Symbol:
Pax6
Name:
paired box 6
RGD ID:
11059
MGI Page
MGI
Description:
Enables several functions, including DNA binding activity; SMAD binding activity; and enzyme binding activity. Involved in several processes, including nervous system development; pancreatic A cell development; and regulation of transcription by RNA polymerase II. Acts upstream of or within several processes, including camera-type eye development; nervous system development; and regulation of neuroblast proliferation. Located in chromatin and nucleus. Is expressed in several structures, including alimentary system; central nervous system; embryo ectoderm; eye; and nose. Used to study Peters anomaly; aniridia; cataract; and juvenile glaucoma. Human ortholog(s) of this gene implicated in bilateral optic nerve hypoplasia; eye disease (multiple); glucose intolerance; and paranoid schizophrenia. Orthologous to human PAX6 (paired box 6).
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
1500038E17Rik; AEY1; AEY11; Dey; Dickie's small eye; Gsfaey; Gsfaey11; oculorhombin; paired box gene 6; paired box protein Pax-6; Pax; Pax-6; Sey; small eye
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PAX6 (paired box 6) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Pax6 (paired box 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pax6 (paired box 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PAX6 (paired box 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PAX6 (paired box 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Pax6 (paired box 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PAX6 (paired box 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PAX6 (paired box 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pax6 (paired box 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Pax6 (paired box 6)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PAX6 (paired box 6)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
pax6a (paired box 6a)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
pax6b (paired box 6b)
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
toy
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
vab-3
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
pax6
Alliance
DIOPT (Ensembl Compara|OMA|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 105,499,241 - 105,528,755 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 105,499,245 - 105,527,709 (+) Ensembl GRCm39 Ensembl GRCm38 2 105,668,896 - 105,698,410 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 105,668,900 - 105,697,364 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 105,516,602 - 105,537,226 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 105,477,284 - 105,497,908 (+) NCBI MGSCv36 mm8 Celera 2 106,897,827 - 106,918,452 (+) NCBI Celera Cytogenetic Map 2 E3 NCBI cM Map 2 55.31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pax6 Mouse (-)-cotinine multiple interactions ISO PAX6 (Homo sapiens) 6480464 [diethyl phosphate co-treated with Cotinine co-treated with bis(2 more ... CTD PMID:37914285 Pax6 Mouse (S)-colchicine multiple interactions ISO PAX6 (Homo sapiens) 6480464 Colchicine promotes the reaction [[4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with LDN 193189] results in increased expression of PAX6 mRNA] CTD PMID:32949729 Pax6 Mouse (S)-nicotine decreases expression ISO Pax6 (Rattus norvegicus) 6480464 Nicotine results in decreased expression of PAX6 mRNA CTD PMID:28555334 Pax6 Mouse 1,2-dimethylhydrazine multiple interactions ISO Pax6 (Rattus norvegicus) 6480464 [APC protein affects the susceptibility to 1 and 2-Dimethylhydrazine] which results in decreased expression of PAX6 mRNA CTD PMID:27840820 Pax6 Mouse 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO PAX6 (Homo sapiens) 6480464 2 more ... CTD PMID:31173147 Pax6 Mouse 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO PAX6 (Homo sapiens) 6480464 2 more ... CTD PMID:31326446 Pax6 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PAX6 mRNA CTD PMID:24058054 and PMID:37172768 Pax6 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PAX6 mRNA CTD PMID:19465110 Pax6 Mouse 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of PAX6 mRNA CTD PMID:20188158 Pax6 Mouse 3H-1,2-dithiole-3-thione increases expression ISO Pax6 (Rattus norvegicus) 6480464 1 and 2-dithiol-3-thione results in increased expression of PAX6 mRNA CTD PMID:19162173 Pax6 Mouse 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of PAX6 mRNA CTD PMID:18648102 Pax6 Mouse 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of PAX6 mRNA CTD PMID:30951980 Pax6 Mouse 4,4'-sulfonyldiphenol affects methylation EXP 6480464 bisphenol S affects the methylation of PAX6 gene CTD PMID:31683443 Pax6 Mouse 4,4'-sulfonyldiphenol decreases methylation ISO PAX6 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of PAX6 gene CTD PMID:31601247 Pax6 Mouse 4,4'-sulfonyldiphenol increases methylation EXP 6480464 bisphenol S results in increased methylation of PAX6 promoter CTD PMID:33297965 Pax6 Mouse 4-hydroxyphenyl retinamide decreases expression ISO PAX6 (Homo sapiens) 6480464 Fenretinide results in decreased expression of PAX6 protein CTD PMID:17110918 Pax6 Mouse 5-aza-2'-deoxycytidine increases expression ISO PAX6 (Homo sapiens) 6480464 Decitabine results in increased expression of PAX6 mRNA CTD PMID:16367923 Pax6 Mouse 5-fluorouracil increases expression EXP 6480464 Fluorouracil results in increased expression of PAX6 protein CTD PMID:21296659 Pax6 Mouse 5-fluorouracil decreases expression ISO PAX6 (Homo sapiens) 6480464 Fluorouracil results in decreased expression of PAX6 mRNA CTD PMID:30518710 Pax6 Mouse 6-propyl-2-thiouracil increases expression ISO Pax6 (Rattus norvegicus) 6480464 Propylthiouracil results in increased expression of PAX6 mRNA CTD PMID:24780913 Pax6 Mouse 9-cis-retinoic acid decreases expression ISO PAX6 (Homo sapiens) 6480464 Alitretinoin results in decreased expression of PAX6 mRNA and Alitretinoin results in decreased expression of PAX6 protein CTD PMID:36805303 Pax6 Mouse abacavir increases expression ISO PAX6 (Homo sapiens) 6480464 abacavir results in increased expression of PAX6 mRNA CTD PMID:31711903 Pax6 Mouse acetaldehyde decreases expression EXP 6480464 Acetaldehyde results in decreased expression of PAX6 mRNA CTD PMID:22634333 Pax6 Mouse acetic acid affects expression EXP 6480464 Acetic Acid affects the expression of PAX6 protein CTD PMID:21296659 Pax6 Mouse aflatoxin B1 decreases methylation ISO PAX6 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of PAX6 gene CTD PMID:27153756 Pax6 Mouse Aflatoxin B2 alpha increases methylation ISO PAX6 (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of PAX6 intron CTD PMID:30157460 Pax6 Mouse aldehydo-D-glucose decreases expression ISO Pax6 (Rattus norvegicus) 6480464 Glucose results in decreased expression of PAX6 mRNA CTD PMID:21818840 Pax6 Mouse aldehydo-D-glucose multiple interactions EXP 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in decreased expression of PAX6 mRNA CTD PMID:37567420 Pax6 Mouse aldicarb multiple interactions ISO PAX6 (Homo sapiens) 6480464 Aldicarb inhibits the reaction [[4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with LDN 193189] results in increased expression of PAX6 mRNA] CTD PMID:32949729 Pax6 Mouse all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of PAX6 mRNA and Tretinoin results in increased expression of PAX6 protein CTD PMID:15996115 more ... Pax6 Mouse all-trans-retinoic acid multiple interactions EXP 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of PAX6 mRNA CTD PMID:36189433 Pax6 Mouse all-trans-retinoic acid multiple interactions ISO PAX6 (Homo sapiens) 6480464 [4-(5-benzo(1 more ... CTD PMID:31711903 and PMID:38070836 Pax6 Mouse all-trans-retinoic acid affects expression ISO PAX6 (Homo sapiens) 6480464 Tretinoin affects the expression of PAX6 mRNA CTD PMID:31600526 Pax6 Mouse all-trans-retinoic acid increases expression ISO PAX6 (Homo sapiens) 6480464 Tretinoin results in increased expression of PAX6 mRNA CTD PMID:31711903 Pax6 Mouse all-trans-retinoic acid decreases expression ISO PAX6 (Homo sapiens) 6480464 Tretinoin results in decreased expression of PAX6 mRNA and Tretinoin results in decreased expression of PAX6 protein CTD PMID:21934132 more ... Pax6 Mouse ammonium chloride affects expression ISO Pax6 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of PAX6 mRNA CTD PMID:16483693 Pax6 Mouse Anatoxin a multiple interactions ISO PAX6 (Homo sapiens) 6480464 anatoxin a promotes the reaction [Tretinoin results in decreased expression of PAX6 mRNA] CTD PMID:38070836 Pax6 Mouse Aroclor 1254 decreases expression ISO PAX6 (Homo sapiens) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of PAX6 mRNA CTD PMID:16934159 Pax6 Mouse arsane decreases expression EXP 6480464 Arsenic results in decreased expression of PAX6 mRNA CTD PMID:24019935 Pax6 Mouse arsenic atom decreases expression EXP 6480464 Arsenic results in decreased expression of PAX6 mRNA CTD PMID:24019935 Pax6 Mouse arsenite(3-) increases methylation ISO PAX6 (Homo sapiens) 6480464 arsenite results in increased methylation of PAX6 promoter CTD PMID:23974009 Pax6 Mouse arsenite(3-) multiple interactions ISO PAX6 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to PAX6 mRNA] CTD PMID:32406909 Pax6 Mouse