160753
Sp1	Mouse	hypovolemia		IAGP		5509061		MGI	PMID:17584888
Sp1	Mouse	lethality at weaning, complete penetrance		IAGP		5509061		MGI	PMID:17584888
Sp1	Mouse	lethality throughout fetal growth and development, incomplete penetrance		IAGP		5509061		MGI	PMID:17584888
Sp1	Mouse	pallor		IAGP		5509061		MGI	PMID:17584888
Sp1	Mouse	skin edema		IAGP		5509061		MGI	PMID:17584888
Sp1	Mouse	small liver		IAGP		5509061		MGI	PMID:17584888

#	Reference Title	Reference Citation
1.	Functional annotation of a full-length mouse cDNA collection.	Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
2.	Estrogen-induced activation of hypoxia-inducible factor-1alpha, vascular endothelial growth factor expression, and edema in the uterus are mediated by the phosphatidylinositol 3-kinase/Akt pathway.	Kazi AA and Koos RD, Endocrinology. 2007 May;148(5):2363-74. doi: 10.1210/en.2006-1394. Epub 2007 Feb 1.
3.	Murine glypican-4 gene structure and expression; Sp1 and Sp3 play a major role in glypican-4 expression in 3T3-F442A cells.	Li H, etal., Biochim Biophys Acta 2004 Aug 12;1679(2):141-55.
4.	Electronic Transfer of Homolog Data	MGD and Homologene mouse data transfer
5.	MGDs mouse GO annotations	MGD data from the GO Consortium
6.	MGD IEA	MGD IEA
7.	Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
8.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
9.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
10.	Mouse MP Annotation Import Pipeline	RGD automated import pipeline
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Angiotensin II-inducible platelet-derived growth factor-D transcription requires specific Ser/Thr residues in the second zinc finger region of Sp1.	Tan NY, etal., Circ Res. 2008 Feb 29;102(4):e38-51. doi: 10.1161/CIRCRESAHA.107.167395. Epub 2008 Feb 7.

PMID:1377062	PMID:1524678	PMID:1633330	PMID:1797234	PMID:1909605	PMID:1980424	PMID:1981055	PMID:1989904	PMID:7568082	PMID:8012111	PMID:8244404	PMID:8530040
PMID:8593813	PMID:8617793	PMID:8657141	PMID:8871649	PMID:8889548	PMID:9041129	PMID:9060426	PMID:9160753	PMID:9177236	PMID:9250660	PMID:9582278	PMID:9628590
PMID:9705320	PMID:9738004	PMID:10215616	PMID:10349636	PMID:10366853	PMID:10381567	PMID:10409740	PMID:10490658	PMID:10547281	PMID:10922068	PMID:10973950	PMID:11004506
PMID:11042159	PMID:11071760	PMID:11076861	PMID:11230134	PMID:11532028	PMID:11745351	PMID:11777901	PMID:11855856	PMID:12004059	PMID:12054741	PMID:12089157	PMID:12119294
PMID:12220517	PMID:12239153	PMID:12433697	PMID:12520002	PMID:12569082	PMID:12591615	PMID:12657651	PMID:12682245	PMID:12752447	PMID:12794070	PMID:12799440	PMID:12801994
PMID:12847250	PMID:12904583	PMID:14570593	PMID:14576192	PMID:14580349	PMID:14610273	PMID:14630713	PMID:14667815	PMID:14681479	PMID:14701757	PMID:14988733	PMID:15016652
PMID:15094381	PMID:15157741	PMID:15219855	PMID:15247247	PMID:15265983	PMID:15282343	PMID:15310743	PMID:15451065	PMID:15462672	PMID:15467729	PMID:15482850	PMID:15511642
PMID:15528196	PMID:15550398	PMID:15589828	PMID:15601926	PMID:15618518	PMID:15650415	PMID:15663180	PMID:15688401	PMID:15741318	PMID:15817708	PMID:15820306	PMID:15936277
PMID:16021625	PMID:16052479	PMID:16141072	PMID:16141073	PMID:16141233	PMID:16249485	PMID:16266294	PMID:16325481	PMID:16339759	PMID:16377629	PMID:16423470	PMID:16453304
PMID:16484221	PMID:16582099	PMID:16595660	PMID:16709865	PMID:16765933	PMID:16876120	PMID:16886906	PMID:16949047	PMID:16951346	PMID:17090534	PMID:17093407	PMID:17097063
PMID:17214963	PMID:17270292	PMID:17276355	PMID:17317039	PMID:17471507	PMID:17496155	PMID:17584888	PMID:17599098	PMID:17626016	PMID:17641042	PMID:17652337	PMID:17660393
PMID:17670746	PMID:17869213	PMID:17961220	PMID:17967808	PMID:18053794	PMID:18192274	PMID:18249093	PMID:18287559	PMID:18388192	PMID:18417714	PMID:18424770	PMID:18434628
PMID:18440316	PMID:18458062	PMID:18480165	PMID:18513743	PMID:18655767	PMID:18669658	PMID:18673381	PMID:18768463	PMID:18768929	PMID:18790003	PMID:18799693	PMID:18809386
PMID:18812468	PMID:18983969	PMID:19017640	PMID:19041738	PMID:19049975	PMID:19064990	PMID:19070619	PMID:19096034	PMID:19211917	PMID:19285002	PMID:19306294	PMID:19342455
PMID:19420113	PMID:19437621	PMID:19471099	PMID:19590177	PMID:19646513	PMID:19666599	PMID:19741146	PMID:19753117	PMID:19808779	PMID:19883626	PMID:19943855	PMID:19994725
PMID:20056610	PMID:20096375	PMID:20138838	PMID:20150657	PMID:20152817	PMID:20157588	PMID:20207994	PMID:20362542	PMID:20375015	PMID:20412781	PMID:20424664	PMID:20478378
PMID:20529870	PMID:20540995	PMID:20554538	PMID:20833840	PMID:20864529	PMID:20979052	PMID:21029371	PMID:21068393	PMID:21105874	PMID:21179468	PMID:21233130	PMID:21262356
PMID:21267068	PMID:21320120	PMID:21504746	PMID:21555589	PMID:21672091	PMID:21677750	PMID:21731673	PMID:21745612	PMID:21779326	PMID:21820092	PMID:21872590	PMID:21873635
PMID:22049076	PMID:22134960	PMID:22158040	PMID:22185379	PMID:22253285	PMID:22331133	PMID:22378045	PMID:22383952	PMID:22415975	PMID:22511764	PMID:22678117	PMID:22679019
PMID:22706977	PMID:22984509	PMID:22988430	PMID:23112860	PMID:23139414	PMID:23159876	PMID:23201262	PMID:23250796	PMID:23341029	PMID:23376040	PMID:23383201	PMID:23463631
PMID:23558680	PMID:23651731	PMID:23843607	PMID:23868804	PMID:23873932	PMID:23898047	PMID:24030830	PMID:24045949	PMID:24324617	PMID:24451878	PMID:24489103	PMID:24554719
PMID:24627491	PMID:24633789	PMID:24706897	PMID:24736457	PMID:24778176	PMID:24788806	PMID:24821721	PMID:24850855	PMID:24899714	PMID:25003626	PMID:25015265	PMID:25024375
PMID:25175639	PMID:25445985	PMID:25538045	PMID:25711369	PMID:25793500	PMID:26238476	PMID:26279143	PMID:26369286	PMID:26384464	PMID:26487428	PMID:27060138	PMID:27143785
PMID:27179789	PMID:27182621	PMID:27328306	PMID:27384152	PMID:27889927	PMID:27918959	PMID:27959449	PMID:28107769	PMID:28257846	PMID:28343946	PMID:28420000	PMID:28939040
PMID:29091030	PMID:29137983	PMID:29263044	PMID:29781215	PMID:30196744	PMID:30634395	PMID:30652310	PMID:30936247	PMID:30995923	PMID:31164147	PMID:31317491	PMID:31327495
PMID:31372634	PMID:31439839	PMID:31666587	PMID:31732967	PMID:31733201	PMID:31786325	PMID:31863909	PMID:31883458	PMID:31898343	PMID:32436661	PMID:32729205	PMID:33002446
PMID:33230114	PMID:33660806	PMID:33894270	PMID:34074765	PMID:34118948	PMID:34204880	PMID:34321999	PMID:34988755	PMID:35043944	PMID:35099001	PMID:35123924	PMID:35420781
PMID:35420971	PMID:35780770	PMID:35901931	PMID:36497119	PMID:36624701	PMID:36759621	PMID:36765477	PMID:36861193	PMID:37481646	PMID:37735515	PMID:37739218	PMID:38197258
PMID:38200349	PMID:38387733	PMID:38467599	PMID:38632598	PMID:38857058	PMID:38924432	PMID:38982418

