Symbol:
Ret
Name:
ret proto-oncogene
RGD ID:
11234
MGI Page
MGI
Description:
Enables transmembrane receptor protein tyrosine kinase activity. Involved in several processes, including Peyer's patch morphogenesis; neuron cell-cell adhesion; and positive regulation of metanephric glomerulus development. Acts upstream of or within several processes, including nervous system development; positive regulation of cell size; and positive regulation of macromolecule metabolic process. Predicted to be located in dendrite; endosome; and neuronal cell body. Predicted to be part of plasma membrane protein complex and receptor complex. Predicted to be active in axon and plasma membrane. Is expressed in several structures, including branchial arch; genitourinary system; gut; nervous system; and sensory organ. Used to study Hirschsprung's disease; clubfoot; multiple endocrine neoplasia type 2B; and pheochromocytoma. Human ortholog(s) of this gene implicated in several diseases, including Hirschsprung's disease; familial medullary thyroid carcinoma; multiple endocrine neoplasia type 2A; multiple endocrine neoplasia type 2B; and pheochromocytoma. Orthologous to human RET (ret proto-oncogene).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
c-Re; c-Ret; proto-oncogene c-Ret; proto-oncogene tyrosine-protein kinase receptor Ret; PTC; RET5; RET51; RET9
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
RET (ret proto-oncogene) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Ret (ret proto-oncogene) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ret (ret proto-oncogene) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
RET (ret proto-oncogene) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
RET (ret proto-oncogene) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ret (ret proto-oncogene) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
RET (ret proto-oncogene) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
RET (ret proto-oncogene) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ret (ret proto-oncogene) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Ret (ret proto-oncogene)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
RET (ret proto-oncogene)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ret (ret proto-oncogene receptor tyrosine kinase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
Ret
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ret
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 118,128,709 - 118,174,705 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 118,128,706 - 118,174,679 (-) Ensembl GRCm39 Ensembl GRCm38 6 118,151,748 - 118,197,744 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 118,151,745 - 118,197,718 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 118,101,766 - 118,147,762 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 118,119,472 - 118,162,752 (-) NCBI MGSCv36 mm8 Celera 6 119,974,414 - 120,020,450 (-) NCBI Celera Cytogenetic Map 6 F1 NCBI cM Map 6 55.86 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ret Mouse (+)-pilocarpine multiple interactions ISO Ret (Rattus norvegicus) 6480464 [Lithium co-treated with Pilocarpine] results in increased expression of RET protein CTD PMID:12914250 Ret Mouse (-)-anisomycin decreases expression ISO Ret (Rattus norvegicus) 6480464 Anisomycin results in decreased expression of RET protein CTD PMID:17555550 Ret Mouse 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine decreases expression EXP 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:17555550 Ret Mouse 17alpha-ethynylestradiol decreases expression ISO Ret (Rattus norvegicus) 6480464 Ethinyl Estradiol results in decreased expression of RET mRNA CTD PMID:12075121 Ret Mouse 17beta-estradiol multiple interactions ISO RET (Homo sapiens) 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in decreased expression of RET mRNA more ... CTD PMID:20823114 and PMID:24758408 Ret Mouse 17beta-estradiol increases expression ISO RET (Homo sapiens) 6480464 Estradiol results in increased expression of RET mRNA CTD PMID:24758408 more ... Ret Mouse 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Ret Mouse 2,2',5,5'-tetrachlorobiphenyl multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Ret Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of RET mRNA CTD PMID:17337447 Ret Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Ret (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of RET mRNA CTD PMID:32109520 Ret Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RET (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of RET mRNA CTD PMID:22903824 Ret Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of RET mRNA CTD PMID:21570461 Ret Mouse 2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile affects expression ISO RET (Homo sapiens) 6480464 Verapamil affects the expression of RET protein CTD PMID:12388792 Ret Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of RET mRNA CTD PMID:30951980 Ret Mouse 4-hydroxyphenyl retinamide decreases expression EXP 6480464 Fenretinide results in decreased expression of RET mRNA CTD PMID:28973697 Ret Mouse 5-azacytidine decreases expression ISO RET (Homo sapiens) 6480464 Azacitidine results in decreased expression of RET mRNA CTD PMID:20823114 Ret Mouse 6-propyl-2-thiouracil increases expression ISO Ret (Rattus norvegicus) 6480464 Propylthiouracil results in increased expression of RET mRNA and Propylthiouracil results in increased expression of RET protein CTD PMID:22504374 more ... Ret Mouse 6-propyl-2-thiouracil decreases expression ISO Ret (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of RET mRNA CTD PMID:30047161 Ret Mouse afimoxifene multiple interactions ISO RET (Homo sapiens) 6480464 afimoxifene inhibits the reaction [Estrogens results in increased expression of RET mRNA] CTD PMID:21233418 Ret Mouse aflatoxin B1 decreases methylation ISO RET (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of RET intron CTD PMID:30157460 Ret Mouse aldehydo-D-glucose increases expression ISO Ret (Rattus norvegicus) 6480464 Glucose results in increased expression of RET mRNA CTD PMID:21818840 Ret Mouse aldrin multiple interactions ISO RET (Homo sapiens) 6480464 [Hexachlorocyclohexane co-treated with Aldrin co-treated with Dieldrin co-treated with Endrin co-treated with Dichlorodiphenyl Dichloroethylene co-treated with Dichlorodiphenyldichloroethane co-treated with DDT co-treated with Simvastatin] results in decreased expression of RET mRNA CTD PMID:28263720 Ret Mouse all-trans-retinoic acid increases response to substance ISO RET (Homo sapiens) 6480464 RET protein results in increased susceptibility to Tretinoin CTD PMID:16849523 Ret Mouse all-trans-retinoic acid decreases expression ISO RET (Homo sapiens) 6480464 Tretinoin results in decreased expression of RET mRNA CTD PMID:33167477 Ret Mouse all-trans-retinoic acid increases expression ISO Ret (Rattus norvegicus) 6480464 Tretinoin results in increased expression of RET mRNA CTD PMID:20488242 Ret Mouse all-trans-retinoic acid increases phosphorylation ISO RET (Homo sapiens) 6480464 Tretinoin results in increased phosphorylation of RET protein CTD PMID:17431108 Ret Mouse all-trans-retinoic acid multiple interactions ISO RET (Homo sapiens) 6480464 [Tretinoin results in increased secretion of GDNF protein] which results in increased activity of RET protein and Tretinoin results in increased expression of and results in increased phosphorylation of and results in increased activity of RET protein CTD PMID:16849523 Ret Mouse all-trans-retinoic acid increases expression ISO RET (Homo sapiens) 6480464 Tretinoin results in increased expression of RET mRNA and Tretinoin results in increased expression of RET protein CTD PMID:16012519 more ... Ret Mouse all-trans-retinol multiple interactions ISO Ret (Rattus norvegicus) 6480464 [Valproic Acid co-treated with Vitamin A deficiency] affects the expression of RET protein and [Valproic Acid co-treated with Vitamin A deficiency] affects the reaction [RARA protein binds to RET promoter] CTD PMID:32526256 Ret Mouse alpha-Zearalanol multiple interactions ISO Ret (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of RET mRNA CTD PMID:35163327 Ret Mouse amitrole decreases expression ISO Ret (Rattus norvegicus) 6480464 Amitrole results in decreased expression of RET mRNA CTD PMID:30047161 Ret Mouse ammonium chloride affects expression ISO Ret (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of RET mRNA CTD PMID:16483693 Ret Mouse arsane increases activity ISO RET (Homo sapiens) 6480464 Arsenic results in increased activity of RET protein and Arsenic results in increased activity of RET protein alternative form CTD PMID:21195159 Ret Mouse arsane multiple interactions ISO RET (Homo sapiens) 6480464 [Arsenic co-treated with RET protein alternative form] results in increased secretion of MMP2 protein alternative form more ... CTD PMID:21195159 Ret Mouse arsenic atom multiple