atrazine decreases expression ISO PAX6 (Homo sapiens) 6480464 Atrazine results in decreased expression of PAX6 mRNA CTD PMID:34146662 Pax6 Mouse atrazine multiple interactions ISO PAX6 (Homo sapiens) 6480464 [Herbicides results in increased abundance of Atrazine] which affects the methylation of PAX6 gene CTD PMID:34516295 Pax6 Mouse Azoxymethane multiple interactions EXP 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of PAX6 mRNA CTD PMID:29950665 Pax6 Mouse benzene decreases expression EXP 6480464 Benzene results in decreased expression of PAX6 mRNA CTD PMID:15120971 and PMID:15122651 Pax6 Mouse benzo[a]pyrene increases expression ISO PAX6 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of PAX6 mRNA CTD PMID:20106945 more ... Pax6 Mouse benzo[a]pyrene decreases expression ISO PAX6 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PAX6 mRNA and Benzo(a)pyrene results in decreased expression of PAX6 protein CTD PMID:30659931 Pax6 Mouse benzo[a]pyrene affects methylation ISO PAX6 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PAX6 5' UTR and Benzo(a)pyrene affects the methylation of PAX6 promoter CTD PMID:27901495 Pax6 Mouse bis(2-ethylhexyl) phthalate multiple interactions ISO PAX6 (Homo sapiens) 6480464 Diethylhexyl Phthalate inhibits the reaction [[4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with LDN 193189] results in increased expression of PAX6 mRNA] CTD PMID:32949729 Pax6 Mouse bis(2-ethylhexyl) phthalate multiple interactions ISO Pax6 (Rattus norvegicus) 6480464 Zinc inhibits the reaction [Diethylhexyl Phthalate results in decreased expression of PAX6 protein] CTD PMID:35841924 Pax6 Mouse bis(2-ethylhexyl) phthalate decreases expression ISO Pax6 (Rattus norvegicus) 6480464 Diethylhexyl Phthalate results in decreased expression of PAX6 protein CTD PMID:25280772 and PMID:35841924 Pax6 Mouse bisphenol A decreases expression ISO PAX6 (Homo sapiens) 6480464 bisphenol A results in decreased expression of PAX6 mRNA CTD PMID:25051057 and PMID:28597690 Pax6 Mouse bisphenol A increases methylation ISO PAX6 (Homo sapiens) 6480464 bisphenol A results in increased methylation of PAX6 gene CTD PMID:31601247 Pax6 Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PAX6 mRNA CTD PMID:30951980 Pax6 Mouse bisphenol A multiple interactions ISO PAX6 (Homo sapiens) 6480464 [bisphenol A co-treated with decabromobiphenyl ether] results in decreased expression of PAX6 mRNA more ... CTD PMID:28597690 and PMID:31400064 Pax6 Mouse bisphenol A increases expression ISO Pax6 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of PAX6 mRNA CTD PMID:30816183 and PMID:32528016 Pax6 Mouse bisphenol A affects methylation EXP 6480464 bisphenol A affects the methylation of PAX6 promoter CTD PMID:27334623 Pax6 Mouse bisphenol A affects expression ISO Pax6 (Rattus norvegicus) 6480464 bisphenol A affects the expression of PAX6 mRNA CTD PMID:25181051 Pax6 Mouse bisphenol A multiple interactions ISO Pax6 (Rattus norvegicus) 6480464 Curcumin inhibits the reaction [bisphenol A results in decreased expression of PAX6 mRNA] CTD PMID:25963729 Pax6 Mouse bisphenol A decreases expression ISO Pax6 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of PAX6 mRNA CTD PMID:25963729 and PMID:34947998 Pax6 Mouse bisphenol F decreases expression EXP 6480464 bisphenol F results in decreased expression of PAX6 mRNA CTD PMID:30951980 Pax6 Mouse bromochloroacetic acid increases expression EXP 6480464 bromochloroacetic acid results in increased expression of PAX6 protein CTD PMID:21296659 Pax6 Mouse bucladesine affects expression ISO PAX6 (Homo sapiens) 6480464 Bucladesine affects the expression of PAX6 mRNA and Bucladesine affects the expression of PAX6 protein CTD PMID:31400064 Pax6 Mouse bucladesine multiple interactions ISO PAX6 (Homo sapiens) 6480464 bisphenol A affects the reaction [Bucladesine affects the expression of PAX6 mRNA] more ... CTD PMID:31400064 Pax6 Mouse butanal increases expression ISO PAX6 (Homo sapiens) 6480464 butyraldehyde results in increased expression of PAX6 mRNA CTD PMID:26079696 Pax6 Mouse C60 fullerene decreases expression ISO Pax6 (Rattus norvegicus) 6480464 fullerene C60 results in decreased expression of PAX6 mRNA CTD PMID:19167457 Pax6 Mouse cadmium atom multiple interactions ISO PAX6 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PAX6 protein CTD PMID:34373904 Pax6 Mouse cadmium dichloride increases expression ISO Pax6 (Rattus norvegicus) 6480464 Cadmium Chloride results in increased expression of PAX6 mRNA and Cadmium Chloride results in increased expression of PAX6 protein CTD PMID:30506660 Pax6 Mouse cadmium dichloride multiple interactions ISO PAX6 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PAX6 protein CTD PMID:34373904 Pax6 Mouse calcium atom affects expression ISO Pax6 (Rattus norvegicus) 6480464 Calcium affects the expression of PAX6 mRNA CTD PMID:15913539 Pax6 Mouse calcium(0) affects expression ISO Pax6 (Rattus norvegicus) 6480464 Calcium affects the expression of PAX6 mRNA CTD PMID:15913539 Pax6 Mouse carbamazepine decreases expression EXP 6480464 Carbamazepine results in decreased expression of PAX6 mRNA CTD PMID:22634333 Pax6 Mouse carbaryl multiple interactions ISO PAX6 (Homo sapiens) 6480464 Carbaryl inhibits the reaction [[4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with LDN 193189] results in increased expression of PAX6 mRNA] CTD PMID:32949729 Pax6 Mouse carbofuran decreases expression ISO Pax6 (Rattus norvegicus) 6480464 Carbofuran results in decreased expression of PAX6 mRNA CTD PMID:28982980 Pax6 Mouse CHIR 99021 increases expression ISO PAX6 (Homo sapiens) 6480464 Chir 99021 results in increased expression of PAX6 mRNA CTD PMID:31711903 Pax6 Mouse CHIR 99021 multiple interactions ISO PAX6 (Homo sapiens) 6480464 [4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with Tretinoin] promotes the reaction [Chir 99021 results in increased expression of PAX6 mRNA] CTD PMID:31711903 Pax6 Mouse CHIR-98014 decreases expression ISO PAX6 (Homo sapiens) 6480464 Chir 98014 results in decreased expression of PAX6 mRNA CTD PMID:22723015 Pax6 Mouse chlorpyrifos multiple interactions ISO PAX6 (Homo sapiens) 6480464 U 0126 inhibits the reaction [Chlorpyrifos results in increased expression of PAX6 mRNA] CTD PMID:28112198 Pax6 Mouse chlorpyrifos decreases expression ISO PAX6 (Homo sapiens) 6480464 Chlorpyrifos results in decreased expression of PAX6 mRNA CTD PMID:28112198 Pax6 Mouse choline multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of PAX6 gene CTD PMID:20938992 Pax6 Mouse crocidolite asbestos increases expression EXP 6480464 Asbestos and Crocidolite results in increased expression of PAX6 mRNA CTD PMID:29279043 Pax6 Mouse Cuprizon increases expression ISO Pax6 (Rattus norvegicus) 6480464 Cuprizone results in increased expression of PAX6 mRNA CTD PMID:26577399 Pax6 Mouse curcumin multiple interactions ISO Pax6 (Rattus norvegicus) 6480464 Curcumin inhibits the reaction [bisphenol A results in decreased expression of PAX6 mRNA] CTD PMID:25963729 Pax6 Mouse curcumin increases expression ISO Pax6 (Rattus norvegicus) 6480464 Curcumin results in increased expression of PAX6 mRNA CTD PMID:25963729 Pax6 Mouse cyclosporin A increases expression ISO PAX6 (Homo sapiens) 6480464 Cyclosporine results in increased expression of PAX6 mRNA CTD PMID:20106945 and PMID:25562108 Pax6 Mouse cyproconazole increases expression EXP 6480464 cyproconazole results in increased expression of PAX6 mRNA CTD PMID:22045034 Pax6 Mouse cytarabine increases expression ISO PAX6 (Homo sapiens) 6480464 Cytarabine results in increased expression of PAX6 mRNA CTD PMID:21198554 Pax6 Mouse cytarabine decreases expression ISO PAX6 (Homo sapiens) 6480464 Cytarabine results in decreased expression of PAX6 protein CTD PMID:21198554 Pax6 Mouse D-glucose decreases expression ISO Pax6 (Rattus norvegicus) 6480464 Glucose results in decreased expression of PAX6 mRNA CTD PMID:21818840 Pax6 Mouse D-glucose multiple interactions EXP 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in decreased expression of PAX6 mRNA CTD PMID:37567420 Pax6 Mouse dabigatran increases expression ISO PAX6 (Homo sapiens) 6480464 Dabigatran results in increased expression of PAX6 mRNA CTD PMID:31711903 Pax6 Mouse DDT multiple interactions ISO PAX6 (Homo sapiens) 6480464 DDT inhibits the reaction [[4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with LDN 193189] results in increased expression of PAX6 mRNA] CTD PMID:32949729 Pax6 Mouse decabromodiphenyl ether increases expression ISO Pax6 (Rattus norvegicus) 6480464 decabromobiphenyl ether results in increased expression of PAX6 mRNA CTD PMID:23640034 Pax6 Mouse decabromodiphenyl ether decreases expression ISO PAX6 (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of PAX6 mRNA CTD PMID:28597690 Pax6 Mouse decabromodiphenyl ether multiple interactions ISO PAX6 (Homo sapiens) 6480464 [bisphenol A co-treated with decabromobiphenyl ether] results in decreased expression of PAX6 mRNA CTD PMID:28597690 Pax6 Mouse decabromodiphenyl ether increases expression ISO PAX6 (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of PAX6 mRNA CTD PMID:31326446 Pax6 Mouse dexamethasone decreases expression ISO PAX6 (Homo sapiens) 6480464 Dexamethasone results in decreased expression of PAX6 protein CTD PMID:34742744 Pax6 Mouse dexamethasone