Sp1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	102,314,751 - 102,344,839 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	102,314,578 - 102,344,839 (+)	Ensembl		GRCm39 Ensembl
GRCm38	15	102,406,316 - 102,436,404 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	102,406,143 - 102,436,404 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	102,236,747 - 102,266,835 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	102,234,362 - 102,260,713 (+)	NCBI		MGSCv36	mm8
Celera	15	104,563,277 - 104,594,207 (+)	NCBI		Celera
Cytogenetic Map	15	F3	NCBI
cM Map	15	57.55	NCBI

SP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	53,380,176 - 53,416,446 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	53,380,176 - 53,416,446 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	53,773,960 - 53,810,230 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	52,060,246 - 52,096,497 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	52,060,245 - 52,096,491	NCBI
Celera	12	53,423,138 - 53,460,427 (+)	NCBI		Celera
Cytogenetic Map	12	q13.13	NCBI
HuRef	12	50,814,656 - 50,850,614 (+)	NCBI		HuRef
CHM1_1	12	53,741,140 - 53,777,425 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	53,346,223 - 53,382,489 (+)	NCBI		T2T-CHM13v2.0

Sp1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	135,419,864 - 135,450,513 (+)	NCBI		GRCr8
mRatBN7.2	7	133,541,302 - 133,571,961 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	133,541,491 - 133,571,961 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	135,298,300 - 135,327,653 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	137,527,694 - 137,557,048 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	137,513,816 - 137,543,172 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	144,014,173 - 144,044,635 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	144,014,173 - 144,044,629 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	141,805,281 - 141,836,504 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	141,164,180 - 141,194,509 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	141,240,616 - 141,265,690 (+)	NCBI
Celera	7	129,968,890 - 129,999,257 (+)	NCBI		Celera
RH 3.4 Map	7	1062.1	RGD
Cytogenetic Map	7	q36	NCBI

Sp1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955458	644,378 - 677,441 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955458	644,435 - 677,360 (+)	NCBI	ChiLan1.0	ChiLan1.0

SP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	40,770,223 - 40,809,774 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	40,766,986 - 40,806,525 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	35,338,492 - 35,374,462 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	36,122,583 - 36,158,356 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	36,127,681 - 36,158,356 (-)	Ensembl	panpan1.1		panPan2

SP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	27	1,802,587 - 1,861,187 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	27	1,805,184 - 1,847,226 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	27	44,404,740 - 44,448,820 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	27	1,804,038 - 1,848,490 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	27	1,804,038 - 1,848,385 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	27	1,823,470 - 1,867,184 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	27	1,807,708 - 1,852,315 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	27	44,805,663 - 44,849,851 (+)	NCBI		UU_Cfam_GSD_1.0

Sp1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	62,467,059 - 62,509,967 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936512	10,655,349 - 10,693,042 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936512	10,655,116 - 10,693,025 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	18,588,758 - 18,630,089 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	18,588,763 - 18,633,177 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	19,024,941 - 19,070,820 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	49,484,459 - 49,516,941 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	49,484,518 - 49,512,541 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	196,540,987 - 196,574,325 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Sp1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624904	1,475,664 - 1,507,588 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Sp1
859 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	4063
Count of miRNA genes:	895
Interacting mature miRNAs:	1270
Transcripts:	ENSMUST00000001326, ENSMUST00000163709, ENSMUST00000165837, ENSMUST00000165924, ENSMUST00000168802, ENSMUST00000169619, ENSMUST00000170042, ENSMUST00000170884
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300627	Sluc26_m	susceptibility to lung cancer 26 (mouse)			Not determined		15	70345653	104073951	Mouse
1357526	Hyplip2_m	hyperlipidemia 2 (mouse)			Not determined		15	12402203	102896555	Mouse
11528547	Sluc34_m	susceptibility to lung cancer 34 (mouse)					15	97884933	102896555	Mouse
1301918	Skull22_m	skull morphology 22 (mouse)			Not determined		15	85901546	104073951	Mouse
14928306	Manh79_m	mandible shape 79 (mouse)					15	78847557	104073951	Mouse
1357894	Epfpq3_m	epididymal fat percentage QTL 3 (mouse)			Not determined		15	78601103	102901704	Mouse
4142060	W3q6_m	weight 3 weeks QTL 6 (mouse)			Not determined			78601103	102901704	Mouse
12791003	Aath8_m	aortic arch atherosclerosis 8 (mouse)					15	73430144	104073951	Mouse
11530038	Sluc34b_m	susceptibility to lung cancer 34b (mouse)					15	85896437	104073951	Mouse
11530037	Sluc34a_m	susceptibility to lung cancer 34a (mouse)					15	85896437	104073951	Mouse
1558985	Eae32_m	experimental allergic encephalomyelitis susceptibility 32 (mouse)			Not determined		15	32578416	103425899	Mouse
12880411	V125Dq11_m	vitamin D active form serum level QTL 11 (mouse)					15	78897881	104073951	Mouse
1300851	Heal4_m	wound healing/regeneration 4 (mouse)			Not determined		15	77527592	104073951	Mouse
14747011	Mancz13_m	mandible centroid size 13 (mouse)					15	72382669	104073951	Mouse
10402490	Dipa5_m	drug induced psychomotor activation 5 (mouse)			Not determined		15	79163411	104073951	Mouse
1300726	Pitm4_m	prion incubation time 4 (mouse)			Not determined		15	70349271	104073951	Mouse
1302197	Bhr2_m	bronchial hyperresponsiveness 2 (mouse)			Not determined		15	64306334	103425899	Mouse
1302074	Bmd4_m	bone mineral density 4 (mouse)			Not determined		15	56186708	103425899	Mouse
4141902	Cia37_m	collagen induced arthritis 37 (mouse)			Not determined		15	80884933	104073951	Mouse
14700689	Carg5_m	Candida albicans resistance gene 5 (mouse)					15	97697881	103008427	Mouse
4141581	Dshv1_m	dorsal hippocampal volume 1 (mouse)			Not determined			92788640	103425899	Mouse
4141897	Imrfq2_m	immune response to Factor IX QTL 2 (mouse)			Not determined			79908940	104073951	Mouse
1301284	Cosz3_m	cocaine seizure 3 (mouse)			Not determined		15	80313634	104073951	Mouse
4141511	Gdcr1_m	glycerolphosphate dehydrogenase regulator 1 (mouse)			Not determined			82615474	104073951	Mouse
1357614	Bmca_m	bile mucin accumulation (mouse)			Not determined		15	85896437	104073951	Mouse
1300648	Dbsty4_m	diabesity 4 (mouse)			Not determined		15	70349271	104073951	Mouse
1300974	Pgia9_m	proteoglycan induced arthritis 9 (mouse)			Not determined		15	80884933	104073951	Mouse