interactions ISO RET (Homo sapiens) 6480464 [Arsenic co-treated with RET protein alternative form] results in increased secretion of MMP2 protein alternative form more ... CTD PMID:21195159 Ret Mouse arsenic atom increases activity ISO RET (Homo sapiens) 6480464 Arsenic results in increased activity of RET protein and Arsenic results in increased activity of RET protein alternative form CTD PMID:21195159 Ret Mouse atrazine affects methylation ISO Ret (Rattus norvegicus) 6480464 Atrazine affects the methylation of RET gene CTD PMID:35440735 Ret Mouse benzo[a]pyrene decreases expression ISO Ret (Rattus norvegicus) 6480464 Benzo(a)pyrene results in decreased expression of RET mRNA CTD PMID:21839799 Ret Mouse benzo[a]pyrene increases methylation ISO RET (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of RET 5' UTR CTD PMID:27901495 Ret Mouse benzo[a]pyrene affects methylation ISO RET (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of RET intron and Benzo(a)pyrene affects the methylation of RET promoter CTD PMID:27901495 and PMID:30157460 Ret Mouse benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of RET mRNA CTD PMID:22228805 Ret Mouse benzo[e]pyrene increases methylation ISO RET (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of RET intron CTD PMID:30157460 Ret Mouse bis(2-ethylhexyl) phthalate affects expression EXP 6480464 Diethylhexyl Phthalate affects the expression of RET mRNA CTD PMID:37059381 Ret Mouse bis(2-ethylhexyl) phthalate decreases expression ISO RET (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of RET mRNA CTD PMID:31163220 Ret Mouse bisphenol A decreases expression ISO Ret (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of RET mRNA CTD PMID:12075121 more ... Ret Mouse bisphenol A increases expression ISO RET (Homo sapiens) 6480464 bisphenol A results in increased expression of RET mRNA CTD PMID:28711546 Ret Mouse bisphenol A decreases methylation EXP 6480464 bisphenol A results in decreased methylation of RET promoter CTD PMID:27312807 Ret Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of RET mRNA CTD PMID:27312807 more ... Ret Mouse bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of RET promoter CTD PMID:27312807 Ret Mouse bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of RET mRNA CTD PMID:30951980 Ret Mouse bucladesine multiple interactions ISO RET (Homo sapiens) 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in decreased expression of RET mRNA CTD PMID:20823114 Ret Mouse butanal increases expression ISO RET (Homo sapiens) 6480464 butyraldehyde results in increased expression of RET mRNA CTD PMID:26079696 Ret Mouse cadmium dichloride multiple interactions ISO RET (Homo sapiens) 6480464 [sodium arsenite co-treated with Cadmium Chloride co-treated with chromic oxide co-treated with chromous chloride co-treated with lead acetate] results in decreased expression of RET mRNA CTD PMID:12634122 Ret Mouse calcitriol increases expression ISO RET (Homo sapiens) 6480464 Calcitriol results in increased expression of RET mRNA CTD PMID:16002434 Ret Mouse camptothecin decreases expression ISO Ret (Rattus norvegicus) 6480464 Camptothecin results in decreased expression of RET protein CTD PMID:17555550 Ret Mouse chlordecone decreases expression EXP 6480464 Chlordecone results in decreased expression of RET mRNA CTD PMID:33711761 Ret Mouse chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of RET mRNA CTD PMID:20350560 Ret Mouse cisplatin decreases expression ISO Ret (Rattus norvegicus) 6480464 Cisplatin results in decreased expression of RET protein CTD PMID:17555550 Ret Mouse clomiphene decreases expression ISO RET (Homo sapiens) 6480464 Clomiphene results in decreased expression of RET mRNA CTD PMID:26865669 Ret Mouse copper(II) sulfate decreases expression ISO RET (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of RET mRNA CTD PMID:19549813 Ret Mouse coumestrol multiple interactions ISO RET (Homo sapiens) 6480464 [Coumestrol co-treated with 2 more ... CTD PMID:19167446 Ret Mouse Cuprizon increases expression ISO Ret (Rattus norvegicus) 6480464 Cuprizone results in increased expression of RET mRNA CTD PMID:27523638 Ret Mouse cycloheximide decreases expression ISO Ret (Rattus norvegicus) 6480464 Cycloheximide results in decreased expression of RET protein CTD PMID:17555550 Ret Mouse D-glucose increases expression ISO Ret (Rattus norvegicus) 6480464 Glucose results in increased expression of RET mRNA CTD PMID:21818840 Ret Mouse dabigatran multiple interactions ISO Ret (Rattus norvegicus) 6480464 Dabigatran inhibits the reaction [Rotenone results in decreased expression of RET protein] CTD PMID:28585189 Ret Mouse DDD multiple interactions ISO RET (Homo sapiens) 6480464 [Hexachlorocyclohexane co-treated with Aldrin co-treated with Dieldrin co-treated with Endrin co-treated with Dichlorodiphenyl Dichloroethylene co-treated with Dichlorodiphenyldichloroethane co-treated with DDT co-treated with Simvastatin] results in decreased expression of RET mRNA CTD PMID:28263720 Ret Mouse DDE multiple interactions ISO RET (Homo sapiens) 6480464 [Hexachlorocyclohexane co-treated with Aldrin co-treated with Dieldrin co-treated with Endrin co-treated with Dichlorodiphenyl Dichloroethylene co-treated with Dichlorodiphenyldichloroethane co-treated with DDT co-treated with Simvastatin] results in decreased expression of RET mRNA CTD PMID:28263720 Ret Mouse DDT multiple interactions ISO RET (Homo sapiens) 6480464 [Hexachlorocyclohexane co-treated with Aldrin co-treated with Dieldrin co-treated with Endrin co-treated with Dichlorodiphenyl Dichloroethylene co-treated with Dichlorodiphenyldichloroethane co-treated with DDT co-treated with Simvastatin] results in decreased expression of RET mRNA CTD PMID:28263720 Ret Mouse decabromodiphenyl ether increases expression ISO Ret (Rattus norvegicus) 6480464 decabromobiphenyl ether results in increased expression of RET mRNA CTD PMID:23914054 Ret Mouse dexamethasone decreases expression ISO Ret (Rattus norvegicus) 6480464 Dexamethasone results in decreased expression of RET mRNA CTD PMID:30359671 Ret Mouse dexamethasone multiple interactions ISO Ret (Rattus norvegicus) 6480464 AGTR2 protein inhibits the reaction [Dexamethasone results in decreased expression of RET mRNA] and Mifepristone inhibits the reaction [Dexamethasone results in decreased expression of RET mRNA] CTD PMID:30359671 Ret Mouse diazinon affects expression ISO Ret (Rattus norvegicus) 6480464 Diazinon affects the expression of RET mRNA CTD PMID:22546817 Ret Mouse dichromium trioxide multiple interactions ISO RET (Homo sapiens) 6480464 [sodium arsenite co-treated with Cadmium Chloride co-treated with chromic oxide co-treated with chromous chloride co-treated with lead acetate] results in decreased expression of RET mRNA CTD PMID:12634122 Ret Mouse diclofenac increases expression EXP 6480464 Diclofenac results in increased expression of RET mRNA CTD PMID:26934552 Ret Mouse dieldrin affects expression ISO Ret (Rattus norvegicus) 6480464 Dieldrin affects the expression of RET mRNA CTD PMID:22546817 Ret Mouse dieldrin multiple interactions ISO RET (Homo sapiens) 6480464 [Hexachlorocyclohexane co-treated with Aldrin co-treated with Dieldrin co-treated with Endrin co-treated with Dichlorodiphenyl Dichloroethylene co-treated with Dichlorodiphenyldichloroethane co-treated with DDT co-treated with Simvastatin] results in decreased expression of RET mRNA CTD PMID:28263720 Ret Mouse diethylstilbestrol increases expression ISO RET (Homo sapiens) 6480464 Diethylstilbestrol results in increased expression of RET mRNA CTD PMID:26865669 Ret Mouse dorsomorphin multiple interactions ISO RET (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Ret Mouse endosulfan increases expression ISO Ret (Rattus norvegicus) 6480464 Endosulfan results in increased expression of RET mRNA CTD PMID:29391264 Ret Mouse endrin multiple interactions ISO RET (Homo sapiens) 6480464 [Hexachlorocyclohexane co-treated with Aldrin co-treated with Dieldrin co-treated with Endrin co-treated with Dichlorodiphenyl Dichloroethylene co-treated with Dichlorodiphenyldichloroethane co-treated with DDT co-treated with Simvastatin] results in decreased expression of RET mRNA CTD PMID:28263720 Ret Mouse Enterolactone multiple interactions ISO RET (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of RET mRNA CTD PMID:19167446 Ret Mouse entinostat increases expression ISO RET (Homo sapiens) 6480464 entinostat results in increased expression of RET mRNA CTD PMID:26272509 Ret Mouse entinostat multiple interactions ISO RET (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of RET mRNA CTD PMID:27188386 Ret Mouse estrone increases expression ISO RET (Homo sapiens) 6480464 Estrone results in increased expression of RET mRNA CTD PMID:26865669 Ret Mouse ethanol affects expression EXP 6480464 Ethanol affects the expression of RET mRNA CTD PMID:22198099 and PMID:30319688 Ret Mouse ethanol decreases expression