increases expression ISO PAX6 (Homo sapiens) 6480464 Dexamethasone results in increased expression of PAX6 mRNA CTD PMID:34742744 Pax6 Mouse dextran sulfate multiple interactions EXP 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of PAX6 mRNA CTD PMID:29950665 Pax6 Mouse diazinon decreases methylation ISO PAX6 (Homo sapiens) 6480464 Diazinon results in decreased methylation of PAX6 gene CTD PMID:22964155 Pax6 Mouse diclofenac increases expression EXP 6480464 Diclofenac results in increased expression of PAX6 mRNA CTD PMID:26934552 Pax6 Mouse dieldrin multiple interactions ISO PAX6 (Homo sapiens) 6480464 Dieldrin inhibits the reaction [[4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with LDN 193189] results in increased expression of PAX6 mRNA] CTD PMID:32949729 Pax6 Mouse diethyl hydrogen phosphate multiple interactions ISO PAX6 (Homo sapiens) 6480464 [diethyl phosphate co-treated with Cotinine co-treated with bis(2 more ... CTD PMID:37914285 Pax6 Mouse dimethylarsinic acid multiple interactions EXP 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of PAX6 mRNA CTD PMID:34876320 Pax6 Mouse dioxygen decreases expression ISO PAX6 (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of PAX6 mRNA CTD PMID:24236059 Pax6 Mouse dorsomorphin multiple interactions ISO PAX6 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Pax6 Mouse doxorubicin increases expression ISO PAX6 (Homo sapiens) 6480464 Doxorubicin results in increased expression of PAX6 mRNA CTD PMID:16404146 Pax6 Mouse elemental selenium multiple interactions ISO PAX6 (Homo sapiens) 6480464 [diethyl phosphate co-treated with Cotinine co-treated with bis(2 more ... CTD PMID:37914285 Pax6 Mouse entinostat decreases expression ISO PAX6 (Homo sapiens) 6480464 entinostat results in decreased expression of PAX6 mRNA CTD PMID:26272509 Pax6 Mouse entinostat multiple interactions ISO PAX6 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PAX6 mRNA CTD PMID:27188386 Pax6 Mouse ethanol increases expression EXP 6480464 Ethanol results in increased expression of PAX6 mRNA CTD PMID:30319688 Pax6 Mouse ethanol affects expression EXP 6480464 Ethanol affects the expression of PAX6 mRNA CTD PMID:30319688 Pax6 Mouse ethosuximide increases expression ISO Pax6 (Rattus norvegicus) 6480464 Ethosuximide results in increased expression of PAX6 mRNA CTD PMID:26420483 Pax6 Mouse ethosuximide multiple interactions ISO Pax6 (Rattus norvegicus) 6480464 Ethosuximide inhibits the reaction [APP protein modified form results in decreased expression of PAX6 mRNA] CTD PMID:26420483 Pax6 Mouse flusilazole increases expression EXP 6480464 flusilazole results in increased expression of PAX6 mRNA CTD PMID:22634333 Pax6 Mouse folic acid multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of PAX6 gene CTD PMID:20938992 Pax6 Mouse folic acid decreases expression ISO PAX6 (Homo sapiens) 6480464 Folic Acid results in decreased expression of PAX6 protein CTD PMID:34742744 Pax6 Mouse folic acid increases expression EXP 6480464 Folic Acid results in increased expression of PAX6 mRNA CTD PMID:25006883 Pax6 Mouse fructose multiple interactions EXP 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in decreased expression of PAX6 mRNA CTD PMID:37567420 Pax6 Mouse gamma-hexachlorocyclohexane multiple interactions ISO PAX6 (Homo sapiens) 6480464 Hexachlorocyclohexane inhibits the reaction [[4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with LDN 193189] results in increased expression of PAX6 mRNA] CTD PMID:32949729 Pax6 Mouse glucose decreases expression ISO Pax6 (Rattus norvegicus) 6480464 Glucose results in decreased expression of PAX6 mRNA CTD PMID:21818840 Pax6 Mouse glucose multiple interactions EXP 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in decreased expression of PAX6 mRNA CTD PMID:37567420 Pax6 Mouse glyphosate multiple interactions EXP 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in decreased expression of PAX6 mRNA CTD PMID:37567420 Pax6 Mouse glyphosate affects expression ISO PAX6 (Homo sapiens) 6480464 Glyphosate affects the expression of PAX6 mRNA CTD PMID:35485992 Pax6 Mouse heptachlor multiple interactions ISO PAX6 (Homo sapiens) 6480464 Heptachlor inhibits the reaction [[4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with LDN 193189] results in increased expression of PAX6 mRNA] CTD PMID:32949729 Pax6 Mouse herbicide multiple interactions ISO PAX6 (Homo sapiens) 6480464 [Herbicides results in increased abundance of Atrazine] which affects the methylation of PAX6 gene CTD PMID:34516295 Pax6 Mouse hexachlorophene multiple interactions ISO PAX6 (Homo sapiens) 6480464 Hexachlorophene inhibits the reaction [[4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with LDN 193189] results in increased expression of PAX6 mRNA] CTD PMID:32949729 Pax6 Mouse hexachlorophene decreases expression EXP 6480464 Hexachlorophene results in decreased expression of PAX6 mRNA and Hexachlorophene results in decreased expression of PAX6 protein CTD PMID:25943520 Pax6 Mouse isotretinoin increases expression ISO PAX6 (Homo sapiens) 6480464 Isotretinoin results in increased expression of PAX6 mRNA CTD PMID:31711903 Pax6 Mouse L-methionine multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of PAX6 gene CTD PMID:20938992 Pax6 Mouse lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of PAX6 mRNA CTD PMID:22609695 Pax6 Mouse lead(0) decreases expression ISO PAX6 (Homo sapiens) 6480464 Lead results in decreased expression of PAX6 mRNA and Lead results in decreased expression of PAX6 protein CTD PMID:24519525 more ... Pax6 Mouse lipopolysaccharide multiple interactions ISO PAX6 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Pax6 Mouse lipopolysaccharide increases expression ISO PAX6 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of PAX6 mRNA CTD PMID:35811015 Pax6 Mouse lumiracoxib multiple interactions EXP 6480464 lumiracoxib affects the reaction [Crotoxin results in increased expression of PAX6 protein] CTD PMID:36702313 Pax6 Mouse maneb multiple interactions EXP 6480464 [LRRK2 protein mutant form co-treated with Maneb co-treated with Paraquat] results in decreased expression of PAX6 mRNA CTD PMID:23017109 Pax6 Mouse mercury atom multiple interactions ISO PAX6 (Homo sapiens) 6480464 [diethyl phosphate co-treated with Cotinine co-treated with bis(2 more ... CTD PMID:37914285 Pax6 Mouse mercury dibromide decreases expression ISO PAX6 (Homo sapiens) 6480464 mercuric bromide results in decreased expression of PAX6 mRNA CTD PMID:26272509 Pax6 Mouse mercury dibromide multiple interactions ISO PAX6 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PAX6 mRNA CTD PMID:27188386 Pax6 Mouse mercury(0) multiple interactions ISO PAX6 (Homo sapiens) 6480464 [diethyl phosphate co-treated with Cotinine co-treated with bis(2 more ... CTD PMID:37914285 Pax6 Mouse methylarsonic acid multiple interactions EXP 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of PAX6 mRNA CTD PMID:34876320 Pax6 Mouse methylmercury chloride affects expression EXP 6480464 methylmercuric chloride affects the expression of PAX6 mRNA CTD PMID:22555245 Pax6 Mouse methylmercury chloride increases expression ISO PAX6 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of PAX6 mRNA CTD PMID:23179753 Pax6 Mouse methylmercury chloride decreases expression ISO PAX6 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of PAX6 mRNA CTD PMID:22555245 and PMID:28001369 Pax6 Mouse mono(2-ethylhexyl) phthalate increases expression ISO PAX6 (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of PAX6 mRNA CTD PMID:31711903 Pax6 Mouse mono(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of PAX6 mRNA CTD PMID:36189433 Pax6 Mouse Morroniside increases expression ISO Pax6 (Rattus norvegicus) 6480464 morroniside results in increased expression of PAX6 protein CTD PMID:24876057 Pax6 Mouse N-ethyl-N-nitrosourea increases mutagenesis EXP 6480464 Ethylnitrosourea results in increased mutagenesis of PAX6 exon more ... CTD PMID:16303964 and PMID:16724327 Pax6 Mouse nicotine decreases expression ISO Pax6 (Rattus norvegicus) 6480464 Nicotine results in decreased expression of PAX6 mRNA CTD PMID:28555334 Pax6 Mouse nilotinib increases expression ISO PAX6 (Homo sapiens) 6480464 nilotinib results in increased expression of PAX6 mRNA CTD PMID:31711903 Pax6 Mouse p-chloromercuribenzoic acid decreases expression ISO PAX6 (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in decreased expression of PAX6 mRNA CTD PMID:26272509 Pax6 Mouse panobinostat decreases expression ISO PAX6 (Homo sapiens) 6480464 panobinostat results in decreased expression of PAX6 mRNA CTD PMID:26272509 Pax6 Mouse panobinostat multiple interactions ISO PAX6 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PAX6 mRNA CTD PMID:27188386 Pax6 Mouse paraquat multiple interactions EXP 6480464 [LRRK2 protein mutant form co-treated with Maneb co-treated with Paraquat] results in decreased expression of PAX6 mRNA CTD PMID:23017109 Pax6 Mouse paraquat multiple interactions ISO PAX6 (Homo sapiens) 6480464 Paraquat affects the reaction [Bucladesine affects the expression of PAX6 mRNA] and Paraquat affects the reaction [Bucladesine affects the expression of PAX6 protein] CTD PMID:31400064 Pax6 Mouse paraquat decreases expression ISO PAX6 (Homo sapiens) 6480464 Paraquat results in decreased