RH133875

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	15	102,432,044 - 102,432,239	UniSTS	GRCm38
MGSCv37	15	102,262,475 - 102,262,670	UniSTS	GRCm37
Celera	15	104,589,847 - 104,590,042	UniSTS
Cytogenetic Map	15	F3	UniSTS

AI845540

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	15	102,436,165 - 102,436,281	UniSTS	GRCm38
MGSCv37	15	102,266,596 - 102,266,712	UniSTS	GRCm37
Celera	15	104,593,968 - 104,594,084	UniSTS
Cytogenetic Map	15	F3	UniSTS
Whitehead/MRC_RH	15	921.04	UniSTS

X60136

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	15	102,431,091 - 102,431,166	UniSTS	GRCm38
MGSCv37	15	102,261,522 - 102,261,597	UniSTS	GRCm37
Celera	15	104,588,894 - 104,588,969	UniSTS
Cytogenetic Map	15	F3	UniSTS
Whitehead_YAC	15		UniSTS

UniSTS:237408

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	15	102,434,766 - 102,435,064	UniSTS	GRCm38
MGSCv37	15	102,265,197 - 102,265,495	UniSTS	GRCm37
Celera	15	104,592,569 - 104,592,867	UniSTS
Cytogenetic Map	15	F3	UniSTS

PMC114562P1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	15	102,408,638 - 102,409,168	UniSTS	GRCm38
MGSCv37	15	102,239,069 - 102,239,599	UniSTS	GRCm37
Celera	15	104,566,421 - 104,566,951	UniSTS
Cytogenetic Map	15	F3	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_013672	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017316523	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC137156	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF022363	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF062566	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK003347	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK088458	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CF729889	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466550	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CJ181598	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF200003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF200004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF200005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF200006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF200007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF200008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF200009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	S79832	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X60136	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000001326 ⟹ ENSMUSP00000001326

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	15	102,314,815 - 102,344,839 (+)	Ensembl
GRCm38.p6 Ensembl	15	102,406,380 - 102,436,404 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000163709 ⟹ ENSMUSP00000130747

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	15	102,314,768 - 102,341,114 (+)	Ensembl
GRCm38.p6 Ensembl	15	102,406,333 - 102,432,679 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000165837 ⟹ ENSMUSP00000126143

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	15	102,315,190 - 102,317,052 (+)	Ensembl
GRCm38.p6 Ensembl	15	102,406,755 - 102,408,617 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000168802 ⟹ ENSMUSP00000127445

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	15	102,316,023 - 102,316,820 (+)	Ensembl
GRCm38.p6 Ensembl	15	102,407,588 - 102,408,385 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000169619 ⟹ ENSMUSP00000127714

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	15	102,315,704 - 102,316,670 (+)	Ensembl
GRCm38.p6 Ensembl	15	102,407,269 - 102,408,235 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000170884 ⟹ ENSMUSP00000129638

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	15	102,314,578 - 102,316,670 (+)	Ensembl
GRCm38.p6 Ensembl	15	102,406,143 - 102,408,235 (+)	Ensembl

RefSeq Acc Id:

NM_013672 ⟹ NP_038700

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	15	102,314,751 - 102,344,839 (+)	NCBI
GRCm38	15	102,406,316 - 102,436,404 (+)	NCBI
MGSCv37	15	102,236,747 - 102,266,835 (+)	RGD
Celera	15	104,563,277 - 104,594,207 (+)	RGD
cM Map	15		ENTREZGENE

Sequence:

show sequence

CCGGTCCGGGTTCGCTTGCCTCGTCAGCGTCCGCGTTTTTCCCGGCCCCCCCCAACCCCCCCGTACAGGACCCCCTTGAGCTCGCCCCTCAGCTGCCACCATGAGCGACCAAGATCACTCCATGGATG
AAGTGACAGCTGTGGTGAAGATTGAAAAAGATGTTGGTGGCAATAATGGGGGTAGCGGCAATGGTGGCGGTGCCGCCTTTTCTCAGACTCGAAGCAGCAGCACAGGCAGTAGCAGCAGCAGTGGTGGC
GGAGGAGGGCAGGAATCCCAGCCATCTCCTTTGGCTCTGCTGGCAGCAACCTGCAGCAGAATTGAGTCACCCAATGAGAACAGCAACAACTCCCAGGGTCCGAGTCAGTCAGGGGGCACAGGTGAACT
TGACCTCACAGCCGCACAACTTTCACAGGGTGCCAATGGCTGGCAGATCATCTCTTCCTCCTCTGGGGCTACCCCTACCTCAAAGGAACAGAGTGGCAACAGTACCAATGGCAGCGAGTCTTCCAAGA
ACCGCACAGTCTCTGGTGGGCAGTATGTTGTGGCTGCTACCCCCAACTTACAGAACCAGCAAGTTCTGACAGGTCTCCCTGGAGTAATGCCTAATATTCAGTATCAAGTAATCCCACAGTTCCAGACT
GTTGATGGGCAGCAGCTGCAGTTTGCTGCCACTGGGGCCCAAGTGCAGCAGGATGGTTCTGGTCAAATACAGATCATACCAGGTGCAAACCAACAGATCATCCCAAATAGAGGAAGTGGGGGCAACAT
TATTGCTGCTATGCCAAATCTACTCCAGCAGGCTGTCCCCCTTCAAGGCCTTGCTAATAATGTGCTCTCAGGACAGACTCAGTATGTGACCAATGTACCAGTGGCCCTGAATGGGAACATCACCTTGC
TACCTGTCAACAGCGTTTCTGCAGCTACCCTGACTCCCAGCTCTCAGGCAGGCACTATCAGCAGCTCTGGATCCCAGGAGAGCAGCTCACAGCCTGTCACCTCAGGGACTGCCATCAGTTCTGCCAGC
TTGGTGTCATCACAAGCTAGTTCCAGCTCCTTTTTTACCAATGCCAATAGTTATTCAACAACTACTACCACCAGCAACATGGGAATTATGAACTTTACCAGCAGTGGCTCATCAGGGACTAGTTCTCA
AGGCCAGACGCCCCAGAGGGTTGGTGGGCTACAAGGGTCTGATTCTCTGAACATCCAGCAGAACCAGACATCAGGAGGCTCGCTGCAAGGAAGTCAGCAGAAAGAGGGAGAGCAAAGTCAGCAGACAC
AGCAACAACAAATCCTTATTCAGCCTCAGCTAGTTCAAGGAGGACAAGCTCTTCAGGCCCTTCAAGCAGCACCATTGTCCGGACAGACCTTCACAACTCAAGCTATTTCCCAGGAAACCCTTCAGAAC
CTCCAGCTTCAGGCTGTTCAAAACTCTGGTCCCATCATCATTCGGACACCAACCGTGGGGCCCAATGGACAGGTCAGTTGGCAGACCCTTCAGCTGCAGAATCTTCAAGTTCAGAACCCACAAGCCCA
GACAATCACCTTGGCCCCTATGCAGGGTGTTTCCTTGGGGCAGACTAGCAGCAGTAATACCACCCTAACACCCATTGCCTCAGCTGCCTCCATTCCTGCTGGCACAGTCACTGTGAATGCTGCTCAAC
TCTCCTCCATGCCAGGCCTCCAGACCATTAACCTCAGTGCATTGGGTACTTCAGGGATCCAGGTGCACCAGCTTCCAGGCCTGCCTTTGGCTATAGCAAACACCCCAGGTGATCATGGAACTCAACTT
GGTCTTCATGGATCTGGTGGTGATGGGATACATGATGAGACAGCAGGTGGAGAAGGAGAGAATAGCTCTGATCTCCAACCCCAAGCTGGACGCAGGACTCGTCGGGAAGCATGTACATGCCCCTATTG
CAAAGACAGTGAGGGAAGAGCCTCAGGAGATCCTGGCAAAAAGAAACAGCACATTTGTCACATCCAAGGATGCGGCAAAGTATATGGCAAGACCTCACATCTCCGAGCACACTTGCGCTGGCATACAG
GGGAGAGGCCATTCATGTGTAATTGGTCATATTGTGGGAAGCGCTTTACACGTTCGGACGAGCTTCAGAGACATAAACGTACACATACAGGAGAGAAGAAATTTGCCTGCCCTGAGTGCCCTAAGCGT
TTCATGAGGAGTGATCACCTGTCAAAGCATATCAAGACTCACCAGAACAAGAAGGGAGGCCCAGGTGTAGCCCTGAGTGTGGGCACATTGCCCCTGGACAGTGGGGCAGGTTCAGAAGGCACTGCCAC
TCCTTCAGCCCTTATTACCACCAATATGGTAGCCATGGAGGCCATCTGTCCAGAGGGTATTGCCCGTCTTGCCAACAGTGGCATCAACGTCATGCAGGTGACAGAGCTGCAGTCCATTAATATCAGTG
GCAATGGTTTCTAAGATTAGACACCCAGTGCCAGAGACATATGGGCCAATACCCACTAAGCCCGGGATGCAAGGTAGCATGGGTCCAAGAGACATCTGGAAGAGAGAGCCATGAGGCATTAATGTGCT
TGGTGGTAGGAAGAATTGGGAGATGGTACAAAAAAAAGAGATGGGATTGTGGCACCCAATGTCACTGGTGACTCCTTGAAAATGGAAAATATTAGTGAAAATTCTGTTGGTGCCACCCTTTGATCAGC
ATTTATCTCATCCCAGGTTCTTCTTACACTTCTTACCCCAGCCTCCTCTTCCTGTTTTTCCCTCTTAGCTCTCCCATGATGGATTCCCCCCCCCTTTTCCTAAAGCCATCATGCCTTGATAAATATAT
ATGATCATTGAAATACTTTTTAACAAAAACAGATTCTATATTATATATATATATATATATTAAAAAATATATAGAGATGCTTTCACAGGGGCTGGCTGGGAGGAGGAAAAAGACCATTCTGTGACCAA
AATACCTTGGTCTTTTTTTCTTTTCTTTTCTTTTCTTTTTTTTAAAAAAATTGCCTTATTTCTCAATGGCTGAGCCTTATCATGACACATCAAGCTTTCCTTATAAATGTTGTCCTGGCATCCCACCA
GAGTAAGCATTCATACTTTCTGCTTTTAGTTCATATATACATATATAATGTGTCTTCTTTCTTAATTTTGTTATTTTATTTGGGATCAGCTCCTTGCACTCCTTTCCTGACTTAATCCTTGTCTCCCT
TTCCTCACACGATCACTTCCTGTGTTGTTTTTGACAGTGATTCCTGGATTAGGCACTTGTGTTAATATTTTAAAGACTTTAGTTCCAGCAACAGAGTGGAAAAGCCTGAAGTATAGTCTGATGCTTGA
AGTAGCTATGGAGGGAGTGTTCAAAATACTACTGACGCAAGCACCTTAGTGCTGGAGAGTCAAAACCATCTCCCTTTTTTAGCTGTTCTAAACATCAGAAATCAGAAGTCTTTCTGTGGAATTGTACA
AGAGGCCCTTTGAAGGAGATATACTTCCAAAATGGTCAAATAGTAGGCAGCAGCTTTCAGTATGAAAAAGATGTTCTCAGAAAAGGAAATAACTCTTAGTCTTGGGTTCAGAAGTTAGTGGAATTATT
CGGATTTCAGTATCATTGTCTTCCAAATAGCTATAAGCCTCAATGTATGGGCTTCTGAGTTCACACTCTGAAAGGAAGTACACTTCCTCTTTTGAACATTTCTGTAGTTCCTTCCTATTACTGTTTTA
ATGTTAAGGAGCATCAGCCAGTGAACCTGTTTGGATTTTCCATCCTGTAGAGTGCAAAACTTGTGCCAGTGGCAAAAGTGGTTCTTTAAAAAAAAAAAAAAGTCCCCCTTAACTCTTCCTTAGATATA