ISO Ret (Rattus norvegicus) 6480464 Ethanol results in decreased expression of RET mRNA CTD PMID:29548890 and PMID:31039417 Ret Mouse fonofos increases methylation ISO RET (Homo sapiens) 6480464 Fonofos results in increased methylation of RET promoter CTD PMID:22847954 Ret Mouse fulvestrant decreases expression ISO RET (Homo sapiens) 6480464 fulvestrant results in decreased expression of RET mRNA CTD PMID:26865669 Ret Mouse gamma-hexachlorocyclohexane multiple interactions ISO RET (Homo sapiens) 6480464 [Hexachlorocyclohexane co-treated with Aldrin co-treated with Dieldrin co-treated with Endrin co-treated with Dichlorodiphenyl Dichloroethylene co-treated with Dichlorodiphenyldichloroethane co-treated with DDT co-treated with Simvastatin] results in decreased expression of RET mRNA CTD PMID:28263720 Ret Mouse genistein increases expression ISO Ret (Rattus norvegicus) 6480464 Genistein results in increased expression of RET mRNA CTD PMID:12075121 Ret Mouse genistein increases expression ISO RET (Homo sapiens) 6480464 Genistein results in increased expression of RET mRNA CTD PMID:26865669 Ret Mouse glucose increases expression ISO Ret (Rattus norvegicus) 6480464 Glucose results in increased expression of RET mRNA CTD PMID:21818840 Ret Mouse glyphosate increases expression EXP 6480464 Glyphosate results in increased expression of RET mRNA CTD PMID:35897073 Ret Mouse graphite affects expression ISO Ret (Rattus norvegicus) 6480464 Graphite affects the expression of RET mRNA CTD PMID:29933104 Ret Mouse Indeno[1,2,3-cd]pyrene decreases expression ISO RET (Homo sapiens) 6480464 indeno(1 more ... CTD PMID:32251684 Ret Mouse irbesartan increases expression ISO RET (Homo sapiens) 6480464 irbesartan results in increased expression of RET protein CTD PMID:16164579 Ret Mouse ivermectin increases expression ISO RET (Homo sapiens) 6480464 Ivermectin results in increased expression of RET mRNA CTD PMID:33405908 Ret Mouse ivermectin multiple interactions ISO RET (Homo sapiens) 6480464 ESR1 protein affects the reaction [Ivermectin results in increased expression of RET mRNA] CTD PMID:33405908 Ret Mouse L-cysteine multiple interactions ISO RET (Homo sapiens) 6480464 Cysteine inhibits the reaction [[Arsenic co-treated with RET protein] results in increased secretion of MMP2 protein alternative form] CTD PMID:21195159 Ret Mouse lead diacetate multiple interactions ISO RET (Homo sapiens) 6480464 [sodium arsenite co-treated with Cadmium Chloride co-treated with chromic oxide co-treated with chromous chloride co-treated with lead acetate] results in decreased expression of RET mRNA CTD PMID:12634122 Ret Mouse lead diacetate increases expression ISO Ret (Rattus norvegicus) 6480464 lead acetate results in increased expression of RET mRNA CTD PMID:22641619 Ret Mouse lipopolysaccharide multiple interactions ISO RET (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of RET mRNA CTD PMID:35811015 Ret Mouse lithium atom multiple interactions ISO Ret (Rattus norvegicus) 6480464 [Lithium co-treated with Pilocarpine] results in increased expression of RET protein CTD PMID:12914250 Ret Mouse lithium hydride multiple interactions ISO Ret (Rattus norvegicus) 6480464 [Lithium co-treated with Pilocarpine] results in increased expression of RET protein CTD PMID:12914250 Ret Mouse manganese(II) chloride decreases expression ISO Ret (Rattus norvegicus) 6480464 manganese chloride results in decreased expression of RET protein CTD PMID:17555550 Ret Mouse Meclizine affects expression ISO RET (Homo sapiens) 6480464 Meclizine affects the expression of RET protein CTD PMID:12388792 Ret Mouse medroxyprogesterone acetate multiple interactions ISO RET (Homo sapiens) 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in decreased expression of RET mRNA CTD PMID:20823114 Ret Mouse megestrol affects expression ISO RET (Homo sapiens) 6480464 Megestrol affects the expression of RET protein CTD PMID:12388792 Ret Mouse mercury dibromide decreases expression ISO RET (Homo sapiens) 6480464 mercuric bromide results in decreased expression of RET mRNA CTD PMID:26272509 Ret Mouse mercury dibromide multiple interactions ISO RET (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of RET mRNA CTD PMID:27188386 Ret Mouse mestranol increases expression ISO RET (Homo sapiens) 6480464 Mestranol results in increased expression of RET mRNA CTD PMID:26865669 Ret Mouse methapyrilene increases methylation ISO RET (Homo sapiens) 6480464 Methapyrilene results in increased methylation of RET intron CTD PMID:30157460 Ret Mouse Methazolamide affects expression ISO RET (Homo sapiens) 6480464 Methazolamide affects the expression of RET protein CTD PMID:12388792 Ret Mouse methimazole increases expression ISO Ret (Rattus norvegicus) 6480464 Methimazole results in increased expression of RET mRNA and Methimazole results in increased expression of RET protein CTD PMID:22504374 Ret Mouse methylmercury chloride decreases expression ISO RET (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of RET mRNA CTD PMID:28001369 Ret Mouse methylphenidate decreases expression EXP 6480464 Methylphenidate results in decreased expression of RET mRNA CTD PMID:22470460 Ret Mouse mifepristone multiple interactions ISO Ret (Rattus norvegicus) 6480464 Mifepristone inhibits the reaction [Dexamethasone results in decreased expression of RET mRNA] CTD PMID:30359671 Ret Mouse N-(3-methyl-5-sulfamoyl-1,3,4-thiadiazol-2-ylidene)acetamide affects expression ISO RET (Homo sapiens) 6480464 Methazolamide affects the expression of RET protein CTD PMID:12388792 Ret Mouse N-methyl-4-phenylpyridinium decreases expression ISO Ret (Rattus norvegicus) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of RET mRNA CTD PMID:16026605 Ret Mouse N-nitrosodiethylamine multiple interactions ISO Ret (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of RET mRNA CTD PMID:20360939 Ret Mouse nickel atom decreases expression ISO RET (Homo sapiens) 6480464 Nickel results in decreased expression of RET mRNA CTD PMID:24768652 and PMID:25583101 Ret Mouse nickel dichloride affects expression ISO Ret (Rattus norvegicus) 6480464 nickel chloride affects the expression of RET mRNA CTD PMID:22546817 Ret Mouse Nor-9-carboxy-delta9-THC multiple interactions ISO RET (Homo sapiens) 6480464 [Cannabinoids results in increased abundance of 11-nor-delta(9)-tetrahydrocannabinol-9-carboxylic acid] which affects the methylation of RET gene CTD PMID:30521419 Ret Mouse oxaliplatin multiple interactions ISO Ret (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of RET mRNA CTD PMID:25729387 Ret Mouse oxidopamine decreases response to substance EXP 6480464 RET protein mutant form results in decreased susceptibility to Oxidopamine CTD PMID:19767128 Ret Mouse p-chloromercuribenzoic acid decreases expression ISO RET (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in decreased expression of RET mRNA CTD PMID:26272509 Ret Mouse p-chloromercuribenzoic acid multiple interactions ISO RET (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of RET mRNA CTD PMID:27188386 Ret Mouse paracetamol decreases expression ISO Ret (Rattus norvegicus) 6480464 Acetaminophen results in decreased expression of RET mRNA CTD PMID:30723492 Ret Mouse parathion increases methylation ISO RET (Homo sapiens) 6480464 Parathion results in increased methylation of RET promoter CTD PMID:22847954 Ret Mouse PCB138 multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Ret Mouse pentanal increases expression ISO RET (Homo sapiens) 6480464 pentanal results in increased expression of RET mRNA CTD PMID:26079696 Ret Mouse perfluorooctanoic acid multiple interactions ISO Ret (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of RET mRNA CTD PMID:35163327 Ret Mouse phenethyl caffeate multiple interactions ISO Ret (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of RET mRNA CTD PMID:20360939 Ret Mouse phenylmercury acetate decreases expression ISO RET (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of RET mRNA CTD PMID:26272509 Ret Mouse phenylmercury acetate multiple interactions ISO RET (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of RET mRNA CTD PMID:27188386 Ret Mouse picene decreases expression ISO RET (Homo sapiens) 6480464 picene results in decreased expression of RET mRNA CTD PMID:32251684 Ret Mouse pinostrobin increases expression ISO RET (Homo sapiens) 6480464 pinostrobin results in increased expression of RET mRNA CTD PMID:37777166 Ret Mouse ponatinib decreases activity ISO RET (Homo sapiens) 6480464 ponatinib analog results in decreased activity of RET protein more ... CTD PMID:19878872 and PMID:21561767 Ret Mouse propanal increases expression ISO RET (Homo sapiens) 6480464 propionaldehyde results in increased expression of RET mRNA CTD PMID:26079696 Ret Mouse Ptaquiloside decreases expression EXP 6480464 ptaquiloside results in decreased expression of RET mRNA CTD PMID:23274088 Ret Mouse raloxifene multiple interactions ISO RET (Homo