expression of PAX6 mRNA and Paraquat results in decreased expression of PAX6 protein CTD PMID:30698896 Pax6 Mouse perfluorooctanoic acid increases activity ISO PAX6 (Homo sapiens) 6480464 perfluorooctanoic acid results in increased activity of PAX6 protein CTD PMID:27589886 Pax6 Mouse phenylmercury acetate decreases expression ISO PAX6 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of PAX6 mRNA CTD PMID:26272509 Pax6 Mouse phenylmercury acetate multiple interactions ISO PAX6 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PAX6 mRNA CTD PMID:27188386 Pax6 Mouse phenytoin increases expression ISO PAX6 (Homo sapiens) 6480464 Phenytoin results in increased expression of PAX6 mRNA CTD PMID:31711903 Pax6 Mouse potassium chromate increases expression ISO PAX6 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of PAX6 mRNA CTD PMID:22714537 Pax6 Mouse propanal increases expression ISO PAX6 (Homo sapiens) 6480464 propionaldehyde results in increased expression of PAX6 mRNA CTD PMID:26079696 Pax6 Mouse propiconazole decreases expression EXP 6480464 propiconazole results in decreased expression of PAX6 mRNA CTD PMID:21278054 Pax6 Mouse rotenone multiple interactions ISO PAX6 (Homo sapiens) 6480464 Rotenone inhibits the reaction [[4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with LDN 193189] results in increased expression of PAX6 mRNA] CTD PMID:32949729 Pax6 Mouse rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of PAX6 protein CTD PMID:35919817 Pax6 Mouse S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO PAX6 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Pax6 Mouse SB 431542 multiple interactions ISO PAX6 (Homo sapiens) 6480464 [4-(5-benzo(1 more ... CTD PMID:27188386 more ... Pax6 Mouse selenium atom multiple interactions ISO PAX6 (Homo sapiens) 6480464 [diethyl phosphate co-treated with Cotinine co-treated with bis(2 more ... CTD PMID:37914285 Pax6 Mouse silicon dioxide decreases expression EXP 6480464 Silicon Dioxide results in decreased expression of PAX6 mRNA CTD PMID:19073995 and PMID:29203145 Pax6 Mouse silver atom decreases expression EXP 6480464 Silver results in decreased expression of PAX6 mRNA CTD PMID:27131904 Pax6 Mouse silver(0) decreases expression EXP 6480464 Silver results in decreased expression of PAX6 mRNA CTD PMID:27131904 Pax6 Mouse sodium arsenate multiple interactions EXP 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of PAX6 mRNA CTD PMID:34876320 Pax6 Mouse sodium arsenite decreases expression ISO PAX6 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PAX6 mRNA CTD PMID:22714537 Pax6 Mouse sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of PAX6 mRNA CTD PMID:37682722 Pax6 Mouse sodium arsenite multiple interactions EXP 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of PAX6 mRNA CTD PMID:34876320 Pax6 Mouse sodium arsenite increases expression ISO PAX6 (Homo sapiens) 6480464 sodium arsenite results in increased expression of PAX6 mRNA CTD PMID:28595984 Pax6 Mouse T-2 toxin increases expression EXP 6480464 T-2 Toxin results in increased expression of PAX6 mRNA CTD PMID:26314264 Pax6 Mouse tert-butyl hydroperoxide decreases expression ISO PAX6 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of PAX6 mRNA CTD PMID:15336504 Pax6 Mouse Tetrachlorobisphenol A increases expression ISO PAX6 (Homo sapiens) 6480464 tetrachlorodian results in increased expression of PAX6 mRNA CTD PMID:31326446 Pax6 Mouse thalidomide increases expression ISO PAX6 (Homo sapiens) 6480464 Thalidomide results in increased expression of PAX6 mRNA CTD PMID:31711903 Pax6 Mouse thapsigargin decreases expression ISO Pax6 (Rattus norvegicus) 6480464 Thapsigargin results in decreased expression of PAX6 protein CTD PMID:35544339 Pax6 Mouse titanium dioxide multiple interactions EXP 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of PAX6 mRNA CTD PMID:29950665 Pax6 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of PAX6 gene and titanium dioxide results in decreased methylation of PAX6 promoter alternative form CTD PMID:35295148 Pax6 Mouse trichloroethene increases expression ISO Pax6 (Rattus norvegicus) 6480464 Trichloroethylene results in increased expression of PAX6 mRNA CTD PMID:33387578 Pax6 Mouse trichostatin A decreases expression ISO PAX6 (Homo sapiens) 6480464 trichostatin A results in decreased expression of PAX6 mRNA CTD PMID:22723015 more ... Pax6 Mouse trichostatin A multiple interactions ISO PAX6 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PAX6 mRNA CTD PMID:27188386 Pax6 Mouse trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of PAX6 mRNA CTD PMID:35537566 Pax6 Mouse urethane increases expression ISO PAX6 (Homo sapiens) 6480464 Urethane results in increased expression of PAX6 mRNA CTD PMID:28818685 Pax6 Mouse valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of PAX6 mRNA CTD PMID:17292431 and PMID:22045034 Pax6 Mouse valproic acid multiple interactions ISO PAX6 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PAX6 mRNA CTD PMID:27188386 Pax6 Mouse valproic acid decreases expression ISO PAX6 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of PAX6 mRNA CTD PMID:22723015 more ... Pax6 Mouse valproic acid increases expression ISO PAX6 (Homo sapiens) 6480464 Valproic Acid results in increased expression of PAX6 mRNA CTD PMID:24849673 more ... Pax6 Mouse vismodegib increases expression EXP 6480464 HhAntag691 results in increased expression of PAX6 mRNA CTD PMID:27585885 Pax6 Mouse zinc atom decreases expression ISO PAX6 (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of PAX6 mRNA CTD PMID:18356318 Pax6 Mouse zinc atom multiple interactions ISO Pax6 (Rattus norvegicus) 6480464 Zinc inhibits the reaction [Diethylhexyl Phthalate results in decreased expression of PAX6 protein] CTD PMID:35841924 Pax6 Mouse zinc(0) decreases expression ISO PAX6 (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of PAX6 mRNA CTD PMID:18356318 Pax6 Mouse zinc(0) multiple interactions ISO Pax6 (Rattus norvegicus) 6480464 Zinc inhibits the reaction [Diethylhexyl Phthalate results in decreased expression of PAX6 protein] CTD PMID:35841924
Imported Annotations - KEGG (archival)
Pax6 Mouse abnormal Ammon gyrus morphology IAGP 5509061 MGI PMID:15917450 Pax6 Mouse abnormal anterior eye segment morphology IAGP 5509061 MGI PMID:11481423 Pax6 Mouse abnormal anterior eye segment morphology IAGP 5509061 MGI PMID:19563798 Pax6 Mouse abnormal Bowman membrane morphology IAGP 5509061 MGI PMID:12714618 Pax6 Mouse abnormal brain commissure morphology IAGP 5509061 MGI PMID:9232602 Pax6 Mouse abnormal brain commissure morphology IAGP 5509061 MGI PMID:15917450 Pax6 Mouse abnormal brain development IAGP 5509061 MGI PMID:17942732 Pax6 Mouse abnormal brain internal capsule morphology IAGP 5509061 MGI PMID:19500363 Pax6 Mouse abnormal brain morphology IAGP 5509061 MGI PMID:15917450 Pax6 Mouse abnormal cell cycle IAGP 5509061 MGI PMID:24523460 Pax6 Mouse abnormal cell cycle checkpoint function IAGP 5509061 MGI PMID:24523460 Pax6 Mouse abnormal cerebellar granule cell morphology IAGP 5509061 MGI PMID:16289327 Pax6 Mouse abnormal cerebellum external granule cell layer morphology IAGP 5509061 MGI PMID:16289327 Pax6 Mouse abnormal cerebellum morphology IAGP 5509061 MGI PMID:16289327 Pax6 Mouse abnormal cerebellum vermis morphology IAGP 5509061 MGI PMID:16289327 Pax6 Mouse abnormal cerebral cortex morphology IAGP 5509061 MGI PMID:16979618 Pax6 Mouse abnormal cerebral cortex morphology IAGP 5509061 MGI PMID:15917450 Pax6 Mouse abnormal ciliary body morphology IAGP 5509061 MGI PMID:19563798 Pax6 Mouse abnormal CNS synaptic transmission IAGP 5509061 MGI PMID:16525473 Pax6 Mouse abnormal cornea anterior stroma morphology IAGP 5509061 MGI PMID:12714618 Pax6 Mouse abnormal cornea endothelium morphology IAGP 5509061 MGI PMID:9166583 Pax6 Mouse abnormal cornea endothelium morphology IAGP 5509061 MGI PMID:17064680 Pax6 Mouse abnormal cornea epithelium morphology IAGP 5509061 MGI PMID:4972360 Pax6 Mouse abnormal cornea epithelium morphology IAGP 5509061 MGI PMID:12692153 Pax6 Mouse abnormal cornea morphology IAGP 5509061 MGI PMID:12714618 Pax6 Mouse abnormal cornea morphology IAGP 5509061 MGI PMID:17064680 Pax6 Mouse abnormal cornea morphology IAGP 5509061 MGI PMID:9166583 Pax6 Mouse abnormal cornea stroma morphology IAGP 5509061 MGI PMID:12714618 Pax6 Mouse abnormal cornea stroma morphology IAGP 5509061 MGI PMID:20538882 Pax6 Mouse abnormal cornea stroma morphology IAGP 5509061 MGI PMID:9166583 Pax6 Mouse abnormal cornea stroma morphology IAGP 5509061 MGI PMID:11983873 Pax6 Mouse abnormal cornea stroma morphology IAGP 5509061 MGI PMID:12692153 Pax6 Mouse abnormal cortical plate morphology IAGP 5509061 MGI PMID:23515312 Pax6 Mouse abnormal cortical ventricular zone morphology IAGP 5509061 MGI PMID:19474196 Pax6 Mouse abnormal craniofacial bone morphology IAGP 5509061 MGI PMID:9363853 Pax6 Mouse abnormal craniofacial development IAGP 5509061 MGI PMID:11779807 Pax6 Mouse abnormal craniofacial morphology IAGP 5509061 MGI PMID:11779807 Pax6 Mouse abnormal diencephalon morphology IAGP 5509061 MGI PMID:15917450 Pax6 Mouse abnormal embryonic/fetal subventricular zone morphology IAGP 5509061 MGI PMID:15548580 Pax6 Mouse abnormal embryonic/fetal subventricular zone morphology IAGP 5509061 MGI PMID:15917450 Pax6 Mouse abnormal endocrine pancreas