CTTGGGTGGTTCCTAAGGGAAAGGGAAGCACACAATCATGGGAACGATAGCCCAGAACAAAAAGAAATCTTGTCTTACCACTGTGGATTATAGGAGAAACTGGGAGAAATTATCCTGCTTTCTCTATG
GCCTGATTCCAGAAGAGACTGATCCAAACATTTTATCGGCAGGGAAACTCAGTGCGTTTGGCACTGAGACTTAAATGCAACCAGAATTGTCCTCAAGGCCCAGCCATTAAAGCATTGTCTCTCTAGAC
CTTGTGCTATCTTGTCAGAGAGCTTTTCACTGTGAGGAAGTATGGGAGTGGTTGAGTGTATGTGTGAGATCTGTTAGGTTGGGGATAGGTTTTCTGTTAGCCAATATTTAAAGAGACCTGCAATAAAA
AATTACCCTGATCTGATAGAGAAACTAAATTGTTTTTGTATGACTGCGTGTGAATGTATTTGTGCCTGTATATATCTACATGCAGATGAGAACTTATATTTGAAATTGTTGGAAAATAAATTCAGATC
AAAACGCCTTTCAGGTCCAGTATCTAGAAATTGGTCATAAAACTTGGGTATGTTCCTAAGGTCAGTTCTCTGCTTATGCTAAATCGGTTAACAGTTATGGGGTTGGGGGGATATCCTAGTGCACTTTC
TAAAGAAGAAACTATTTTTGTGTTTGAAAATGAAATCAACATCCAAATCTATAGTGGATTCCTTATTCTAACTTCTCTATCTTGGCTACAAATAGATTATAGTGTTATTATACATTTTATGTAAATTC
CATCTAAACTAGGTTCTTGATAAGTTTATGGTATTGTTAGCTTGAAATACTAACATTAGTTTATTCCATTTGGTCCTTTCTATGCAGACTTAATACTGTTATCAAGACTCAGGAAATATTTCAAGGGA
CTGTCCCCAAATCACATGTTATTAATGTTGACGTAAAAGTTATCTGTCCTCAGCCACCATCACACCTTTTATTCCTAAAGAAAAGCAGAACTCAAACAAACCGTGTTATTTTACATTTATAATCATGT
ACTTTGCATCTCTGGAGGAAGAGGGCAGGATAACTCAGTGGAGTGTGCAGTATTTTGCTAGAAAATTTCAAGAAATAGAATCTTGTTCAGTATGAGGTGATTAGTTACAAGCCGGCTTCGAGATGCTG
AGGACTATAAGCCTTTGGATAAGTTATCTGATGGTGTTTTCTCTCTTGGGTGAAAAGCTGATGATTGACCCTCAGCATCTGCTACATTAACACATTACCATGAATTAATTTACATCAGATTCTTTCTG
CTTTTTAAATTTCCTTCTCCGGTGTCTTATTTGACCATAAAATGGAATCAGTTTCCGCTCTTGTCTCCCTGTCTGTGAGCCGCTCAGCCTTTTCTAAAGTTAAGAGACTACATTCCTCTAGTCAGGGT
CTCATGACTGAAAAATAACCTTTCCCCAAACTTTTGGCCTTCAGAATTTAACATAACTGGCATGCATATTGATTCTGAAATTCTTTTCATTACATTTTTGTTGTTTGGGGTTTTTTGTTTGTTTTGTC
TCATTGAGACAGGGTTTTACTCTGTAGCCCAGGCTAGCCTGGAATTCACTGTTAACTCAGACTGGCCTGGAATTTTGAATAATTTTTTTGCCTTCTAAGTGTTGGGATTACAAGTATATGTCACTATG
TCCAGCCTTCATGATTTTTCACTTAATTTTTAAAAAAAATGACGGCACCTTGCAAAGTGGTGGGTGACCACCAATATAATCTTGTTTTTTGTTTTGAAATAGGTCTTTCTAGGTACCCTTGGCTGATC
TGAATTTATATGTAGTCCAGGATGCAGCGATCTGTCCACCTTGGCCTTTCAAGTGTTAGGGGTTACAGGTGTGTGCCACCACATCTAGCAGAAATAGTAATCTTAAAGCATTCATTTCCTTGTCCTAG
GCTGCCCATTTGTACTCATTTACAAACTATTTGACTGTGTCATCTTTTTCCTAGAAAGGACCAACTCACCATCTTCCTTCAGGGACCTCCTAACAGGCACCCTTCGGGGTGCTATTCAAAACGCAATA
TAATGGTTCTTTCTCAGCTTGGTCTCAGAATAAATAGACCCTTTAATCACAGAAAATATAGACTGAAGTATGGGATGAAGGTGTTATAATTTGGGGAGGGTGGGAGACTAAAGCTGTAAATTACTATG
GCTGATTTATTTCTACTATATACATATATTTTTTGCTTTTGTATATCCTATATAGAAAACTAAGCATTGTATTTTTTTAACAAATCTGAGAAAGCACTATGAACTGCAGGTGTTTGACTTTCAGAATA
TATTTTGTATTGTTAATACTTCACATTATGTGAATACTGGACGCTGCAGATCTTTGTAGGCCGCAATAAAATTGGACACTTTTTGAGGGGTTCTTTGGAGGTGCTAATCAGGCCTCTGTTACACTTTG
AAGGAGCCCTGGTGCTACATGATTAACGTTTCATTCAATTTTAAGTGCCCTAATGTCTTTTTGGACCTTGGGATCAGTTGAGAAGTGATTTAGAGATCAGGTACCGAGGGAGTGAGGATAGTGTGCCT
GCCTCAGCTAAGGGCCTCTTTCATGGTTTTACTTTCCATAGACAAAGTTGGGTAGCCTCTTGGGGTTGAAAGCAGAAATGTTGGAAATCTCAGAGTTTCATCTTCTCTTAGAAGAGCCAGTAACTTAC
AAGGATAAAGGTAGCAGCAGTTACTTTGGGAGAGGAGGGCATGGCACTTTTCCAACCCGGAAAACATTGCTTTGAAAGCTGCTGATAAAGCATGGGCAGGTTATTAGTTTGGTTTAGAAGACTGTGCG
TCTCTTGGCTCTGCTCCGGGGTACAGATCTCATCTAGGAGGATGAGTAGAAGCTTTGAGGTTGAGCTGTTTCTTGTCTTTGTCTGCCTTCCTTAAATAACATCCCCCAAAAAGACATTAAGCAGCCTT
TACGTTCCTACTCCCTCTTCAGACTTGGCTCATGTGTTGTAGGTTGAAGACTGGGAAGAGAGAAGAGGGGCAGTCTTCGGCTCCATTCCTTCCCTAAGTCATCTCTGTTCAAACTTCCACACACTCAG
AAGGATTTCTCCACAGCACTCATGTGAGAGAGAAGCTGCTTCTTTTTTTCCAATTTGCCCCTTCTTTATCAAACAGCCCAACCTTCCTTGTCTTGGGATTCATCTGTCCTTCAGCTCCTCTAAGTCTC
AGCTCGTGGAGGTAGAGGAGCCTGGCAAATTAGGCTGGGGCTACAGATAGAGAAGACTTGAGGTACATCTGCTTGGTTGTGTGCTTTCCTATATCTTGCCTTCAGGAATCACACTGTGCCTTCTCCAC
TAGGGAACTGATTCTATCTACACAGCTTTTCCAGTAACTGCTCTTGAAAATTGTGGGTAATGGCAGTTCTTCATACTTCTGATGACTCTTTTCTCCCAATAACATCCTAATATCCCTTACCTAGCTAA
AGACTAGGCACAAAGTCAGAATATGTTGATAATGGTCTGAGGAAGCCAAAGGCAGCTGCCCTAGGGCCTGCTTCCCTCTCCCAAGTCTGTCATCTCTGGGCAGAGGAGTAGTGCTCCAATCTGGTGCC
TAAAACCAGTTTATCTTTCTTAATACTGGCAATAACCAGTCTCTGTACCACTGTTGCCTTTAAACCTTTTAATCTCACGATGTTTGTTGTGGGTTCCAATCCAGTTATCACCAGGGCTGTGAGGGTAA
ATACTTCTAAACAGTCACTTACCTTGTTCTCTGCCCTCACTCTTGAGTATGTATGATGTTAATCTCTTGTCTTCCTGTTCCTTTTGTATCTTCCTCGTCTCTCTCCCCCTAATTTTGTCCCTGGGTGT
TTTGGGGATCTCAGTATCTCTTTCTCTATATCTCTATCTCAATCTCTCTGCCTTTTGTACAAAGATTAGTTTCAATGTAGTCTGTAGCTCCTTTGTAAACCAATTAAAATTTTTTTAATAAATCATGT
CTCTGGTGTA