sapiens) 6480464 [Raloxifene Hydrochloride co-treated with ESR1 protein] results in increased expression of RET mRNA and [Raloxifene Hydrochloride co-treated with ESR2 protein] results in decreased expression of RET mRNA CTD PMID:19059307 Ret Mouse raloxifene decreases expression ISO RET (Homo sapiens) 6480464 Raloxifene Hydrochloride results in decreased expression of RET mRNA CTD PMID:26865669 Ret Mouse resveratrol multiple interactions ISO RET (Homo sapiens) 6480464 [Coumestrol co-treated with Resveratrol] results in increased expression of RET mRNA and [Plant Extracts co-treated with Resveratrol] results in decreased expression of RET mRNA CTD PMID:19167446 and PMID:23557933 Ret Mouse rotenone decreases expression ISO Ret (Rattus norvegicus) 6480464 Rotenone results in decreased expression of RET mRNA and Rotenone results in decreased expression of RET protein CTD PMID:17555550 more ... Ret Mouse rotenone multiple interactions ISO Ret (Rattus norvegicus) 6480464 Dabigatran inhibits the reaction [Rotenone results in decreased expression of RET protein] CTD PMID:28585189 Ret Mouse S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO RET (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of RET mRNA CTD PMID:35811015 Ret Mouse SB 431542 multiple interactions ISO RET (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Ret Mouse simvastatin multiple interactions ISO RET (Homo sapiens) 6480464 [Hexachlorocyclohexane co-treated with Aldrin co-treated with Dieldrin co-treated with Endrin co-treated with Dichlorodiphenyl Dichloroethylene co-treated with Dichlorodiphenyldichloroethane co-treated with DDT co-treated with Simvastatin] results in decreased expression of RET mRNA CTD PMID:28263720 Ret Mouse sodium arsenite multiple interactions ISO RET (Homo sapiens) 6480464 [sodium arsenite co-treated with Cadmium Chloride co-treated with chromic oxide co-treated with chromous chloride co-treated with lead acetate] results in decreased expression of RET mRNA CTD PMID:12634122 Ret Mouse sodium arsenite decreases expression ISO Ret (Rattus norvegicus) 6480464 sodium arsenite results in decreased expression of RET mRNA CTD PMID:35314868 Ret Mouse sodium arsenite increases expression ISO RET (Homo sapiens) 6480464 sodium arsenite results in increased expression of RET mRNA CTD PMID:38568856 Ret Mouse sodium arsenite affects methylation ISO RET (Homo sapiens) 6480464 sodium arsenite affects the methylation of RET gene CTD PMID:28589171 Ret Mouse Soman increases expression ISO Ret (Rattus norvegicus) 6480464 Soman results in increased expression of RET mRNA CTD PMID:19281266 Ret Mouse sorafenib decreases activity ISO RET (Homo sapiens) 6480464 sorafenib results in decreased activity of RET protein and sorafenib results in decreased activity of RET protein mutant form CTD PMID:17664273 Ret Mouse sorafenib increases degradation ISO RET (Homo sapiens) 6480464 sorafenib results in increased degradation of RET protein CTD PMID:17664273 Ret Mouse staurosporine decreases expression ISO Ret (Rattus norvegicus) 6480464 Staurosporine results in decreased expression of RET protein CTD PMID:17555550 Ret Mouse sulindac affects expression ISO RET (Homo sapiens) 6480464 Sulindac affects the expression of RET protein CTD PMID:12388792 Ret Mouse tamoxifen multiple interactions ISO RET (Homo sapiens) 6480464 [Tamoxifen co-treated with ESR1 protein] results in increased expression of RET mRNA more ... CTD PMID:19059307 and PMID:24758408 Ret Mouse tebuconazole decreases expression ISO RET (Homo sapiens) 6480464 tebuconazole results in decreased expression of RET mRNA CTD PMID:30458266 Ret Mouse terbufos increases methylation ISO RET (Homo sapiens) 6480464 terbufos results in increased methylation of RET promoter CTD PMID:22847954 Ret Mouse tetrachloromethane affects expression ISO Ret (Rattus norvegicus) 6480464 Carbon Tetrachloride affects the expression of RET mRNA CTD PMID:12734012 Ret Mouse thapsigargin decreases expression ISO RET (Homo sapiens) 6480464 Thapsigargin results in decreased expression of RET mRNA CTD PMID:22378314 Ret Mouse titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of RET mRNA CTD PMID:29264374 Ret Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of RET gene CTD PMID:35295148 Ret Mouse topotecan multiple interactions ISO Ret (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of RET mRNA CTD PMID:25729387 Ret Mouse trichostatin A increases expression ISO RET (Homo sapiens) 6480464 trichostatin A results in increased expression of RET mRNA CTD PMID:24935251 Ret Mouse triclosan decreases expression ISO RET (Homo sapiens) 6480464 Triclosan results in decreased expression of RET mRNA CTD PMID:30510588 Ret Mouse triptonide increases expression EXP 6480464 triptonide results in increased expression of RET mRNA CTD PMID:33045310 Ret Mouse tunicamycin decreases expression ISO RET (Homo sapiens) 6480464 Tunicamycin results in decreased expression of RET mRNA CTD PMID:22378314 Ret Mouse valproic acid increases methylation ISO RET (Homo sapiens) 6480464 Valproic Acid results in increased methylation of RET gene CTD PMID:29154799 Ret Mouse valproic acid increases methylation ISO Ret (Rattus norvegicus) 6480464 Valproic Acid results in increased methylation of RET promoter CTD PMID:33150595 Ret Mouse valproic acid decreases expression ISO Ret (Rattus norvegicus) 6480464 Valproic Acid results in decreased expression of RET mRNA CTD PMID:33150595 Ret Mouse valproic acid multiple interactions ISO Ret (Rattus norvegicus) 6480464 [Valproic Acid co-treated with Vitamin A deficiency] affects the expression of RET protein and [Valproic Acid co-treated with Vitamin A deficiency] affects the reaction [RARA protein binds to RET promoter] CTD PMID:32526256 Ret Mouse valproic acid multiple interactions ISO RET (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of RET mRNA CTD PMID:27188386 Ret Mouse valproic acid increases expression ISO RET (Homo sapiens) 6480464 Valproic Acid results in increased expression of RET mRNA CTD PMID:23179753 more ... Ret Mouse valproic acid affects expression ISO RET (Homo sapiens) 6480464 Valproic Acid affects the expression of RET mRNA CTD PMID:25979313 Ret Mouse valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of RET mRNA CTD PMID:17963808 Ret Mouse vandetanib decreases phosphorylation ISO RET (Homo sapiens) 6480464 vandetanib results in decreased phosphorylation of RET protein CTD PMID:17431108 Ret Mouse verapamil affects expression ISO RET (Homo sapiens) 6480464 Verapamil affects the expression of RET protein CTD PMID:12388792 Ret Mouse vorinostat decreases expression ISO RET (Homo sapiens) 6480464 vorinostat results in decreased expression of RET mRNA CTD PMID:27188386
Imported Annotations - KEGG (archival)
Ret Mouse abnormal adrenal gland morphology IAGP 5509061 MGI PMID:10675330 Ret Mouse abnormal adrenal medulla morphology IAGP 5509061 MGI PMID:10675330 Ret Mouse abnormal axon guidance IAGP 5509061 MGI PMID:16600854 Ret Mouse abnormal branching involved in ureteric bud morphogenesis IAGP 5509061 MGI PMID:8674430 Ret Mouse abnormal cardiac ganglion morphology IAGP 5509061 MGI PMID:10974669 Ret Mouse abnormal colon morphology IAGP 5509061 MGI PMID:15340065 Ret Mouse abnormal colon morphology IAGP 5509061 MGI PMID:17050626 Ret Mouse abnormal colon morphology IAGP 5509061 MGI PMID:15469971 Ret Mouse abnormal defecation IAGP 5509061 MGI PMID:20392943 Ret Mouse abnormal embryo development IAGP 5509061 MGI PMID:29192291 Ret Mouse abnormal enteric ganglia morphology IAGP 5509061 MGI PMID:15340065 Ret Mouse abnormal enteric ganglia morphology IAGP 5509061 MGI PMID:18414682 Ret Mouse abnormal enteric ganglia morphology IAGP 5509061 MGI PMID:17372903 Ret Mouse abnormal enteric ganglia morphology IAGP 5509061 MGI PMID:17050626 Ret Mouse abnormal enteric ganglia morphology IAGP 5509061 MGI PMID:16565500 Ret Mouse abnormal enteric ganglia morphology IAGP 5509061 MGI PMID:11562352 Ret Mouse abnormal enteric ganglia morphology IAGP 5509061 MGI PMID:16227613 Ret Mouse abnormal enteric ganglia morphology IAGP 5509061 MGI PMID:15469971 Ret Mouse abnormal enteric nervous system morphology IAGP 5509061 MGI PMID:15340065 Ret Mouse abnormal enteric nervous system morphology IAGP 5509061 MGI PMID:18414682 Ret Mouse abnormal enteric nervous system morphology IAGP 5509061 MGI PMID:15469971 Ret Mouse abnormal enteric neural crest cell migration IAGP 5509061 MGI PMID:8565847 Ret Mouse abnormal enteric neural crest cell migration IAGP 5509061 MGI PMID:18414682 Ret Mouse abnormal enteric neural crest cell migration IAGP 5509061 MGI PMID:20392943 Ret Mouse abnormal enteric neural crest cell migration IAGP 5509061 MGI PMID:17050626 Ret Mouse abnormal enteric neural crest cell migration IAGP 5509061 MGI PMID:11562352 Ret Mouse abnormal enteric neural crest cell morphology IAGP 5509061 MGI PMID:17050626 Ret Mouse abnormal enteric neuron morphology IAGP 5509061 MGI PMID:12668632 Ret Mouse abnormal