development IAGP 5509061 MGI PMID:18199433 Pax6 Mouse abnormal eye anterior chamber morphology IAGP 5509061 MGI PMID:11481423 Pax6 Mouse abnormal eye anterior chamber morphology IAGP 5509061 MGI PMID:9166583 Pax6 Mouse abnormal eye anterior chamber morphology IAGP 5509061 MGI PMID:12714618 Pax6 Mouse abnormal eye development IAGP 5509061 MGI PMID:11076764 Pax6 Mouse abnormal eye development IAGP 5509061 MGI PMID:23515312 Pax6 Mouse abnormal eye morphology IAGP 5509061 MGI PMID:11929848 Pax6 Mouse abnormal eye morphology IAGP 5509061 MGI PMID:23592925 Pax6 Mouse abnormal eye morphology IAGP 5509061 MGI PMID:19500363 Pax6 Mouse abnormal eye physiology IAGP 5509061 MGI PMID:24523460 Pax6 Mouse abnormal eye size IAGP 5509061 MGI PMID:23592925 Pax6 Mouse abnormal face development IAGP 5509061 MGI PMID:3794606 Pax6 Mouse abnormal facial morphology IAGP 5509061 MGI PMID:19500363 Pax6 Mouse abnormal forebrain development IAGP 5509061 MGI PMID:15548580 Pax6 Mouse abnormal forebrain morphology IAGP 5509061 MGI PMID:9232602 Pax6 Mouse abnormal forebrain morphology IAGP 5509061 MGI PMID:19474196 Pax6 Mouse abnormal hormone level IAGP 5509061 MGI PMID:9224716 Pax6 Mouse abnormal hormone level IAGP 5509061 MGI PMID:19034419 Pax6 Mouse abnormal intraocular muscle morphology IAGP 5509061 MGI PMID:19563798 Pax6 Mouse abnormal iridocorneal angle IAGP 5509061 MGI PMID:20538882 Pax6 Mouse abnormal iridocorneal angle IAGP 5509061 MGI PMID:17064680 Pax6 Mouse abnormal iris morphology IAGP 5509061 MGI PMID:11062307 Pax6 Mouse abnormal iris morphology IAGP 5509061 MGI PMID:19563798 Pax6 Mouse abnormal iris morphology IAGP 5509061 MGI PMID:11779807 Pax6 Mouse abnormal iris morphology IAGP 5509061 MGI PMID:11983873 Pax6 Mouse abnormal iris stroma morphology IAGP 5509061 MGI PMID:20538882 Pax6 Mouse abnormal lacrimal gland morphology IAGP 5509061 MGI PMID:22240097 Pax6 Mouse abnormal lateral nasal prominence morphology IAGP 5509061 MGI PMID:11779807 Pax6 Mouse abnormal lens development IAGP 5509061 MGI PMID:11481423 Pax6 Mouse abnormal lens development IAGP 5509061 MGI PMID:19570848 Pax6 Mouse abnormal lens development IAGP 5509061 MGI PMID:11076764 Pax6 Mouse abnormal lens development IAGP 5509061 MGI PMID:103464 Pax6 Mouse abnormal lens epithelium morphology IAGP 5509061 MGI PMID:4972360 Pax6 Mouse abnormal lens epithelium morphology IAGP 5509061 MGI PMID:19570848 Pax6 Mouse abnormal lens epithelium morphology IAGP 5509061 MGI PMID:11714668 Pax6 Mouse abnormal lens epithelium morphology IAGP 5509061 MGI PMID:11983873 Pax6 Mouse abnormal lens fiber morphology IAGP 5509061 MGI PMID:11481423 Pax6 Mouse abnormal lens fiber morphology IAGP 5509061 MGI PMID:22240097 Pax6 Mouse abnormal lens fiber morphology IAGP 5509061 MGI PMID:19570848 Pax6 Mouse abnormal lens fiber morphology IAGP 5509061 MGI PMID:11714668 Pax6 Mouse abnormal lens induction IAGP 5509061 MGI PMID:9851982 Pax6 Mouse abnormal lens morphology IAGP 5509061 MGI PMID:11481423 Pax6 Mouse abnormal lens morphology IAGP 5509061 MGI PMID:24523460 Pax6 Mouse abnormal lens morphology IAGP 5509061 MGI PMID:22240097 Pax6 Mouse abnormal lens morphology IAGP 5509061 MGI PMID:19570848 Pax6 Mouse abnormal lens morphology IAGP 5509061 MGI PMID:19563798 Pax6 Mouse abnormal lens morphology IAGP 5509061 MGI PMID:17140559 Pax6 Mouse abnormal lens morphology IAGP 5509061 MGI PMID:11714668 Pax6 Mouse abnormal lens morphology IAGP 5509061 MGI PMID:9166583 Pax6 Mouse abnormal lens morphology IAGP 5509061 MGI PMID:11983873 Pax6 Mouse abnormal lens vesicle development IAGP 5509061 MGI PMID:11481423 Pax6 Mouse abnormal lens vesicle development IAGP 5509061 MGI PMID:11714668 Pax6 Mouse abnormal lens vesicle development IAGP 5509061 MGI PMID:17064680 Pax6 Mouse abnormal lens vesicle development IAGP 5509061 MGI PMID:9166583 Pax6 Mouse abnormal lens vesicle development IAGP 5509061 MGI PMID:7789273 Pax6 Mouse abnormal lens vesicle development IAGP 5509061 MGI PMID:12714618 Pax6 Mouse abnormal lens vesicle development IAGP 5509061 MGI PMID:7035547 Pax6 Mouse abnormal liver morphology IEA 5509061 MGI Pax6 Mouse abnormal maxillary shelf morphology IAGP 5509061 MGI PMID:3794606 Pax6 Mouse abnormal medial nasal prominence morphology IAGP 5509061 MGI PMID:11779807 Pax6 Mouse abnormal mitosis IAGP 5509061 MGI PMID:24523460 Pax6 Mouse abnormal nasal bone morphology IAGP 5509061 MGI PMID:3794606 Pax6 Mouse abnormal nasal capsule morphology IAGP 5509061 MGI PMID:9363853 Pax6 Mouse abnormal nasal cavity morphology IAGP 5509061 MGI PMID:1684639 Pax6 Mouse abnormal neocortex morphology IAGP 5509061 MGI PMID:23643363 Pax6 Mouse abnormal neuron differentiation IAGP 5509061 MGI PMID:16950124 Pax6 Mouse abnormal neuron differentiation IAGP 5509061 MGI PMID:15548580 Pax6 Mouse abnormal neuron number IAGP 5509061 MGI PMID:23643363 Pax6 Mouse abnormal neuron physiology IAGP 5509061 MGI PMID:16525473 Pax6 Mouse abnormal neuronal precursor cell number IAGP 5509061 MGI PMID:23643363 Pax6 Mouse abnormal neuronal precursor proliferation IAGP 5509061 MGI PMID:23515312 Pax6 Mouse abnormal nose morphology IAGP 5509061 MGI PMID:7649798 Pax6 Mouse abnormal olfactory epithelium morphology IAGP 5509061 MGI PMID:11074448 Pax6 Mouse abnormal olfactory nerve morphology IAGP 5509061 MGI PMID:11074448 Pax6 Mouse abnormal optic cup morphology IAGP 5509061 MGI PMID:11069887 Pax6 Mouse abnormal optic cup morphology IAGP 5509061 MGI PMID:24523460 Pax6 Mouse abnormal optic cup morphology IAGP 5509061 MGI PMID:1684639 Pax6 Mouse abnormal optic nerve morphology IAGP 5509061 MGI PMID:7649798 Pax6 Mouse abnormal optic nerve morphology IAGP 5509061 MGI PMID:20538882 Pax6 Mouse abnormal optic placode morphology IAGP 5509061 MGI PMID:11714668 Pax6 Mouse abnormal optic placode morphology IAGP 5509061 MGI PMID:24523460 Pax6 Mouse abnormal optic vesicle formation IAGP 5509061 MGI PMID:9232602 Pax6 Mouse abnormal optic vesicle formation IAGP 5509061 MGI PMID:11069887 Pax6 Mouse abnormal optic vesicle formation IAGP 5509061 MGI PMID:7789273 Pax6 Mouse abnormal pallium development IAGP 5509061 MGI PMID:11124115 Pax6 Mouse abnormal pancreas morphology IAGP 5509061 MGI PMID:19034419 Pax6 Mouse abnormal placenta morphology IEA 5509061 MGI Pax6 Mouse abnormal placenta vasculature IEA 5509061 MGI Pax6 Mouse abnormal postnatal subventricular zone morphology IAGP 5509061 MGI PMID:19474196 Pax6 Mouse abnormal pretectal region morphology IAGP 5509061 MGI PMID:15917450 Pax6 Mouse abnormal pupil morphology IAGP 5509061 MGI PMID:11983873 Pax6 Mouse abnormal pupil morphology IAGP 5509061 MGI PMID:11779807 Pax6 Mouse abnormal respiratory system development IAGP 5509061 MGI PMID:7789273 Pax6 Mouse abnormal retina development IAGP 5509061 MGI PMID:23515312 Pax6 Mouse abnormal retina development IAGP 5509061 MGI PMID:24523460 Pax6 Mouse abnormal retina ganglion layer morphology IEA 5509061 MGI Pax6 Mouse abnormal retina layer morphology IAGP 5509061 MGI PMID:24523460 Pax6 Mouse abnormal retina morphology IAGP 5509061 MGI PMID:4972360 Pax6 Mouse abnormal retina morphology IAGP 5509061 MGI PMID:11983873 Pax6 Mouse abnormal retina photoreceptor layer morphology IAGP 5509061 MGI PMID:4972360 Pax6 Mouse abnormal retina pigment epithelium morphology IAGP 5509061 MGI PMID:4972360 Pax6 Mouse abnormal retina pigment epithelium morphology IAGP 5509061 MGI PMID:22792072 Pax6 Mouse abnormal retina pigment epithelium morphology IAGP 5509061 MGI PMID:19563798 Pax6 Mouse abnormal retina pigment epithelium morphology IAGP 5509061 MGI PMID:103464 Pax6 Mouse abnormal retina progenitor cell morphology IAGP 5509061 MGI PMID:24523460 Pax6 Mouse abnormal submandibular gland morphology IAGP 5509061 MGI PMID:11731698 Pax6 Mouse abnormal synaptic transmission IAGP 5509061 MGI PMID:14762144 Pax6 Mouse abnormal tectum morphology IAGP 5509061 MGI PMID:15917450 Pax6 Mouse abnormal telencephalon development IAGP 5509061 MGI PMID:15548580 Pax6 Mouse abnormal telencephalon development IAGP 5509061 MGI PMID:23515312 Pax6 Mouse abnormal telencephalon development IAGP 5509061 MGI PMID:19500363 Pax6 Mouse abnormal telencephalon morphology IAGP 5509061 MGI PMID:15548580 Pax6 Mouse abnormal telencephalon morphology IAGP 5509061 MGI PMID:19500363 Pax6 Mouse abnormal telencephalon morphology IAGP 5509061 MGI PMID:15917450 Pax6 Mouse abnormal thalamus morphology IAGP 5509061 MGI PMID:15917450 Pax6 Mouse abnormal ventral interneuron 0 morphology IAGP 5509061 MGI PMID:16525473 Pax6 Mouse abnormal ventral interneuron 1 morphology IAGP 5509061 MGI PMID:14762144 Pax6 Mouse abnormal ventral interneuron 1 morphology IAGP 5509061 MGI PMID:16525473 Pax6 Mouse abnormal ventral interneuron 3 morphology IAGP 5509061 MGI PMID:16525473 Pax6 Mouse abnormal ventral interneuron morphology IAGP 5509061 MGI PMID:16525473 Pax6 Mouse abnormal vitreous body morphology IAGP 5509061 MGI PMID:9166583 Pax6 Mouse abnormal vitreous body morphology IAGP 5509061 MGI PMID:19563798 Pax6 Mouse absent amacrine cells IAGP 5509061 MGI PMID:24523460 Pax6 Mouse absent choroid plexus IAGP 5509061 MGI PMID:15917450 Pax6 Mouse absent ciliary body IAGP 5509061 MGI PMID:19563798 Pax6 Mouse absent diencephalon IAGP 5509061 MGI PMID:15917450 Pax6 Mouse absent external nares IAGP 5509061 MGI PMID:11062307 Pax6 Mouse absent eye anterior chamber IAGP 5509061 MGI PMID:20538882 Pax6 Mouse absent hippocampus IAGP 5509061 