hide sequence

RefSeq Acc Id:

XM_017316523 ⟹ XP_017172012

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	15	102,315,709 - 102,344,828 (+)	NCBI
GRCm38	15	102,407,274 - 102,436,393 (+)	NCBI

Sequence:

show sequence

TCTTTATTTCTGAGACACTGAAATTCCAAATTCCCTTTCTCAAAAGGGCTATTTGTATTGGGAT
CAGTTCTTACTCTGTAGGCCTGGAAGACCTAGAACTGGTGAACCACCTGGCTCATCCTTCCAAGTCTTGGGATTATAGACCAAGATCACTCCATGGATGAAGTGACAGCTGTGGTGAAGATTGAAAAA
GATGTTGGTGGCAATAATGGGGGTAGCGGCAATGGTGGCGGTGCCGCCTTTTCTCAGACTCGAAGCAGCAGCACAGGCAGTAGCAGCAGCAGTGGTGGCGGAGGAGGGCAGGAATCCCAGCCATCTCC
TTTGGCTCTGCTGGCAGCAACCTGCAGCAGAATTGAGTCACCCAATGAGAACAGCAACAACTCCCAGGGTCCGAGTCAGTCAGGGGGCACAGGTGAACTTGACCTCACAGCCGCACAACTTTCACAGG
GTGCCAATGGCTGGCAGATCATCTCTTCCTCCTCTGGGGCTACCCCTACCTCAAAGGAACAGAGTGGCAACAGTACCAATGGCAGCGAGTCTTCCAAGAACCGCACAGTCTCTGGTGGGCAGTATGTT
GTGGCTGCTACCCCCAACTTACAGAACCAGCAAGTTCTGACAGGTCTCCCTGGAGTAATGCCTAATATTCAGTATCAAGTAATCCCACAGTTCCAGACTGTTGATGGGCAGCAGCTGCAGTTTGCTGC
CACTGGGGCCCAAGTGCAGCAGGATGGTTCTGGTCAAATACAGATCATACCAGGTGCAAACCAACAGATCATCCCAAATAGAGGAAGTGGGGGCAACATTATTGCTGCTATGCCAAATCTACTCCAGC
AGGCTGTCCCCCTTCAAGGCCTTGCTAATAATGTGCTCTCAGGACAGACTCAGTATGTGACCAATGTACCAGTGGCCCTGAATGGGAACATCACCTTGCTACCTGTCAACAGCGTTTCTGCAGCTACC
CTGACTCCCAGCTCTCAGGCAGGCACTATCAGCAGCTCTGGATCCCAGGAGAGCAGCTCACAGCCTGTCACCTCAGGGACTGCCATCAGTTCTGCCAGCTTGGTGTCATCACAAGCTAGTTCCAGCTC
CTTTTTTACCAATGCCAATAGTTATTCAACAACTACTACCACCAGCAACATGGGAATTATGAACTTTACCAGCAGTGGCTCATCAGGGACTAGTTCTCAAGGCCAGACGCCCCAGAGGGTTGGTGGGC
TACAAGGGTCTGATTCTCTGAACATCCAGCAGAACCAGACATCAGGAGGCTCGCTGCAAGGAAGTCAGCAGAAAGAGGGAGAGCAAAGTCAGCAGACACAGCAACAACAAATCCTTATTCAGCCTCAG
CTAGTTCAAGGAGGACAAGCTCTTCAGGCCCTTCAAGCAGCACCATTGTCCGGACAGACCTTCACAACTCAAGCTATTTCCCAGGAAACCCTTCAGAACCTCCAGCTTCAGGCTGTTCAAAACTCTGG
TCCCATCATCATTCGGACACCAACCGTGGGGCCCAATGGACAGGTCAGTTGGCAGACCCTTCAGCTGCAGAATCTTCAAGTTCAGAACCCACAAGCCCAGACAATCACCTTGGCCCCTATGCAGGGTG
TTTCCTTGGGGCAGACTAGCAGCAGTAATACCACCCTAACACCCATTGCCTCAGCTGCCTCCATTCCTGCTGGCACAGTCACTGTGAATGCTGCTCAACTCTCCTCCATGCCAGGCCTCCAGACCATT
AACCTCAGTGCATTGGGTACTTCAGGGATCCAGGTGCACCAGCTTCCAGGCCTGCCTTTGGCTATAGCAAACACCCCAGGTGATCATGGAACTCAACTTGGTCTTCATGGATCTGGTGGTGATGGGAT
ACATGATGAGACAGCAGGTGGAGAAGGAGAGAATAGCTCTGATCTCCAACCCCAAGCTGGACGCAGGACTCGTCGGGAAGCATGTACATGCCCCTATTGCAAAGACAGTGAGGGAAGAGCCTCAGGAG
ATCCTGGCAAAAAGAAACAGCACATTTGTCACATCCAAGGATGCGGCAAAGTATATGGCAAGACCTCACATCTCCGAGCACACTTGCGCTGGCATACAGGGGAGAGGCCATTCATGTGTAATTGGTCA
TATTGTGGGAAGCGCTTTACACGTTCGGACGAGCTTCAGAGACATAAACGTACACATACAGGAGAGAAGAAATTTGCCTGCCCTGAGTGCCCTAAGCGTTTCATGAGGAGTGATCACCTGTCAAAGCA
TATCAAGACTCACCAGAACAAGAAGGGAGGCCCAGGTGTAGCCCTGAGTGTGGGCACATTGCCCCTGGACAGTGGGGCAGGTTCAGAAGGCACTGCCACTCCTTCAGCCCTTATTACCACCAATATGG
TAGCCATGGAGGCCATCTGTCCAGAGGGTATTGCCCGTCTTGCCAACAGTGGCATCAACGTCATGCAGGTGACAGAGCTGCAGTCCATTAATATCAGTGGCAATGGTTTCTAAGATTAGACACCCAGT
GCCAGAGACATATGGGCCAATACCCACTAAGCCCGGGATGCAAGGTAGCATGGGTCCAAGAGACATCTGGAAGAGAGAGCCATGAGGCATTAATGTGCTTGGTGGTAGGAAGAATTGGGAGATGGTAC
AAAAAAAAGAGATGGGATTGTGGCACCCAATGTCACTGGTGACTCCTTGAAAATGGAAAATATTAGTGAAAATTCTGTTGGTGCCACCCTTTGATCAGCATTTATCTCATCCCAGGTTCTTCTTACAC
TTCTTACCCCAGCCTCCTCTTCCTGTTTTTCCCTCTTAGCTCTCCCATGATGGATTCCCCCCCCCTTTTCCTAAAGCCATCATGCCTTGATAAATATATATGATCATTGAAATACTTTTTAACAAAAA
CAGATTCTATATTATATATATATATATATATTAAAAAATATATAGAGATGCTTTCACAGGGGCTGGCTGGGAGGAGGAAAAAGACCATTCTGTGACCAAAATACCTTGGTCTTTTTTTCTTTTCTTTT
CTTTTCTTTTTTTTAAAAAAATTGCCTTATTTCTCAATGGCTGAGCCTTATCATGACACATCAAGCTTTCCTTATAAATGTTGTCCTGGCATCCCACCAGAGTAAGCATTCATACTTTCTGCTTTTAG
TTCATATATACATATATAATGTGTCTTCTTTCTTAATTTTGTTATTTTATTTGGGATCAGCTCCTTGCACTCCTTTCCTGACTTAATCCTTGTCTCCCTTTCCTCACACGATCACTTCCTGTGTTGTT
TTTGACAGTGATTCCTGGATTAGGCACTTGTGTTAATATTTTAAAGACTTTAGTTCCAGCAACAGAGTGGAAAAGCCTGAAGTATAGTCTGATGCTTGAAGTAGCTATGGAGGGAGTGTTCAAAATAC
TACTGACGCAAGCACCTTAGTGCTGGAGAGTCAAAACCATCTCCCTTTTTTAGCTGTTCTAAACATCAGAAATCAGAAGTCTTTCTGTGGAATTGTACAAGAGGCCCTTTGAAGGAGATATACTTCCA
AAATGGTCAAATAGTAGGCAGCAGCTTTCAGTATGAAAAAGATGTTCTCAGAAAAGGAAATAACTCTTAGTCTTGGGTTCAGAAGTTAGTGGAATTATTCGGATTTCAGTATCATTGTCTTCCAAATA
GCTATAAGCCTCAATGTATGGGCTTCTGAGTTCACACTCTGAAAGGAAGTACACTTCCTCTTTTGAACATTTCTGTAGTTCCTTCCTATTACTGTTTTAATGTTAAGGAGCATCAGCCAGTGAACCTG