enteric neuron morphology IAGP 5509061 MGI PMID:20392943 Ret Mouse abnormal enteric neuron morphology IAGP 5509061 MGI PMID:17050626 Ret Mouse abnormal enteric neuron morphology IAGP 5509061 MGI PMID:17065462 Ret Mouse abnormal enteric neuron morphology IAGP 5509061 MGI PMID:16565500 Ret Mouse abnormal enzyme/coenzyme activity IAGP 5509061 MGI PMID:17050626 Ret Mouse abnormal facial motor nucleus morphology IAGP 5509061 MGI PMID:18216204 Ret Mouse abnormal feces composition IAGP 5509061 MGI PMID:20392943 Ret Mouse abnormal gastrocnemius morphology IAGP 5509061 MGI PMID:18305247 Ret Mouse abnormal hypaxial muscle morphology IAGP 5509061 MGI PMID:18305247 Ret Mouse abnormal hypoglossal nucleus morphology IAGP 5509061 MGI PMID:18216204 Ret Mouse abnormal innervation IAGP 5509061 MGI PMID:15242795 Ret Mouse abnormal innervation pattern to muscle IAGP 5509061 MGI PMID:16600854 Ret Mouse abnormal intestinal peristalsis IAGP 5509061 MGI PMID:10675330 Ret Mouse abnormal intestinal peristalsis IAGP 5509061 MGI PMID:16227613 Ret Mouse abnormal jejunum morphology IAGP 5509061 MGI PMID:17553423 Ret Mouse abnormal kidney collecting duct morphology IAGP 5509061 MGI PMID:8114940 Ret Mouse abnormal kidney development IAGP 5509061 MGI PMID:15469971 Ret Mouse abnormal kidney development IAGP 5509061 MGI PMID:18216204 Ret Mouse abnormal kidney development IAGP 5509061 MGI PMID:16452504 Ret Mouse abnormal kidney medulla development IAGP 5509061 MGI PMID:16452504 Ret Mouse abnormal kidney mesenchyme morphology IAGP 5509061 MGI PMID:8114940 Ret Mouse abnormal kidney morphology IAGP 5509061 MGI PMID:8114940 Ret Mouse abnormal kidney morphology IAGP 5509061 MGI PMID:16452504 Ret Mouse abnormal kidney morphology IAGP 5509061 MGI PMID:16227613 Ret Mouse abnormal kidney morphology IAGP 5509061 MGI PMID:11562352 Ret Mouse abnormal kidney morphology IAGP 5509061 MGI PMID:7595168 Ret Mouse abnormal large intestine morphology IAGP 5509061 MGI PMID:16565500 Ret Mouse abnormal large intestine morphology IAGP 5509061 MGI PMID:18414682 Ret Mouse abnormal lung development IAGP 5509061 MGI PMID:7595168 Ret Mouse abnormal mesonephros morphology IAGP 5509061 MGI PMID:8674430 Ret Mouse abnormal metanephric mesenchyme morphology IAGP 5509061 MGI PMID:8674430 Ret Mouse abnormal motor neuron innervation pattern IAGP 5509061 MGI PMID:18305247 Ret Mouse abnormal muscle spindle morphology IAGP 5509061 MGI PMID:18305247 Ret Mouse abnormal neurite morphology IAGP 5509061 MGI PMID:17553423 Ret Mouse abnormal neuromuscular synapse morphology IAGP 5509061 MGI PMID:18216204 Ret Mouse abnormal neuron differentiation IAGP 5509061 MGI PMID:17372903 Ret Mouse abnormal neuron morphology IAGP 5509061 MGI PMID:17553423 Ret Mouse abnormal neuron morphology IAGP 5509061 MGI PMID:19755105 Ret Mouse abnormal neurotransmitter secretion IAGP 5509061 MGI PMID:12668632 Ret Mouse abnormal parasympathetic postganglionic fiber morphology IAGP 5509061 MGI PMID:10974669 Ret Mouse abnormal prevertebral ganglion morphology IAGP 5509061 MGI PMID:11641220 Ret Mouse abnormal pterygopalatine ganglion morphology IAGP 5509061 MGI PMID:15469971 Ret Mouse abnormal renal glomerulus morphology IAGP 5509061 MGI PMID:16452504 Ret Mouse abnormal small intestine morphology IAGP 5509061 MGI PMID:15340065 Ret Mouse abnormal small intestine morphology IAGP 5509061 MGI PMID:16565500 Ret Mouse abnormal spermatogenesis IAGP 5509061 MGI PMID:15469971 Ret Mouse abnormal stellate ganglion morphology IAGP 5509061 MGI PMID:8565847 Ret Mouse abnormal submandibular gland morphology IAGP 5509061 MGI PMID:11641220 Ret Mouse abnormal sympathetic ganglion morphology IAGP 5509061 MGI PMID:10675330 Ret Mouse abnormal sympathetic ganglion morphology IAGP 5509061 MGI PMID:11641220 Ret Mouse abnormal sympathetic neuron morphology IAGP 5509061 MGI PMID:11641220 Ret Mouse abnormal sympathetic postganglionic fiber morphology IAGP 5509061 MGI PMID:11641220 Ret Mouse abnormal synaptic dopamine release IAGP 5509061 MGI PMID:22841315 Ret Mouse abnormal thyroid gland morphology IAGP 5509061 MGI PMID:17372903 Ret Mouse abnormal ureter development IAGP 5509061 MGI PMID:8114940 Ret Mouse abnormal ureter morphology IAGP 5509061 MGI PMID:8114940 Ret Mouse abnormal ureter morphology IAGP 5509061 MGI PMID:16452504 Ret Mouse abnormal ureter morphology IAGP 5509061 MGI PMID:7595168 Ret Mouse abnormal ureteric bud elongation IAGP 5509061 MGI PMID:8674430 Ret Mouse abnormal ureteric bud invasion IAGP 5509061 MGI PMID:8674430 Ret Mouse abnormal ureteric bud morphology IAGP 5509061 MGI PMID:15340065 Ret Mouse abnormal ureteric bud morphology IAGP 5509061 MGI PMID:16452504 Ret Mouse abnormal urinary bladder morphology IAGP 5509061 MGI PMID:16565500 Ret Mouse abnormal vas deferens morphology IAGP 5509061 MGI PMID:16452504 Ret Mouse absent enteric neural crest cell IAGP 5509061 MGI PMID:11562352 Ret Mouse absent enteric neural crest cell IAGP 5509061 MGI PMID:16227613 Ret Mouse absent enteric neurons IAGP 5509061 MGI PMID:7595168 Ret Mouse absent enteric neurons IAGP 5509061 MGI PMID:20392943 Ret Mouse absent enteric neurons IAGP 5509061 MGI PMID:17553423 Ret Mouse absent enteric neurons IAGP 5509061 MGI PMID:17050626 Ret Mouse absent enteric neurons IAGP 5509061 MGI PMID:17065462 Ret Mouse absent enteric neurons IAGP 5509061 MGI PMID:16565500 Ret Mouse absent enteric neurons IAGP 5509061 MGI PMID:11641220 Ret Mouse absent enteric neurons IAGP 5509061 MGI PMID:8565847 Ret Mouse absent enteric neurons IAGP 5509061 MGI PMID:8114940 Ret Mouse absent kidney IAGP 5509061 MGI PMID:8114940 Ret Mouse absent kidney IAGP 5509061 MGI PMID:17047028 Ret Mouse absent kidney IAGP 5509061 MGI PMID:18414682 Ret Mouse absent kidney IAGP 5509061 MGI PMID:20392943 Ret Mouse absent kidney IAGP 5509061 MGI PMID:17372903 Ret Mouse absent kidney IAGP 5509061 MGI PMID:17065462 Ret Mouse absent kidney IAGP 5509061 MGI PMID:16565500 Ret Mouse absent kidney IAGP 5509061 MGI PMID:11641220 Ret Mouse absent kidney IAGP 5509061 MGI PMID:16452504 Ret Mouse absent kidney IAGP 5509061 MGI PMID:10675330 Ret Mouse absent kidney IAGP 5509061 MGI PMID:7595168 Ret Mouse absent kidney cortex IAGP 5509061 MGI PMID:16452504 Ret Mouse absent kidney medulla IAGP 5509061 MGI PMID:16452504 Ret Mouse absent nephrogenic zone IAGP 5509061 MGI PMID:8114940 Ret Mouse absent nephrogenic zone IAGP 5509061 MGI PMID:16452504 Ret Mouse absent superior cervical ganglion IAGP 5509061 MGI PMID:8565847 Ret Mouse absent ureter IAGP 5509061 MGI PMID:8114940 Ret Mouse absent ureter IAGP 5509061 MGI PMID:17047028 Ret Mouse absent ureter IAGP 5509061 MGI PMID:7595168 Ret Mouse adrenal cortical hyperplasia IAGP 5509061 MGI PMID:17372903 Ret Mouse adrenergic chromaffin cell hyperplasia IAGP 5509061 MGI PMID:10675330 Ret Mouse aganglionic megacolon IAGP 5509061 MGI PMID:17553423 Ret Mouse aganglionic megacolon IAGP 5509061 MGI PMID:18414682 Ret Mouse arrest of spermatogenesis IAGP 5509061 MGI PMID:15469971 Ret Mouse blind ureter IAGP 5509061 MGI PMID:7595168 Ret Mouse blind ureter IAGP 5509061 MGI PMID:8114940 Ret Mouse clubfoot IAGP 5509061 MGI PMID:16600854 Ret Mouse cryptorchism IAGP 5509061 MGI PMID:16452504 Ret Mouse decreased body weight IAGP 5509061 MGI PMID:20392943 Ret Mouse decreased feces water content IAGP 5509061 MGI PMID:20392943 Ret Mouse decreased kidney weight IAGP 5509061 MGI PMID:15340065 Ret Mouse decreased locomotor activity IAGP 5509061 MGI PMID:17065462 Ret Mouse decreased motor neuron number IAGP 5509061 MGI PMID:18305247 Ret Mouse decreased neural crest cell number IAGP 5509061 MGI PMID:18414682 Ret Mouse decreased neuron apoptosis IAGP 5509061 MGI PMID:20392943 Ret Mouse decreased renal glomerulus number IAGP 5509061 MGI PMID:15469971 Ret Mouse decreased renal glomerulus number IAGP 5509061 MGI PMID:17047028 Ret Mouse decreased renal glomerulus number IAGP 5509061 MGI PMID:16452504 Ret Mouse decreased renal glomerulus number IAGP 5509061 MGI PMID:16227613 Ret Mouse dilated renal glomerular capsule IAGP 5509061 MGI PMID:7595168 Ret Mouse dilated renal tubule IAGP 5509061 MGI PMID:7595168 Ret Mouse dilated ureter IAGP 5509061 MGI PMID:16452504 Ret Mouse distended abdomen IAGP 5509061 MGI PMID:15340065 Ret Mouse distended abdomen IAGP 5509061 MGI PMID:17553423 Ret Mouse distended ileum IAGP 5509061 MGI PMID:15469971 Ret Mouse ectopic kidney IAGP 5509061 MGI PMID:16452504 Ret Mouse ectopic ovary IAGP 5509061 MGI PMID:16452504 Ret Mouse ectopic testis IAGP 5509061 MGI PMID:16452504 Ret Mouse ectopic ureteric bud IAGP 5509061 MGI PMID:16452504 Ret Mouse enlarged ileum IAGP 5509061 MGI PMID:17553423 Ret Mouse glomerulosclerosis IAGP 5509061 MGI PMID:16452504 Ret Mouse hydronephrosis IAGP 5509061 MGI PMID:16452504 Ret Mouse impaired branching involved in ureteric bud morphogenesis IAGP 5509061 MGI PMID:12783789 Ret Mouse impaired branching involved in ureteric bud morphogenesis IAGP 5509061 MGI PMID:24780737 Ret Mouse impaired branching involved in ureteric bud morphogenesis IAGP 