MGI PMID:15917450 Pax6 Mouse absent lens vesicle IAGP 5509061 MGI PMID:7789273 Pax6 Mouse absent lens vesicle IAGP 5509061 MGI PMID:24523460 Pax6 Mouse absent nasal pit IAGP 5509061 MGI PMID:3794606 Pax6 Mouse absent nasal placodes IAGP 5509061 MGI PMID:7789273 Pax6 Mouse absent olfactory bulb IAGP 5509061 MGI PMID:9163426 Pax6 Mouse absent olfactory bulb IAGP 5509061 MGI PMID:3794606 Pax6 Mouse absent optic placodes IAGP 5509061 MGI PMID:11069887 Pax6 Mouse absent pancreatic alpha cells IAGP 5509061 MGI PMID:9163426 Pax6 Mouse absent pancreatic alpha cells IAGP 5509061 MGI PMID:9224716 Pax6 Mouse absent pancreatic beta cells IAGP 5509061 MGI PMID:9224716 Pax6 Mouse absent Schlemm's canal IAGP 5509061 MGI PMID:20538882 Pax6 Mouse absent snout IAGP 5509061 MGI PMID:3794606 Pax6 Mouse absent trabecular meshwork IAGP 5509061 MGI PMID:20538882 Pax6 Mouse aniridia IAGP 5509061 MGI PMID:11983873 Pax6 Mouse aniridia IAGP 5509061 MGI PMID:2173141 Pax6 Mouse anophthalmia IAGP 5509061 MGI PMID:7649798 Pax6 Mouse anophthalmia IAGP 5509061 MGI PMID:23592925 Pax6 Mouse anophthalmia IAGP 5509061 MGI PMID:1684639 Pax6 Mouse anophthalmia IAGP 5509061 MGI PMID:3794606 Pax6 Mouse anophthalmia IAGP 5509061 MGI PMID:9163426 Pax6 Mouse anophthalmia IAGP 5509061 MGI PMID:11062307 Pax6 Mouse anophthalmia IAGP 5509061 MGI PMID:7035547 Pax6 Mouse anophthalmia IAGP 5509061 MGI PMID:11779807 Pax6 Mouse anterior iris synechia IAGP 5509061 MGI PMID:12714618 Pax6 Mouse anterior iris synechia IAGP 5509061 MGI PMID:17064680 Pax6 Mouse anterior iris synechia IAGP 5509061 MGI PMID:11779807 Pax6 Mouse anterior iris synechia IAGP 5509061 MGI PMID:10886015 Pax6 Mouse anterior iris synechia IAGP 5509061 MGI PMID:20538882 Pax6 Mouse anterior polar cataract IAGP 5509061 MGI PMID:10886015 Pax6 Mouse anterior polar cataract IAGP 5509061 MGI PMID:9166583 Pax6 Mouse anterior polar cataract IAGP 5509061 MGI PMID:6877261 Pax6 Mouse anterior polar cataract IAGP 5509061 MGI PMID:11779807 Pax6 Mouse aphakia IAGP 5509061 MGI PMID:3794606 Pax6 Mouse aphakia IAGP 5509061 MGI PMID:24523460 Pax6 Mouse belly spot IAGP 5509061 MGI PMID:103464 Pax6 Mouse belly spot IAGP 5509061 MGI PMID:3794606 Pax6 Mouse blindness IAGP 5509061 MGI PMID:23592925 Pax6 Mouse cataract IAGP 5509061 MGI PMID:7035547 Pax6 Mouse cataract IAGP 5509061 MGI PMID:19570848 Pax6 Mouse cataract IAGP 5509061 MGI PMID:19563798 Pax6 Mouse cataract IAGP 5509061 MGI PMID:11779807 Pax6 Mouse cataract IAGP 5509061 MGI PMID:16303964 Pax6 Mouse cataract IAGP 5509061 MGI PMID:10886015 Pax6 Mouse cataract IAGP 5509061 MGI PMID:103464 Pax6 Mouse cleft palate IEA 5509061 MGI Pax6 Mouse coloboma IAGP 5509061 MGI PMID:103464 Pax6 Mouse coloboma IAGP 5509061 MGI PMID:22240097 Pax6 Mouse coloboma IAGP 5509061 MGI PMID:9166583 Pax6 Mouse coloboma IAGP 5509061 MGI PMID:3794606 Pax6 Mouse cornea opacity IAGP 5509061 MGI PMID:11062307 Pax6 Mouse cornea opacity IAGP 5509061 MGI PMID:19474196 Pax6 Mouse cornea opacity IAGP 5509061 MGI PMID:16303964 Pax6 Mouse cornea opacity IAGP 5509061 MGI PMID:6877261 Pax6 Mouse cornea vascularization IAGP 5509061 MGI PMID:17051153 Pax6 Mouse cornea vascularization IAGP 5509061 MGI PMID:17064680 Pax6 Mouse cornea vascularization IAGP 5509061 MGI PMID:12714618 Pax6 Mouse corneal-lenticular stalk IAGP 5509061 MGI PMID:16303964 Pax6 Mouse corneal-lenticular stalk IAGP 5509061 MGI PMID:23515312 Pax6 Mouse corneal-lenticular stalk IAGP 5509061 MGI PMID:23592925 Pax6 Mouse corneal-lenticular stalk IAGP 5509061 MGI PMID:22240097 Pax6 Mouse decreased adrenocorticotropin level IAGP 5509061 MGI PMID:19034419 Pax6 Mouse decreased birth body size IEA 5509061 MGI Pax6 Mouse decreased body length IEA 5509061 MGI Pax6 Mouse decreased body size IAGP 5509061 MGI PMID:103464 Pax6 Mouse decreased body size IAGP 5509061 MGI PMID:3794606 Pax6 Mouse decreased cell proliferation IAGP 5509061 MGI PMID:24523460 Pax6 Mouse decreased circulating growth hormone level IAGP 5509061 MGI PMID:10451227 Pax6 Mouse decreased circulating insulin level IAGP 5509061 MGI PMID:15110714 Pax6 Mouse decreased cornea epithelium thickness IAGP 5509061 MGI PMID:12692153 Pax6 Mouse decreased cornea epithelium thickness IAGP 5509061 MGI PMID:12714618 Pax6 Mouse decreased cornea epithelium thickness IAGP 5509061 MGI PMID:17051153 Pax6 Mouse decreased embryo size IAGP 5509061 MGI PMID:3794606 Pax6 Mouse decreased eye pigmentation IAGP 5509061 MGI PMID:3794606 Pax6 Mouse decreased fetal size IAGP 5509061 MGI PMID:103464 Pax6 Mouse decreased pancreatic alpha cell number IAGP 5509061 MGI PMID:15110714 Pax6 Mouse decreased pancreatic beta cell number IAGP 5509061 MGI PMID:15110714 Pax6 Mouse decreased total retina thickness IAGP 5509061 MGI PMID:24523460 Pax6 Mouse delayed eyelid fusion IAGP 5509061 MGI PMID:11481423 Pax6 Mouse developmental cataract IEA 5509061 MGI Pax6 Mouse disorganized pancreatic islets IAGP 5509061 MGI PMID:9163426 Pax6 Mouse ectopic Purkinje cell IAGP 5509061 MGI PMID:16289327 Pax6 Mouse embryonic lethality before implantation, incomplete penetrance IEA 5509061 MGI Pax6 Mouse embryonic lethality between implantation and somite formation, complete penetrance IAGP 5509061 MGI PMID:103464 Pax6 Mouse embryonic lethality, complete penetrance IAGP 5509061 MGI PMID:3794606 Pax6 Mouse embryonic lethality, incomplete penetrance IEA 5509061 MGI Pax6 Mouse exencephaly IAGP 5509061 MGI PMID:103464 Pax6 Mouse eye opacity IAGP 5509061 MGI PMID:19474196 Pax6 Mouse facial cleft IEA 5509061 MGI Pax6 Mouse fused cornea and lens IAGP 5509061 MGI PMID:7035547 Pax6 Mouse fused cornea and lens IAGP 5509061 MGI PMID:6877261 Pax6 Mouse fused cornea and lens IAGP 5509061 MGI PMID:19474196 Pax6 Mouse fused cornea and lens IAGP 5509061 MGI PMID:9166583 Pax6 Mouse fused cornea and lens IAGP 5509061 MGI PMID:16303964 Pax6 Mouse fused cornea and lens IAGP 5509061 MGI PMID:11929848 Pax6 Mouse fused cornea and lens IAGP 5509061 MGI PMID:20538882 Pax6 Mouse fused cornea and lens IAGP 5509061 MGI PMID:103464 Pax6 Mouse hyperactivity IEA 5509061 MGI Pax6 Mouse hyperglycemia IAGP 5509061 MGI PMID:15110714 Pax6 Mouse hypopigmentation IAGP 5509061 MGI PMID:103464 Pax6 Mouse impaired glucose tolerance IAGP 5509061 MGI PMID:19034419 Pax6 Mouse impaired pupillary reflex IAGP 5509061 MGI PMID:19563798 Pax6 Mouse increased alimentary system tumor incidence IAGP 5509061 MGI PMID:17660683 Pax6 Mouse increased circulating ketone body level IAGP 5509061 MGI PMID:15110714 Pax6 Mouse increased cornea thickness IAGP 5509061 MGI PMID:19570848 Pax6 Mouse increased intestinal adenoma incidence IAGP 5509061 MGI PMID:17660683 Pax6 Mouse increased lens epithelium apoptosis IAGP 5509061 MGI PMID:19570848 Pax6 Mouse increased opacity of vitreous body IAGP 5509061 MGI PMID:19563798 Pax6 Mouse increased retina apoptosis IAGP 5509061 MGI PMID:24523460 Pax6 Mouse increased stomach tumor incidence IAGP 5509061 MGI PMID:17660683 Pax6 Mouse increased susceptibility to induced pancreatitis IAGP 5509061 MGI PMID:17660683 Pax6 Mouse increased tumor incidence IAGP 5509061 MGI PMID:17660683 Pax6 Mouse iris hypoplasia IAGP 5509061 MGI PMID:103464 Pax6 Mouse iris hypoplasia IAGP 5509061 MGI PMID:19563798 Pax6 Mouse iris hypoplasia IAGP 5509061 MGI PMID:11983873 Pax6 Mouse iris hypoplasia IAGP 5509061 MGI PMID:12714618 Pax6 Mouse irregularly shaped pupil IAGP 5509061 MGI PMID:11779807 Pax6 Mouse irregularly shaped pupil IAGP 5509061 MGI PMID:19563798 Pax6 Mouse lowered ear position IAGP 5509061 MGI PMID:3794606 Pax6 Mouse microphthalmia IAGP 5509061 MGI PMID:11481423 Pax6 Mouse microphthalmia IAGP 5509061 MGI PMID:24523460 Pax6 Mouse microphthalmia IAGP 5509061 MGI PMID:23592925 Pax6 Mouse microphthalmia IAGP 5509061 MGI PMID:22240097 Pax6 Mouse microphthalmia IAGP 5509061 MGI PMID:19474196 Pax6 Mouse microphthalmia IAGP 5509061 MGI PMID:20538882 Pax6 Mouse microphthalmia IAGP 5509061 MGI PMID:19570848 Pax6 Mouse microphthalmia IAGP 5509061 MGI PMID:19563798 Pax6 Mouse microphthalmia IAGP 5509061 MGI PMID:1684639 Pax6 Mouse microphthalmia IAGP 5509061 MGI PMID:9166583 Pax6 Mouse microphthalmia IAGP 5509061 MGI PMID:16303964 Pax6 Mouse microphthalmia IAGP 5509061 MGI PMID:10886015 Pax6 Mouse microphthalmia IAGP 5509061 MGI PMID:11779807 Pax6 Mouse microphthalmia IAGP 5509061 MGI PMID:11929848 Pax6 Mouse microphthalmia IAGP 5509061 MGI PMID:12714618 Pax6 Mouse microphthalmia IAGP 5509061 MGI PMID:3794606 Pax6 Mouse microphthalmia IAGP 5509061 MGI PMID:103464 Pax6 Mouse microphthalmia IAGP 5509061 MGI PMID:11062307 Pax6 Mouse mydriasis IAGP 5509061 MGI PMID:11983873 Pax6 Mouse mydriasis IAGP 5509061 MGI PMID:19563798 Pax6 Mouse neonatal lethality, complete penetrance IAGP 5509061 MGI PMID:10451227 Pax6 Mouse neonatal lethality, complete penetrance IAGP 5509061 MGI PMID:1684639 Pax6 Mouse neonatal lethality, complete penetrance IAGP 5509061 MGI PMID:9163426 Pax6 Mouse neonatal lethality, incomplete penetrance IAGP 5509061 MGI PMID:103464 Pax6 Mouse no abnormal phenotype detected IAGP 5509061 MGI PMID:19500363 Pax6 Mouse ocular hypertension IAGP 5509061 MGI PMID:20538882 Pax6 Mouse optic nerve degeneration IAGP 5509061 MGI PMID:20538882 Pax6 Mouse optic nerve hypoplasia IAGP 5509061 MGI PMID:20538882 Pax6 Mouse perinatal lethality, complete penetrance IAGP 5509061 MGI PMID:7649798 Pax6 Mouse perinatal lethality, complete penetrance IAGP 5509061 