TTTGGATTTTCCATCCTGTAGAGTGCAAAACTTGTGCCAGTGGCAAAAGTGGTTCTTTAAAAAAAAAAAAAAGTCCCCCTTAACTCTTCCTTAGATATACTTGGGTGGTTCCTAAGGGAAAGGGAAGC
ACACAATCATGGGAACGATAGCCCAGAACAAAAAGAAATCTTGTCTTACCACTGTGGATTATAGGAGAAACTGGGAGAAATTATCCTGCTTTCTCTATGGCCTGATTCCAGAAGAGACTGATCCAAAC
ATTTTATCGGCAGGGAAACTCAGTGCGTTTGGCACTGAGACTTAAATGCAACCAGAATTGTCCTCAAGGCCCAGCCATTAAAGCATTGTCTCTCTAGACCTTGTGCTATCTTGTCAGAGAGCTTTTCA
CTGTGAGGAAGTATGGGAGTGGTTGAGTGTATGTGTGAGATCTGTTAGGTTGGGGATAGGTTTTCTGTTAGCCAATATTTAAAGAGACCTGCAATAAAAAATTACCCTGATCTGATAGAGAAACTAAA
TTGTTTTTGTATGACTGCGTGTGAATGTATTTGTGCCTGTATATATCTACATGCAGATGAGAACTTATATTTGAAATTGTTGGAAAATAAATTCAGATCAAAACGCCTTTCAGGTCCAGTATCTAGAA
ATTGGTCATAAAACTTGGGTATGTTCCTAAGGTCAGTTCTCTGCTTATGCTAAATCGGTTAACAGTTATGGGGTTGGGGGGATATCCTAGTGCACTTTCTAAAGAAGAAACTATTTTTGTGTTTGAAA
ATGAAATCAACATCCAAATCTATAGTGGATTCCTTATTCTAACTTCTCTATCTTGGCTACAAATAGATTATAGTGTTATTATACATTTTATGTAAATTCCATCTAAACTAGGTTCTTGATAAGTTTAT
GGTATTGTTAGCTTGAAATACTAACATTAGTTTATTCCATTTGGTCCTTTCTATGCAGACTTAATACTGTTATCAAGACTCAGGAAATATTTCAAGGGACTGTCCCCAAATCACATGTTATTAATGTT
GACGTAAAAGTTATCTGTCCTCAGCCACCATCACACCTTTTATTCCTAAAGAAAAGCAGAACTCAAACAAACCGTGTTATTTTACATTTATAATCATGTACTTTGCATCTCTGGAGGAAGAGGGCAGG
ATAACTCAGTGGAGTGTGCAGTATTTTGCTAGAAAATTTCAAGAAATAGAATCTTGTTCAGTATGAGGTGATTAGTTACAAGCCGGCTTCGAGATGCTGAGGACTATAAGCCTTTGGATAAGTTATCT
GATGGTGTTTTCTCTCTTGGGTGAAAAGCTGATGATTGACCCTCAGCATCTGCTACATTAACACATTACCATGAATTAATTTACATCAGATTCTTTCTGCTTTTTAAATTTCCTTCTCCGGTGTCTTA
TTTGACCATAAAATGGAATCAGTTTCCGCTCTTGTCTCCCTGTCTGTGAGCCGCTCAGCCTTTTCTAAAGTTAAGAGACTACATTCCTCTAGTCAGGGTCTCATGACTGAAAAATAACCTTTCCCCAA
ACTTTTGGCCTTCAGAATTTAACATAACTGGCATGCATATTGATTCTGAAATTCTTTTCATTACATTTTTGTTGTTTGGGGTTTTTTGTTTGTTTTGTCTCATTGAGACAGGGTTTTACTCTGTAGCC
CAGGCTAGCCTGGAATTCACTGTTAACTCAGACTGGCCTGGAATTTTGAATAATTTTTTTGCCTTCTAAGTGTTGGGATTACAAGTATATGTCACTATGTCCAGCCTTCATGATTTTTCACTTAATTT
TTAAAAAAAATGACGGCACCTTGCAAAGTGGTGGGTGACCACCAATATAATCTTGTTTTTTGTTTTGAAATAGGTCTTTCTAGGTACCCTTGGCTGATCTGAATTTATATGTAGTCCAGGATGCAGCG
ATCTGTCCACCTTGGCCTTTCAAGTGTTAGGGGTTACAGGTGTGTGCCACCACATCTAGCAGAAATAGTAATCTTAAAGCATTCATTTCCTTGTCCTAGGCTGCCCATTTGTACTCATTTACAAACTA
TTTGACTGTGTCATCTTTTTCCTAGAAAGGACCAACTCACCATCTTCCTTCAGGGACCTCCTAACAGGCACCCTTCGGGGTGCTATTCAAAACGCAATATAATGGTTCTTTCTCAGCTTGGTCTCAGA
ATAAATAGACCCTTTAATCACAGAAAATATAGACTGAAGTATGGGATGAAGGTGTTATAATTTGGGGAGGGTGGGAGACTAAAGCTGTAAATTACTATGGCTGATTTATTTCTACTATATACATATAT
TTTTTGCTTTTGTATATCCTATATAGAAAACTAAGCATTGTATTTTTTTAACAAATCTGAGAAAGCACTATGAACTGCAGGTGTTTGACTTTCAGAATATATTTTGTATTGTTAATACTTCACATTAT
GTGAATACTGGACGCTGCAGATCTTTGTAGGCCGCAATAAAATTGGACACTTTTTGAGGGGTTCTTTGGAGGTGCTAATCAGGCCTCTGTTACACTTTGAAGGAGCCCTGGTGCTACATGATTAACGT
TTCATTCAATTTTAAGTGCCCTAATGTCTTTTTGGACCTTGGGATCAGTTGAGAAGTGATTTAGAGATCAGGTACCGAGGGAGTGAGGATAGTGTGCCTGCCTCAGCTAAGGGCCTCTTTCATGGTTT
TACTTTCCATAGACAAAGTTGGGTAGCCTCTTGGGGTTGAAAGCAGAAATGTTGGAAATCTCAGAGTTTCATCTTCTCTTAGAAGAGCCAGTAACTTACAAGGATAAAGGTAGCAGCAGTTACTTTGG
GAGAGGAGGGCATGGCACTTTTCCAACCCGGAAAACATTGCTTTGAAAGCTGCTGATAAAGCATGGGCAGGTTATTAGTTTGGTTTAGAAGACTGTGCGTCTCTTGGCTCTGCTCCGGGGTACAGATC
TCATCTAGGAGGATGAGTAGAAGCTTTGAGGTTGAGCTGTTTCTTGTCTTTGTCTGCCTTCCTTAAATAACATCCCCCAAAAAGACATTAAGCAGCCTTTACGTTCCTACTCCCTCTTCAGACTTGGC
TCATGTGTTGTAGGTTGAAGACTGGGAAGAGAGAAGAGGGGCAGTCTTCGGCTCCATTCCTTCCCTAAGTCATCTCTGTTCAAACTTCCACACACTCAGAAGGATTTCTCCACAGCACTCATGTGAGA
GAGAAGCTGCTTCTTTTTTTCCAATTTGCCCCTTCTTTATCAAACAGCCCAACCTTCCTTGTCTTGGGATTCATCTGTCCTTCAGCTCCTCTAAGTCTCAGCTCGTGGAGGTAGAGGAGCCTGGCAAA
TTAGGCTGGGGCTACAGATAGAGAAGACTTGAGGTACATCTGCTTGGTTGTGTGCTTTCCTATATCTTGCCTTCAGGAATCACACTGTGCCTTCTCCACTAGGGAACTGATTCTATCTACACAGCTTT
TCCAGTAACTGCTCTTGAAAATTGTGGGTAATGGCAGTTCTTCATACTTCTGATGACTCTTTTCTCCCAATAACATCCTAATATCCCTTACCTAGCTAAAGACTAGGCACAAAGTCAGAATATGTTGA
TAATGGTCTGAGGAAGCCAAAGGCAGCTGCCCTAGGGCCTGCTTCCCTCTCCCAAGTCTGTCATCTCTGGGCAGAGGAGTAGTGCTCCAATCTGGTGCCTAAAACCAGTTTATCTTTCTTAATACTGG
CAATAACCAGTCTCTGTACCACTGTTGCCTTTAAACCTTTTAATCTCACGATGTTTGTTGTGGGTTCCAATCCAGTTATCACCAGGGCTGTGAGGGTAAATACTTCTAAACAGTCACTTACCTTGTTC
TCTGCCCTCACTCTTGAGTATGTATGATGTTAATCTCTTGTCTTCCTGTTCCTTTTGTATCTTCCTCGTCTCTCTCCCCCTAATTTTGTCCCTGGGTGTTTTGGGGATCTCAGTATCTCTTTCTCTAT
ATCTCTATCTCAATCTCTCTGCCTTTTGTACAAAGATTAGTTTCAATGTAGTCTGTAGCTCCTTTGTAAACCAATTAAAATTTTTTTAATAAATCATG