5509061 MGI PMID:17047028 Ret Mouse impaired branching involved in ureteric bud morphogenesis IAGP 5509061 MGI PMID:16452504 Ret Mouse impaired branching involved in ureteric bud morphogenesis IAGP 5509061 MGI PMID:16227613 Ret Mouse impaired branching involved in ureteric bud morphogenesis IAGP 5509061 MGI PMID:11562352 Ret Mouse increased cell proliferation IAGP 5509061 MGI PMID:11641220 Ret Mouse increased ganglioneuroma incidence IAGP 5509061 MGI PMID:10675330 Ret Mouse increased kidney apoptosis IAGP 5509061 MGI PMID:16452504 Ret Mouse increased metanephric mesenchyme apoptosis IAGP 5509061 MGI PMID:8674430 Ret Mouse increased neuroblastoma incidence IAGP 5509061 MGI PMID:29321660 Ret Mouse increased neuron apoptosis IAGP 5509061 MGI PMID:11641220 Ret Mouse increased neuron apoptosis IAGP 5509061 MGI PMID:18414682 Ret Mouse increased pheochromocytoma incidence IAGP 5509061 MGI PMID:10675330 Ret Mouse increased pheochromocytoma incidence IAGP 5509061 MGI PMID:19321127 Ret Mouse increased thyroid adenoma incidence IAGP 5509061 MGI PMID:17372903 Ret Mouse intestinal hypoperistalsis IAGP 5509061 MGI PMID:8114940 Ret Mouse intestinal hypoperistalsis IAGP 5509061 MGI PMID:12668632 Ret Mouse intestinal hypoperistalsis IAGP 5509061 MGI PMID:7595168 Ret Mouse kidney atrophy IAGP 5509061 MGI PMID:16452504 Ret Mouse kidney cyst IAGP 5509061 MGI PMID:15340065 Ret Mouse kidney cyst IAGP 5509061 MGI PMID:16452504 Ret Mouse kidney cyst IAGP 5509061 MGI PMID:16227613 Ret Mouse kidney cyst IAGP 5509061 MGI PMID:11562352 Ret Mouse kidney cyst IAGP 5509061 MGI PMID:15469971 Ret Mouse large ureter IAGP 5509061 MGI PMID:16452504 Ret Mouse loss of dopaminergic neurons IAGP 5509061 MGI PMID:22841315 Ret Mouse male infertility IAGP 5509061 MGI PMID:10675330 Ret Mouse muscular atrophy IAGP 5509061 MGI PMID:18305247 Ret Mouse neonatal lethality IAGP 5509061 MGI PMID:16227613 Ret Mouse neonatal lethality, complete penetrance IAGP 5509061 MGI PMID:8114940 Ret Mouse neonatal lethality, complete penetrance IAGP 5509061 MGI PMID:17372903 Ret Mouse neonatal lethality, complete penetrance IAGP 5509061 MGI PMID:16565500 Ret Mouse neonatal lethality, complete penetrance IAGP 5509061 MGI PMID:11641220 Ret Mouse neonatal lethality, complete penetrance IAGP 5509061 MGI PMID:10675330 Ret Mouse neonatal lethality, complete penetrance IAGP 5509061 MGI PMID:7595168 Ret Mouse no abnormal phenotype detected IAGP 5509061 MGI PMID:15469971 Ret Mouse no abnormal phenotype detected IAGP 5509061 MGI PMID:23918385 Ret Mouse no abnormal phenotype detected IAGP 5509061 MGI PMID:18216204 Ret Mouse no abnormal phenotype detected IAGP 5509061 MGI PMID:20064391 Ret Mouse no abnormal phenotype detected IAGP 5509061 MGI PMID:15541311 Ret Mouse no abnormal phenotype detected IAGP 5509061 MGI PMID:16452504 Ret Mouse no abnormal phenotype detected IAGP 5509061 MGI PMID:11562352 Ret Mouse no abnormal phenotype detected IAGP 5509061 MGI PMID:16227613 Ret Mouse oligohydramnios IAGP 5509061 MGI PMID:7595168 Ret Mouse perinatal lethality, complete penetrance IAGP 5509061 MGI PMID:18216204 Ret Mouse postnatal growth retardation IAGP 5509061 MGI PMID:15340065 Ret Mouse postnatal growth retardation IAGP 5509061 MGI PMID:20392943 Ret Mouse postnatal growth retardation IAGP 5509061 MGI PMID:11562352 Ret Mouse postnatal lethality, complete penetrance IAGP 5509061 MGI PMID:15340065 Ret Mouse postnatal lethality, incomplete penetrance IAGP 5509061 MGI PMID:17553423 Ret Mouse postnatal lethality, incomplete penetrance IAGP 5509061 MGI PMID:20392943 Ret Mouse premature death IAGP 5509061 MGI PMID:15469971 Ret Mouse premature death IAGP 5509061 MGI PMID:29321660 Ret Mouse premature death IAGP 5509061 MGI PMID:20392943 Ret Mouse premature death IAGP 5509061 MGI PMID:16452504 Ret Mouse preweaning lethality, incomplete penetrance IAGP 5509061 MGI PMID:11562352 Ret Mouse preweaning lethality, incomplete penetrance IAGP 5509061 MGI PMID:17047028 Ret Mouse renal cast IAGP 5509061 MGI PMID:15469971 Ret Mouse renal hypoplasia IAGP 5509061 MGI PMID:15469971 Ret Mouse renal hypoplasia IAGP 5509061 MGI PMID:17047028 Ret Mouse renal hypoplasia IAGP 5509061 MGI PMID:16452504 Ret Mouse renal hypoplasia IAGP 5509061 MGI PMID:16227613 Ret Mouse renal hypoplasia IAGP 5509061 MGI PMID:11562352 Ret Mouse seminiferous tubule degeneration IAGP 5509061 MGI PMID:15469971 Ret Mouse single kidney IAGP 5509061 MGI PMID:16452504 Ret Mouse single kidney IAGP 5509061 MGI PMID:17047028 Ret Mouse small dorsal root ganglion IAGP 5509061 MGI PMID:17553423 Ret Mouse small kidney IAGP 5509061 MGI PMID:7595168 Ret Mouse small kidney IAGP 5509061 MGI PMID:16227613 Ret Mouse small kidney IAGP 5509061 MGI PMID:12783789 Ret Mouse small superior cervical ganglion IAGP 5509061 MGI PMID:11641220 Ret Mouse thyroid gland hyperplasia IAGP 5509061 MGI PMID:10675330 Ret Mouse ureter obstruction IAGP 5509061 MGI PMID:16452504 Ret Mouse ureter stenosis IAGP 5509061 MGI PMID:16452504 Ret Mouse weakness IAGP 5509061 MGI PMID:17553423
(+)-pilocarpine (ISO) (-)-anisomycin (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (EXP) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (EXP) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile (ISO) 4,4'-sulfonyldiphenol (EXP) 4-hydroxyphenyl retinamide (EXP) 5-azacytidine (ISO) 6-propyl-2-thiouracil (ISO) afimoxifene (ISO) aflatoxin B1 (ISO) aldehydo-D-glucose (ISO) aldrin (ISO) all-trans-retinoic acid (ISO) all-trans-retinol (ISO) alpha-Zearalanol (ISO) amitrole (ISO) ammonium chloride (ISO) arsane (ISO) arsenic atom (ISO) atrazine (ISO) benzo[a]pyrene (EXP,ISO) benzo[e]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) bucladesine (ISO) butanal (ISO) cadmium dichloride (ISO) calcitriol (ISO) camptothecin (ISO) chlordecone (EXP) chlorpyrifos (EXP) cisplatin (ISO) clomiphene (ISO) copper(II) sulfate (ISO) coumestrol (ISO) Cuprizon (ISO) cycloheximide (ISO) D-glucose (ISO) dabigatran (ISO) DDD (ISO) DDE (ISO) DDT (ISO) decabromodiphenyl ether (ISO) dexamethasone (ISO) diazinon (ISO) dichromium trioxide (ISO) diclofenac (EXP) dieldrin (ISO) diethylstilbestrol (ISO) dorsomorphin (ISO) endosulfan (ISO) endrin (ISO) Enterolactone (ISO) entinostat (ISO) estrone (ISO) ethanol (EXP,ISO) fonofos (ISO) fulvestrant (ISO) gamma-hexachlorocyclohexane (ISO) genistein (ISO) glucose (ISO) glyphosate (EXP) graphite (ISO) Indeno[1,2,3-cd]pyrene (ISO) irbesartan (ISO) ivermectin (ISO) L-cysteine (ISO) lead diacetate (ISO) lipopolysaccharide (ISO) lithium atom (ISO) lithium hydride (ISO) manganese(II) chloride (ISO) Meclizine (ISO) medroxyprogesterone acetate (ISO) megestrol (ISO) mercury dibromide (ISO) mestranol (ISO) methapyrilene (ISO) Methazolamide (ISO) methimazole (ISO) methylmercury chloride (ISO) methylphenidate (EXP) mifepristone (ISO) N-(3-methyl-5-sulfamoyl-1,3,4-thiadiazol-2-ylidene)acetamide (ISO) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (ISO) nickel atom (ISO) nickel dichloride (ISO) Nor-9-carboxy-delta9-THC (ISO) oxaliplatin (ISO) oxidopamine (EXP) p-chloromercuribenzoic acid (ISO) paracetamol (ISO) parathion (ISO) PCB138 (EXP) pentanal (ISO) perfluorooctanoic acid (ISO) phenethyl caffeate (ISO) phenylmercury acetate (ISO) picene (ISO) pinostrobin (ISO) ponatinib (ISO) propanal (ISO) Ptaquiloside (EXP) raloxifene (ISO) resveratrol (ISO) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) simvastatin (ISO) sodium arsenite (ISO) Soman (ISO) sorafenib (ISO) staurosporine (ISO) sulindac (ISO) tamoxifen (ISO) tebuconazole (ISO) terbufos (ISO) tetrachloromethane (ISO) thapsigargin (ISO) titanium dioxide (EXP) topotecan (ISO) trichostatin A (ISO) triclosan (ISO) triptonide (EXP) tunicamycin (ISO) valproic acid (EXP,ISO) vandetanib (ISO) verapamil (ISO) vorinostat (ISO)
Biological Process