MGI PMID:23592925 Pax6 Mouse perinatal lethality, incomplete penetrance IAGP 5509061 MGI PMID:3794606 Pax6 Mouse postnatal growth retardation IAGP 5509061 MGI PMID:15110714 Pax6 Mouse postnatal lethality, complete penetrance IAGP 5509061 MGI PMID:11779807 Pax6 Mouse postnatal lethality, complete penetrance IAGP 5509061 MGI PMID:15110714 Pax6 Mouse postnatal lethality, incomplete penetrance IEA 5509061 MGI Pax6 Mouse premature death IAGP 5509061 MGI PMID:17660683 Pax6 Mouse prenatal lethality, complete penetrance IAGP 5509061 MGI PMID:11062307 Pax6 Mouse prenatal lethality, incomplete penetrance IEA 5509061 MGI Pax6 Mouse preweaning lethality, complete penetrance IEA 5509061 MGI Pax6 Mouse reduced female fertility IAGP 5509061 MGI PMID:3794606 Pax6 Mouse respiratory failure IAGP 5509061 MGI PMID:7649798 Pax6 Mouse retina fold IAGP 5509061 MGI PMID:3794606 Pax6 Mouse retina fold IAGP 5509061 MGI PMID:103464 Pax6 Mouse retina hypoplasia IAGP 5509061 MGI PMID:19563798 Pax6 Mouse retina hypoplasia IAGP 5509061 MGI PMID:24523460 Pax6 Mouse short snout IAGP 5509061 MGI PMID:1684639 Pax6 Mouse small ears IAGP 5509061 MGI PMID:3794606 Pax6 Mouse small lens IAGP 5509061 MGI PMID:103464 Pax6 Mouse small lens IAGP 5509061 MGI PMID:23592925 Pax6 Mouse small lens IAGP 5509061 MGI PMID:20538882 Pax6 Mouse small lens IAGP 5509061 MGI PMID:19570848 Pax6 Mouse small lens IAGP 5509061 MGI PMID:19563798 Pax6 Mouse small lens IAGP 5509061 MGI PMID:3794606 Pax6 Mouse small liver IEA 5509061 MGI Pax6 Mouse small thalamus IAGP 5509061 MGI PMID:15917450 Pax6 Mouse submandibular gland hypoplasia IAGP 5509061 MGI PMID:11731698 Pax6 Mouse supernumerary incisors IAGP 5509061 MGI PMID:9363853 Pax6 Mouse telencephalon hypoplasia IAGP 5509061 MGI PMID:19474196 Pax6 Mouse thin cerebral cortex IAGP 5509061 MGI PMID:16979618 Pax6 Mouse thin cortical plate IAGP 5509061 MGI PMID:15548580 Pax6 Mouse thin cortical plate IAGP 5509061 MGI PMID:23515312 Pax6 Mouse white spotting IEA 5509061 MGI
(-)-cotinine (ISO) (S)-colchicine (ISO) (S)-nicotine (ISO) 1,2-dimethylhydrazine (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 3,4-methylenedioxymethamphetamine (EXP) 3H-1,2-dithiole-3-thione (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (EXP,ISO) 6-propyl-2-thiouracil (ISO) 9-cis-retinoic acid (ISO) abacavir (ISO) acetaldehyde (EXP) acetic acid (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) aldehydo-D-glucose (EXP,ISO) aldicarb (ISO) all-trans-retinoic acid (EXP,ISO) ammonium chloride (ISO) Anatoxin a (ISO) Aroclor 1254 (ISO) arsane (EXP) arsenic atom (EXP) arsenite(3-) (ISO) atrazine (ISO) Azoxymethane (EXP) benzene (EXP) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) bromochloroacetic acid (EXP) bucladesine (ISO) butanal (ISO) C60 fullerene (ISO) cadmium atom (ISO) cadmium dichloride (ISO) calcium atom (ISO) calcium(0) (ISO) carbamazepine (EXP) carbaryl (ISO) carbofuran (ISO) CHIR 99021 (ISO) CHIR-98014 (ISO) chlorpyrifos (ISO) choline (EXP) crocidolite asbestos (EXP) Cuprizon (ISO) curcumin (ISO) cyclosporin A (ISO) cyproconazole (EXP) cytarabine (ISO) D-glucose (EXP,ISO) dabigatran (ISO) DDT (ISO) decabromodiphenyl ether (ISO) dexamethasone (ISO) dextran sulfate (EXP) diazinon (ISO) diclofenac (EXP) dieldrin (ISO) diethyl hydrogen phosphate (ISO) dimethylarsinic acid (EXP) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (ISO) elemental selenium (ISO) entinostat (ISO) ethanol (EXP) ethosuximide (ISO) flusilazole (EXP) folic acid (EXP,ISO) fructose (EXP) gamma-hexachlorocyclohexane (ISO) glucose (EXP,ISO) glyphosate (EXP,ISO) heptachlor (ISO) herbicide (ISO) hexachlorophene (EXP,ISO) isotretinoin (ISO) L-methionine (EXP) lead diacetate (EXP) lead(0) (ISO) lipopolysaccharide (ISO) lumiracoxib (EXP) maneb (EXP) mercury atom (ISO) mercury dibromide (ISO) mercury(0) (ISO) methylarsonic acid (EXP) methylmercury chloride (EXP,ISO) mono(2-ethylhexyl) phthalate (EXP,ISO) Morroniside (ISO) N-ethyl-N-nitrosourea (EXP) nicotine (ISO) nilotinib (ISO) p-chloromercuribenzoic acid (ISO) panobinostat (ISO) paraquat (EXP,ISO) perfluorooctanoic acid (ISO) phenylmercury acetate (ISO) phenytoin (ISO) potassium chromate (ISO) propanal (ISO) propiconazole (EXP) rotenone (EXP,ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) selenium atom (ISO) silicon dioxide (EXP) silver atom (EXP) silver(0) (EXP) sodium arsenate (EXP) sodium arsenite (EXP,ISO) T-2 toxin (EXP) tert-butyl hydroperoxide (ISO) Tetrachlorobisphenol A (ISO) thalidomide (ISO) thapsigargin (ISO) titanium dioxide (EXP) trichloroethene (ISO) trichostatin A (ISO) trovafloxacin (EXP) urethane (ISO) valproic acid (EXP,ISO) vismodegib (EXP) zinc atom (ISO) zinc(0) (ISO)
Biological Process
anterior/posterior pattern specification (IGI,IMP) astrocyte differentiation (IMP,ISO) axon guidance (IMP) axonogenesis (IMP) blood vessel development (IEA,ISO) brain development (IBA,IMP) camera-type eye development (IGI,IMP) cell differentiation (IMP) cell fate commitment (IGI,IMP) cell fate determination (IMP) cell population proliferation (IMP) cellular response to fibroblast growth factor stimulus (IEA,ISO) cellular response to glucose stimulus (IEA,ISO) cellular response to insulin stimulus (IEA,ISO) cellular response to leukemia inhibitory factor (IEP) cellular response to prostaglandin E stimulus (IEA,ISO) cellular response to xenobiotic stimulus (IEA,ISO) cerebellum development (IEA,ISO) cerebral cortex development (IMP) cerebral cortex regionalization (IMP) chromatin remodeling (IMP) commitment of neuronal cell to specific neuron type in forebrain (IMP) cornea development in camera-type eye (IEA,ISO) dorsal/ventral axis specification (IMP) dorsal/ventral pattern formation (IMP) embryonic camera-type eye morphogenesis (IGI) epithelial cell development (ISO) epithelial cell differentiation (IMP) establishment of mitotic spindle orientation (IMP) eye photoreceptor cell development (IMP) forebrain development (IBA,IMP) forebrain dorsal/ventral pattern formation (IMP) forebrain-midbrain boundary formation (IMP) gene expression (IMP) glucose homeostasis (ISO) habenula development (IMP) hindbrain development (ISO) insulin metabolic process (IEA,ISO) interkinetic nuclear migration (IEA,ISO) iris morphogenesis (IEA,ISO) keratinocyte differentiation (IMP) lacrimal gland development (IMP) learned vocalization behavior or vocal learning (IEA,ISO) lens development in camera-type eye (IMP) negative regulation of epithelial cell proliferation (IMP) negative regulation of neural precursor cell proliferation (IMP) negative regulation of neuroblast proliferation (IMP) negative regulation of neuron differentiation (IGI) negative regulation of protein phosphorylation (IMP) negative regulation of transcription by RNA polymerase II (IDA) nervous system development (IMP,ISO) neural crest cell migration (IEA,ISO) neural precursor cell proliferation (IMP,ISO) neuroblast proliferation (IMP) neuron differentiation (IGI,IMP) neuron migration (IMP,ISO) olfactory bulb development (ISO) olfactory bulb mitral cell layer development (IEA,ISO) oligodendrocyte cell fate specification (IMP) pallium development (IMP) pancreatic A cell development (IMP,ISO) pancreatic A cell differentiation (ISO) pituitary gland development (IMP) positive regulation of cell fate specification (IEA,ISO) positive regulation of DNA-templated transcription (IDA,ISO) positive regulation of epithelial cell differentiation (IMP) positive regulation of gene expression (IMP,ISO) positive regulation of glutamatergic neuron differentiation (IEA,ISO) positive regulation of miRNA transcription (IEA,ISO) positive regulation of neuroblast proliferation (IMP) positive regulation of neuron migration (IEA,ISO) positive regulation of response to biotic stimulus (ISO) positive regulation of transcription by RNA polymerase II (IDA,IGI,IMP,ISO) protein localization to organelle (IMP) protein phosphorylation (IMP) regionalization (IMP) regulation of asymmetric cell division (IMP) regulation of cell migration (IMP) regulation of DNA-templated transcription (TAS) regulation of gene expression (IMP) regulation of neurogenesis (IMP,ISO) regulation of neuron differentiation (IMP,ISO) regulation of neuron projection development (IEA,ISO) regulation of timing of cell differentiation (IMP) regulation of transcription by RNA polymerase II (IBA,IMP) response to ethanol (IEA,ISO) response to wounding (IEA) retina development in camera-type eye (IBA,IGI,ISO) rhombomere morphogenesis (IEA,ISO) salivary gland morphogenesis (IMP) sensory neuron migration (IEA,ISO) sensory organ development (IBA) signal transduction involved in regulation of gene expression (IDA) smoothened signaling pathway (IDA) somatic motor neuron fate commitment (IMP) spinal cord development (ISO) spinal cord motor neuron cell fate specification (IMP) telencephalon regionalization (IMP) transcription by RNA polymerase II (IGI) type B pancreatic cell differentiation (IBA,IMP,ISO) ventral spinal cord development (IMP) ventral spinal cord interneuron specification (IMP) visual perception (IMP)
Molecular Function