hide sequence


Protein RefSeqs	NP_038700	(Get FASTA)	NCBI Sequence Viewer
	XP_017172012	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB35321	(Get FASTA)	NCBI Sequence Viewer
	AAC08527	(Get FASTA)	NCBI Sequence Viewer
	AAC16484	(Get FASTA)	NCBI Sequence Viewer
	ABM98419	(Get FASTA)	NCBI Sequence Viewer
	CAA42721	(Get FASTA)	NCBI Sequence Viewer
	EDL03985	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000001326
	ENSMUSP00000130747.2
GenBank Protein	O89090	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_038700 ⟸ NM_013672

- UniProtKB:

Q64167 (UniProtKB/Swiss-Prot), Q62251 (UniProtKB/Swiss-Prot), O89087 (UniProtKB/Swiss-Prot), O89090 (UniProtKB/Swiss-Prot), G3X8Q0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSDQDHSMDEVTAVVKIEKDVGGNNGGSGNGGGAAFSQTRSSSTGSSSSSGGGGGQESQPSPLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTAAQLSQGANGWQIISSSSGATPTSKEQSGN
STNGSESSKNRTVSGGQYVVAATPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIIPNRGSGGNIIAAMPNLLQQAVPLQGLANNVLSGQTQYVTNVP
VALNGNITLLPVNSVSAATLTPSSQAGTISSSGSQESSSQPVTSGTAISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTSSGSSGTSSQGQTPQRVGGLQGSDSLNIQQNQTSGGSLQGSQQ
KEGEQSQQTQQQQILIQPQLVQGGQALQALQAAPLSGQTFTTQAISQETLQNLQLQAVQNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLAPMQGVSLGQTSSSNTTLTPIASAASIPA
GTVTVNAAQLSSMPGLQTINLSALGTSGIQVHQLPGLPLAIANTPGDHGTQLGLHGSGGDGIHDETAGGEGENSSDLQPQAGRRTRREACTCPYCKDSEGRASGDPGKKKQHICHIQGCGKVYGKTSH
LRAHLRWHTGERPFMCNWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDSGAGSEGTATPSALITTNMVAMEAICPEGIARLANSGINVMQV
TELQSINISGNGF

hide sequence

RefSeq Acc Id:	XP_017172012 ⟸ XM_017316523
- Peptide Label:	isoform X1
- UniProtKB:	Q64167 (UniProtKB/Swiss-Prot), Q62251 (UniProtKB/Swiss-Prot), O89090 (UniProtKB/Swiss-Prot), O89087 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MDEVTAVVKIEKDVGGNNGGSGNGGGAAFSQTRSSSTGSSSSSGGGGGQESQPSPLALLAATCS RIESPNENSNNSQGPSQSGGTGELDLTAAQLSQGANGWQIISSSSGATPTSKEQSGNSTNGSESSKNRTVSGGQYVVAATPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQDG SGQIQIIPGANQQIIPNRGSGGNIIAAMPNLLQQAVPLQGLANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAGTISSSGSQESSSQPVTSGTAISSASLVSSQASSSSFFTNANSYS TTTTTSNMGIMNFTSSGSSGTSSQGQTPQRVGGLQGSDSLNIQQNQTSGGSLQGSQQKEGEQSQQTQQQQILIQPQLVQGGQALQALQAAPLSGQTFTTQAISQETLQNLQLQAVQNSGPIIIRTPTV GPNGQVSWQTLQLQNLQVQNPQAQTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHQLPGLPLAIANTPGDHGTQLGLHGSGGDGIHDETAGGEG ENSSDLQPQAGRRTRREACTCPYCKDSEGRASGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCNWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKG GPGVALSVGTLPLDSGAGSEGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVTELQSINISGNGF hide sequence

Ensembl Acc Id:

ENSMUSP00000130747 ⟸ ENSMUST00000163709

Ensembl Acc Id:

ENSMUSP00000001326 ⟸ ENSMUST00000001326

Ensembl Acc Id:

ENSMUSP00000129638 ⟸ ENSMUST00000170884

Protein Domains

C2H2-type

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O89090-F1-model_v2	AlphaFold	O89090	1-784	view protein structure

RGD ID:

6826506

Promoter ID:

MM_KWN:19846

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen

Transcripts:

NM_013672

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	15	102,235,786 - 102,236,667 (+)	MPROMDB

RGD ID:

6826505

Promoter ID:

MM_KWN:19847

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

3T3L1_Day1, 3T3L1_Day4, BoneMarrow_0Hour, BoneMarrow_2Hour, Kidney, Liver, Lung

Transcripts:

UC007XVP.1

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	15	102,236,916 - 102,237,452 (+)	MPROMDB

RGD ID:

8685204

Promoter ID:

EPDNEW_M20633

Type:

initiation region

Name:

Sp1_1

Description:

Mus musculus trans-acting transcription factor 1 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	15	102,406,312 - 102,406,372	EPDNEW

Database	Acc Id	Source(s)
Ensembl Genes	ENSMUSG00000001280	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000001326	ENTREZGENE
	ENSMUST00000163709.8	UniProtKB/Swiss-Prot
Gene3D-CATH	Classic Zinc Finger	UniProtKB/Swiss-Prot
InterPro	Znf_C2H2_sf	UniProtKB/Swiss-Prot
	Znf_C2H2_type	UniProtKB/Swiss-Prot
KEGG Report	mmu:20683	UniProtKB/Swiss-Prot
MGD	MGI:98372	ENTREZGENE
NCBI Gene	20683	ENTREZGENE
PANTHER	KRUEPPEL-LIKE TRANSCRIPTION FACTOR	UniProtKB/Swiss-Prot
	TRANSCRIPTION FACTOR SP1	UniProtKB/Swiss-Prot
Pfam	zf-C2H2	UniProtKB/Swiss-Prot
PhenoGen	Sp1	PhenoGen
PROSITE	ZINC_FINGER_C2H2_1	UniProtKB/Swiss-Prot
	ZINC_FINGER_C2H2_2	UniProtKB/Swiss-Prot
SMART	ZnF_C2H2	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF57667	UniProtKB/Swiss-Prot
UniProt	A0A979HLR9_MOUSE	UniProtKB/TrEMBL
	A2TH11_MOUSE	UniProtKB/TrEMBL
	E9Q0S7_MOUSE	UniProtKB/TrEMBL
	E9Q113_MOUSE	UniProtKB/TrEMBL
	E9Q2V3_MOUSE	UniProtKB/TrEMBL
	G3X8Q0	ENTREZGENE, UniProtKB/TrEMBL
	O89087	ENTREZGENE
	O89090	ENTREZGENE
	Q62251	ENTREZGENE
	Q64167	ENTREZGENE
	SP1_MOUSE	UniProtKB/Swiss-Prot
UniProt Secondary	O89087	UniProtKB/Swiss-Prot
	Q62251	UniProtKB/Swiss-Prot
	Q64167	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Mammalian Phenotype