anatomical structure morphogenesis (TAS) brain-derived neurotrophic factor receptor signaling pathway (IEA) cell surface receptor protein tyrosine kinase signaling pathway (IBA,IGI) cellular response to retinoic acid (IEA,ISO) collagen-activated tyrosine kinase receptor signaling pathway (IEA) embryonic epithelial tube formation (IGI) enteric nervous system development (IMP) ephrin receptor signaling pathway (IEA) epidermal growth factor receptor signaling pathway (IEA) fibroblast growth factor receptor signaling pathway (IEA) GDF15-GFRAL signaling pathway (IEA,ISO) glial cell-derived neurotrophic factor receptor signaling pathway (ISO,ISS) hepatocyte growth factor receptor signaling pathway (IEA) homophilic cell adhesion via plasma membrane adhesion molecules (IEA) innervation (IEA,ISO) insulin receptor signaling pathway (IEA) insulin-like growth factor receptor signaling pathway (IEA) Kit signaling pathway (IEA) macrophage colony-stimulating factor signaling pathway (IEA) MAPK cascade (IGI) membrane protein proteolysis (IEA,ISO) nervous system development (IMP) neural crest cell migration (IMP) neuron cell-cell adhesion (IDA,ISO) neuron differentiation (IMP) neuron maturation (IMP) Peyer's patch morphogenesis (IMP) platelet-derived growth factor receptor-alpha signaling pathway (IEA) platelet-derived growth factor receptor-beta signaling pathway (IEA) positive regulation of cell adhesion mediated by integrin (IEA,ISO) positive regulation of cell migration (IEA,ISO) positive regulation of cell size (IMP) positive regulation of DNA-templated transcription (IMP) positive regulation of extrinsic apoptotic signaling pathway in absence of ligand (ISO) positive regulation of gene expression (IMP) positive regulation of MAPK cascade (ISO,ISS) positive regulation of metanephric glomerulus development (IMP) positive regulation of neuron maturation (IEA,ISO) positive regulation of neuron projection development (IEA,ISO) positive regulation of peptidyl-serine phosphorylation of STAT protein (IMP) positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (ISO,ISS) regulation of axonogenesis (IMP) regulation of cell adhesion (ISO) response to pain (IMP) response to xenobiotic stimulus (IEA,ISO) retina development in camera-type eye (IEA,ISO) ureter maturation (IMP) ureteric bud development (IMP) vascular endothelial growth factor receptor-1 signaling pathway (IEA) vascular endothelial growth factor signaling pathway (IEA)
Cellular Component
axon (IBA,IEA,ISO) dendrite (IEA,ISO) early endosome (IEA,ISO) endosome membrane (IEA,ISO) neuronal cell body (IEA,ISO) plasma membrane (IBA,ISO,ISS,TAS) plasma membrane protein complex (IEA,ISO) receptor complex (IBA,ISO)
1.
Up-regulation of GDNFR-alpha and c-ret mRNA in facial motor neurons following facial nerve injury in the rat.
Burazin TC and Gundlach AL, Brain Res Mol Brain Res. 1998 Apr;55(2):331-6.
2.
Genetic mapping of the RET protooncogene on rat chromosome 4.
Canzian F, etal., Mamm Genome 1995 Jun;6(6):433-5.
3.
Time-course of GDNF and its receptor expression after brain injury in the rat.
Cheng Q, etal., Neurosci Lett. 2008 Jul 4;439(1):24-9. Epub 2008 May 1.
4.
Expression of glial cell line-derived neurotrophic factor family members and their receptors in pancreatic cancers.
Ito Y, etal., Surgery. 2005 Oct;138(4):788-94.
5.
Induction of glial cell line-derived neurotrophic factor receptor proteins in cerebral cortex and striatum after permanent middle cerebral artery occlusion in rats.
Kitagawa H, etal., Brain Res. 1999 Jul 10;834(1-2):190-5.
6.
Gene and pseudogene of the mouse cation-dependent mannose 6-phosphate receptor. Genomic organization, expression, and chromosomal localization.
Ludwig T, etal., J Biol Chem 1992 Jun 15;267(17):12211-9.
7.
Regulation of c-Ret, GFRalpha1, and GFRalpha2 in the substantia nigra pars compacta in a rat model of Parkinson's disease.
Marco S, etal., J Neurobiol. 2002 Sep 15;52(4):343-51.
8.
Electronic Transfer of Homolog Data
MGD and Homologene mouse data transfer
9.
MGDs mouse GO annotations
MGD data from the GO Consortium
10.
MGD IEA
MGD IEA
11.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
12.
Mouse chromosomal location of three epithelial sodium channel subunit genes and an apical sodium chloride cotransporter gene.
Pathak BG, etal., Genomics 1996 Apr 1;33(1):124-7.
13.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
14.
Adrenergic differentiation and Ret expression in rat pheochromocytomas.
Powers JF, etal., Endocr Pathol. 2008 Spring;19(1):9-16.
15.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
16.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
17.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
18.
Discordant expression of c-Ret and glial cell line-derived neurotrophic factor receptor alpha-1 mRNAs in response to motor nerve injury in neonate rats.
Tsujino H, etal., Brain Res Mol Brain Res. 1999 Jul 5;70(2):298-303.
19.
RET variants and haplotype analysis in a cohort of Czech patients with Hirschsprung disease.
Vaclavikova E, etal., PLoS One. 2014 Jun 4;9(6):e98957. doi: 10.1371/journal.pone.0098957. eCollection 2014.
20.
Upregulation of glial cell line-derived neurotrophic factor and artemin mRNA in the auditory nerve of deafened rats.
Wissel K, etal., Neuroreport. 2006 Jun 26;17(9):875-8.
21.
The relationship between overexpression of glial cell-derived neurotrophic factor and its RET receptor with progression and prognosis of human pancreatic cancer.
Zeng Q, etal., J Int Med Res. 2008 Jul-Aug;36(4):656-64.
22.
A common RET variant is associated with reduced newborn kidney size and function.
Zhang Z, etal., J Am Soc Nephrol. 2008 Oct;19(10):2027-34. doi: 10.1681/ASN.2007101098.
23.
Diagnosis and surgical treatment of multiple endocrine neoplasia.
Zhou GW, etal., Chin Med J (Engl). 2009 Jul 5;122(13):1495-500.
Ret Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 118,128,709 - 118,174,705 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 118,128,706 - 118,174,679 (-) Ensembl GRCm39 Ensembl GRCm38 6 118,151,748 - 118,197,744 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 118,151,745 - 118,197,718 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 118,101,766 - 118,147,762 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 118,119,472 - 118,162,752 (-) NCBI MGSCv36 mm8 Celera 6 119,974,414 - 120,020,450 (-) NCBI Celera Cytogenetic Map 6 F1 NCBI cM Map 6 55.86 NCBI
RET Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 43,077,069 - 43,130,351 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 43,077,064 - 43,130,351 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 43,572,517 - 43,625,799 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 42,892,523 - 42,945,805 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 42,892,532 - 42,944,955 NCBI Celera 10 39,575,663 - 39,628,954 (+) NCBI Celera Cytogenetic Map 10 q11.21 NCBI HuRef 10 40,098,756 - 40,151,896 (+) NCBI HuRef CHM1_1 10 43,611,715 - 43,665,000 (+) NCBI CHM1_1 T2T-CHM13v2.0 10 43,954,542 - 44,007,848 (+) NCBI T2T-CHM13v2.0
Ret Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 152,998,344 - 153,040,556 (-) NCBI GRCr8 mRatBN7.2 4 151,325,969 - 151,368,176 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 151,326,431 - 151,368,176 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 157,589,266 - 157,631,480 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 153,373,235 - 153,415,450 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 151,996,254 - 152,038,470 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 150,202,170 - 150,249,196 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 150,202,058 - 150,244,372 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 216,130,142 - 216,177,139 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 154,448,179 - 154,491,103 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 154,693,019 - 154,735,944 (-) NCBI Celera 4 140,198,457 - 140,240,663 (-) NCBI Celera Cytogenetic Map 4 q42 NCBI
Ret Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955546 1,221,995 - 1,253,946 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955546 1,221,995 - 1,252,147 (+) NCBI ChiLan1.0 ChiLan1.0
RET Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 55,790,324 - 55,866,889 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 55,795,492 - 55,848,773 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 40,050,396 - 40,103,629 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 43,256,437 - 43,286,340 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 43,249,468 - 43,284,331 (+) Ensembl panpan1.1 panPan2
RET Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 28 3,946,132 - 3,995,505 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 28 3,947,232 - 3,994,210 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 28 4,180,472 - 4,211,554 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 28 4,124,929 - 4,176,146 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 28 4,126,037 - 4,174,867 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 28 3,922,935 - 3,954,018 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 28 3,965,997 - 3,997,076 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 28 4,100,288 - 4,131,400 (-) NCBI UU_Cfam_GSD_1.0
Ret Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 83,803,446 - 83,856,824 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936617 2,927,155 - 2,980,602 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936617 2,927,185 - 2,980,594 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
RET Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 61,305,841 - 61,361,412 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 61,305,818 - 61,361,416 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 66,136,477 - 66,192,220 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
RET Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 38,746,088 - 38,798,773 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 38,769,170 - 38,796,712 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666056 47,691,006 - 47,743,756 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ret
.
Predicted Target Of
Count of predictions: 2159 Count of miRNA genes: 671 Interacting mature miRNAs: 845 Transcripts: ENSMUST00000032201, ENSMUST00000088790 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
4142079 Skmw15_m skeletal muscle weight 15 (mouse) Not determined 6 116829851 149588044 Mouse 10043864 T2dm4sa_m type 2 diabetes mellitus 4 in SMXA RI mice (mouse) Not determined 6 83690851 146954059 Mouse 11252138 Clas1_m carcinogen-induced lung adenoma susceptibility 1 (mouse) 6 112246918 146954059 Mouse 8552704 Cia43_m collagen induced arthritis QTL 43 (mouse) Not determined 6 114159241 119737532 Mouse 1300887 Pabr1_m plasma apolipoprotein B (human) regulator 1 (mouse) Not determined 6 103754405 136400690 Mouse 1301915 Chab3_m cholesterol absorption 3 (mouse) Not determined 6 98908709 132916997 Mouse 1301083 Bhr5_m bronchial hyperresponsiveness 5 (mouse) Not determined 6 115694477 132578150 Mouse 1301658 Radpf3_m radiation pulmonary fibrosis 3 (mouse) Not determined 6 115219814 146330736 Mouse 10043923 Bhr7_m bronchial hyperresponsiveness 7 (mouse) Not determined 6 98219814 132219938 Mouse 4141940 W6q5_m weight 6 weeks QTL 5 (mouse) Not determined 96632912 146535124 Mouse 4140980 Mvwf2_m modifier of von Willebrand factor 2 (mouse) Not determined 114345693 145601739 Mouse 4142259 Tabw2_m tally ho associated body weight 2 (mouse) Not determined 46912919 136400690 Mouse 25314319 Histh6_m histamine hypersensitivity 6 (mouse) 6 48696934 125336963 Mouse 4141295 Rua_m raffinose acetate tasting (mouse) Not determined 115546805 149549364 Mouse 25314320 Histh5_m histamine hypersensitivity 5 (mouse) 6 48696934 148351498 Mouse 1301509 Sluc3_m susceptibility to lung cancer 3 (mouse) Not determined 6 104480321 127019938 Mouse 1301962 Eila2_m ethanol induced locomotor activity 2 (mouse) Not determined 6 48703490 125333748 Mouse 1301262 Gasa3_m gastritis type A susceptibility locus 3 (mouse) Not determined 6 88982366 122982564 Mouse 1301518 Bbaa5_m B.burgdorferi-associated arthritis 5 (mouse) Not determined 6 98483798 145881170 Mouse 11353842 Bmiq4_m body mass index QTL 4 (mouse) 6 92584287 146330736 Mouse 1302131 Bmd8_m bone mineral density 8 (mouse) Not determined 6 99132089 133132228 Mouse 10412157 Fl1n_m fatty liver 1 in NSY (mouse) Not determined 6 45290993 128811995 Mouse 1301744 Hdlq11_m HDL QTL 11 (mouse) Not determined 6 87480321 121480516 Mouse 26884414 Bzwq12_m bi-zygomatic width QTL 12, 16 week (mouse) 6 3400000 139076998 Mouse 1357555 Tesq2_m testis weight QTL 2 (mouse) Not determined 6 96632912 146535124 Mouse 10043891 Tilss4_m TNF-induced lethal shock susceptibility 3 (mouse) Not determined 6 112246918 125333748 Mouse 1301244 Ichs_m immediate cutaneous hypersensitivity QTL (mouse) Not determined 6 90772571 124772807 Mouse 4142416 Egq11_m early growth QTL 11 (mouse) Not determined 96632912 146535124 Mouse 1301923 Lith6_m lithogenic gene 6 (mouse) Not determined 6 98694477 132694676 Mouse 10412207 Cypr5_m cytokine production 5 (mouse) Not determined 6 110815180 144815323 Mouse 1300704 Cia3_m collagen induced arthritis QTL 3 (mouse) Not determined 6 96324286 130324483 Mouse 1301152 Athsq2_m atherosclerosis susceptibility QTL 2 (mouse) Not determined 6 117059949 149588044 Mouse 13463481 Mcvq14_m mean corpuscular volume QTL 14 (mouse) 6 111142448 145142541 Mouse 1301927 Etohcta6_m ethanol conditioned taste aversion 6 (mouse) Not determined 6 115578005 149578150 Mouse 4141194 Cyx_m cycloheximide tasting (mouse) Not determined 115546805 149549364 Mouse 4141064 Ath37_m atherosclerosis 37 (mouse) Not determined 6 116641858 128495988 Mouse 1357806 Aaj3_m anxiety in A/J 3 (mouse) Not determined 6 104480321 136400690 Mouse 13506930 Recrq9_m recombination rate in male meiosis QTL 9 (mouse) 6 73476983 134676963 Mouse 4141699 Ibdq2_m inflammatory bowel disease QTL 2 (mouse) Not determined 105982366 120894102 Mouse 4141889 Qui_m quinine sensitivity, taste (mouse) Not determined 115546805 149549364 Mouse 4141376 Dbm1_m diabetes modifier 1 (mouse) Not determined 6 78606487 121092347 Mouse 1301292 Cfbw2_m cystic fibrosis body weight 2 (mouse) Not determined 6 94981612 128981699 Mouse 11040599 Lmr4b_m leishmaniasis resistance 4b (mouse) 6 96324286 130324483 Mouse
Ret
Mouse Assembly Chr Position (strand) Source JBrowse MGSCv37 6 118,105,327 - 118,105,433 UniSTS GRCm37 Celera 6 119,977,975 - 119,978,081 UniSTS Cytogenetic Map 6 E3-F1 UniSTS cM Map 6 53.2 UniSTS
Ret
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 6 E3-F1 UniSTS
Ret
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 6 E3-F1 UniSTS
Ret
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 6 118,155,309 - 118,155,415 UniSTS GRCm38 MGSCv37 6 118,105,327 - 118,105,433 UniSTS GRCm37 Celera 6 119,977,975 - 119,978,081 UniSTS Cytogenetic Map 6 E3-F1 UniSTS cM Map 6 53.2 UniSTS
Ret
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 6 E3-F1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000032201 ⟹ ENSMUSP00000032201
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 6 118,128,706 - 118,174,094 (-) Ensembl GRCm38.p6 Ensembl 6 118,151,745 - 118,197,133 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000088790 ⟹ ENSMUSP00000086169
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 6 118,131,527 - 118,174,679 (-) Ensembl GRCm38.p6 Ensembl 6 118,154,566 - 118,197,718 (-) Ensembl
RefSeq Acc Id:
NM_001080780 ⟹ NP_001074249
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 118,128,709 - 118,174,705 (-) NCBI GRCm38 6 118,151,748 - 118,197,744 (-) ENTREZGENE MGSCv37 6 118,101,766 - 118,147,762 (-) RGD Celera 6 119,974,414 - 120,020,450 (-) RGD cM Map 6 ENTREZGENE
Sequence:
GACATCATTCTAGACTCTGGGTCTCTGCGAGTATAGGTGACCAGTCGGCCCAGACGCCGAATCTTCTGTGTTGCTCTTTCTGGGCGGCGGGAAAGGACTAACAGAAACAGCAAGCGAGACGCACGGGG
hide sequence
RefSeq Acc Id:
NM_009050 ⟹ NP_033076
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 118,128,709 - 118,174,705 (-) NCBI GRCm38 6 118,151,748 - 118,197,744 (-) ENTREZGENE MGSCv37 6 118,101,766 - 118,147,762 (-) RGD Celera 6 119,974,414 - 120,020,450 (-) RGD cM Map 6 ENTREZGENE
Sequence:
GACATCATTCTAGACTCTGGGTCTCTGCGAGTATAGGTGACCAGTCGGCCCAGACGCCGAATCT
hide sequence
RefSeq Acc Id:
NP_001074249 ⟸ NM_001080780
- Peptide Label:
isoform c precursor
- UniProtKB:
P35546 (UniProtKB/Swiss-Prot)
- Sequence:
MAKATSGAAGLGLKLILLLPLLGEAPLGLYFSRDAYWERLYVDQPAGTPLLYVHALRDAPGEVPSFRLGQHLYGVYRTRLHENDWIRINETTGLLYLNQSLDHSSWEQLSIRNGGFPLLTIFLQVFLG
hide sequence
RefSeq Acc Id:
NP_033076 ⟸ NM_009050
- Peptide Label:
isoform a precursor
- UniProtKB:
Q8BQ34 (UniProtKB/Swiss-Prot), Q9QXH9 (UniProtKB/Swiss-Prot), P35546 (UniProtKB/Swiss-Prot)
- Sequence:
MAKATSGAAGLGLKLILLLPLLGEAPLGLYFSRDAYWERLYVDQPAGTPLLYVHALRDAPGEVP
hide sequence
Ensembl Acc Id:
ENSMUSP00000032201 ⟸ ENSMUST00000032201
Ensembl Acc Id:
ENSMUSP00000086169 ⟸ ENSMUST00000088790
RGD ID: 6890800 Promoter ID: EPDNEW_M8851 Type: initiation region Name: Ret_2 Description: Mus musculus ret proto-oncogene , transcript variant 4, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M8852 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 6 118,197,366 - 118,197,426 EPDNEW
RGD ID: 6890802 Promoter ID: EPDNEW_M8852 Type: single initiation site Name: Ret_1 Description: Mus musculus ret proto-oncogene , transcript variant 4, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M8851 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 6 118,197,676 - 118,197,736 EPDNEW