chromatin binding (IDA) chromatin DNA binding (IDA) co-SMAD binding (IDA) DNA binding (IDA) DNA-binding transcription activator activity, RNA polymerase II-specific (IDA,ISO) DNA-binding transcription factor activity (IDA,TAS) DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,IDA,ISO) DNA-binding transcription repressor activity, RNA polymerase II-specific (IDA) double-stranded DNA binding (ISO) histone acetyltransferase binding (IDA) HMG box domain binding (IPI) minor groove of adenine-thymine-rich DNA binding (IEA,ISO) protein binding (IPI) protein kinase binding (IPI) R-SMAD binding (IDA,ISO) RNA binding (IDA) RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,IDA,ISO) RNA polymerase II core promoter sequence-specific DNA binding (IDA) sequence-specific DNA binding (IDA,ISO) sequence-specific double-stranded DNA binding (ISO) transcription cis-regulatory region binding (IDA) transcription coregulator binding (IPI) ubiquitin protein ligase binding (IPI)
Mammalian Phenotype
abnormal Ammon gyrus morphology (IAGP) abnormal anterior eye segment morphology (IAGP) abnormal Bowman membrane morphology (IAGP) abnormal brain commissure morphology (IAGP) abnormal brain development (IAGP) abnormal brain internal capsule morphology (IAGP) abnormal brain morphology (IAGP) abnormal cell cycle (IAGP) abnormal cell cycle checkpoint function (IAGP) abnormal cerebellar granule cell morphology (IAGP) abnormal cerebellum external granule cell layer morphology (IAGP) abnormal cerebellum morphology (IAGP) abnormal cerebellum vermis morphology (IAGP) abnormal cerebral cortex morphology (IAGP) abnormal ciliary body morphology (IAGP) abnormal CNS synaptic transmission (IAGP) abnormal cornea anterior stroma morphology (IAGP) abnormal cornea endothelium morphology (IAGP) abnormal cornea epithelium morphology (IAGP) abnormal cornea morphology (IAGP) abnormal cornea stroma morphology (IAGP) abnormal cortical plate morphology (IAGP) abnormal cortical ventricular zone morphology (IAGP) abnormal craniofacial bone morphology (IAGP) abnormal craniofacial development (IAGP) abnormal craniofacial morphology (IAGP) abnormal diencephalon morphology (IAGP) abnormal embryonic/fetal subventricular zone morphology (IAGP) abnormal endocrine pancreas development (IAGP) abnormal eye anterior chamber morphology (IAGP) abnormal eye development (IAGP) abnormal eye morphology (IAGP) abnormal eye physiology (IAGP) abnormal eye size (IAGP) abnormal face development (IAGP) abnormal facial morphology (IAGP) abnormal forebrain development (IAGP) abnormal forebrain morphology (IAGP) abnormal hormone level (IAGP) abnormal intraocular muscle morphology (IAGP) abnormal iridocorneal angle (IAGP) abnormal iris morphology (IAGP) abnormal iris stroma morphology (IAGP) abnormal lacrimal gland morphology (IAGP) abnormal lateral nasal prominence morphology (IAGP) abnormal lens development (IAGP) abnormal lens epithelium morphology (IAGP) abnormal lens fiber morphology (IAGP) abnormal lens induction (IAGP) abnormal lens morphology (IAGP) abnormal lens vesicle development (IAGP) abnormal liver morphology (IEA) abnormal maxillary shelf morphology (IAGP) abnormal medial nasal prominence morphology (IAGP) abnormal mitosis (IAGP) abnormal nasal bone morphology (IAGP) abnormal nasal capsule morphology (IAGP) abnormal nasal cavity morphology (IAGP) abnormal neocortex morphology (IAGP) abnormal neuron differentiation (IAGP) abnormal neuron number (IAGP) abnormal neuron physiology (IAGP) abnormal neuronal precursor cell number (IAGP) abnormal neuronal precursor proliferation (IAGP) abnormal nose morphology (IAGP) abnormal olfactory epithelium morphology (IAGP) abnormal olfactory nerve morphology (IAGP) abnormal optic cup morphology (IAGP) abnormal optic nerve morphology (IAGP) abnormal optic placode morphology (IAGP) abnormal optic vesicle formation (IAGP) abnormal pallium development (IAGP) abnormal pancreas morphology (IAGP) abnormal placenta morphology (IEA) abnormal placenta vasculature (IEA) abnormal postnatal subventricular zone morphology (IAGP) abnormal pretectal region morphology (IAGP) abnormal pupil morphology (IAGP) abnormal respiratory system development (IAGP) abnormal retina development (IAGP) abnormal retina ganglion layer morphology (IEA) abnormal retina layer morphology (IAGP) abnormal retina morphology (IAGP) abnormal retina photoreceptor layer morphology (IAGP) abnormal retina pigment epithelium morphology (IAGP) abnormal retina progenitor cell morphology (IAGP) abnormal submandibular gland morphology (IAGP) abnormal synaptic transmission (IAGP) abnormal tectum morphology (IAGP) abnormal telencephalon development (IAGP) abnormal telencephalon morphology (IAGP) abnormal thalamus morphology (IAGP) abnormal ventral interneuron 0 morphology (IAGP) abnormal ventral interneuron 1 morphology (IAGP) abnormal ventral interneuron 3 morphology (IAGP) abnormal ventral interneuron morphology (IAGP) abnormal vitreous body morphology (IAGP) absent amacrine cells (IAGP) absent choroid plexus (IAGP) absent ciliary body (IAGP) absent diencephalon (IAGP) absent external nares (IAGP) absent eye anterior chamber (IAGP) absent hippocampus (IAGP) absent lens vesicle (IAGP) absent nasal pit (IAGP) absent nasal placodes (IAGP) absent olfactory bulb (IAGP) absent optic placodes (IAGP) absent pancreatic alpha cells (IAGP) absent pancreatic beta cells (IAGP) absent Schlemm's canal (IAGP) absent snout (IAGP) absent trabecular meshwork (IAGP) aniridia (IAGP) anophthalmia (IAGP) anterior iris synechia (IAGP) anterior polar cataract (IAGP) aphakia (IAGP) belly spot (IAGP) blindness (IAGP) cataract (IAGP) cleft palate (IEA) coloboma (IAGP) cornea opacity (IAGP) cornea vascularization (IAGP) corneal-lenticular stalk (IAGP) decreased adrenocorticotropin level (IAGP) decreased birth body size (IEA) decreased body length (IEA) decreased body size (IAGP) decreased cell proliferation (IAGP) decreased circulating growth hormone level (IAGP) decreased circulating insulin level (IAGP) decreased cornea epithelium thickness (IAGP) decreased embryo size (IAGP) decreased eye pigmentation (IAGP) decreased fetal size (IAGP) decreased pancreatic alpha cell number (IAGP) decreased pancreatic beta cell number (IAGP) decreased total retina thickness (IAGP) delayed eyelid fusion (IAGP) developmental cataract (IEA) disorganized pancreatic islets (IAGP) ectopic Purkinje cell (IAGP) embryonic lethality before implantation, incomplete penetrance (IEA) embryonic lethality between implantation and somite formation, complete penetrance (IAGP) embryonic lethality, complete penetrance (IAGP) embryonic lethality, incomplete penetrance (IEA) exencephaly (IAGP) eye opacity (IAGP) facial cleft (IEA) fused cornea and lens (IAGP) hyperactivity (IEA) hyperglycemia (IAGP) hypopigmentation (IAGP) impaired glucose tolerance (IAGP) impaired pupillary reflex (IAGP) increased alimentary system tumor incidence (IAGP) increased circulating ketone body level (IAGP) increased cornea thickness (IAGP) increased intestinal adenoma incidence (IAGP) increased lens epithelium apoptosis (IAGP) increased opacity of vitreous body (IAGP) increased retina apoptosis (IAGP) increased stomach tumor incidence (IAGP) increased susceptibility to induced pancreatitis (IAGP) increased tumor incidence (IAGP) iris hypoplasia (IAGP) irregularly shaped pupil (IAGP) lowered ear position (IAGP) microphthalmia (IAGP) mydriasis (IAGP) neonatal lethality, complete penetrance (IAGP) neonatal lethality, incomplete penetrance (IAGP) no abnormal phenotype detected (IAGP) ocular hypertension (IAGP) optic nerve degeneration (IAGP) optic nerve hypoplasia (IAGP) perinatal lethality, complete penetrance (IAGP) perinatal lethality, incomplete penetrance (IAGP) postnatal growth retardation (IAGP) postnatal lethality, complete penetrance (IAGP) postnatal lethality, incomplete penetrance (IEA) premature death (IAGP) prenatal lethality, complete penetrance (IAGP) prenatal lethality, incomplete penetrance (IEA) preweaning lethality, complete penetrance (IEA) reduced female fertility (IAGP) respiratory failure (IAGP) retina fold (IAGP) retina hypoplasia (IAGP) short snout (IAGP) small ears (IAGP) small lens (IAGP) small liver (IEA) small thalamus (IAGP) submandibular gland hypoplasia (IAGP) supernumerary incisors (IAGP) telencephalon hypoplasia (IAGP) thin cerebral cortex (IAGP) thin cortical plate (IAGP) white spotting (IEA)
1.
PAX6 aniridia and interhemispheric brain anomalies.
Abouzeid H, etal., Mol Vis. 2009 Oct 17;15:2074-83.
2.
The incidence of PAX6 mutation in patients with simple aniridia: an evaluation of mutation detection in 12 cases.
Axton R, etal., J Med Genet. 1997 Apr;34(4):279-86.
3.
Missense mutation in the alternative splice region of the PAX6 gene in eye anomalies.
Azuma N, etal., Am J Hum Genet. 1999 Sep;65(3):656-63.
4.
Mutations of the PAX6 gene detected in patients with a variety of optic-nerve malformations.
Azuma N, etal., Am J Hum Genet. 2003 Jun;72(6):1565-70. Epub 2003 Apr 29.
5.
A novel PAX6 mutation in a large Chinese family with aniridia and congenital cataract.
Cai F, etal., Mol Vis. 2010 Jun 22;16:1141-5.
6.
A novel mutation of PAX6 identified in a Chinese twin family with congenital aniridia complicated with nystagmus.
Cao X, etal., Genet Mol Res. 2014 Oct 27;13(4):8679-85. doi: 10.4238/2014.October.27.8.
7.
A novel PAX6 deletion in a Chinese family with congenital aniridia.
Chen JH, etal., Mol Vis. 2012;18:989-95. Epub 2012 Apr 21.
8.
Mutation analysis of paired box 6 gene in inherited aniridia in northern China.
Chen P, etal., Mol Vis. 2013 May 30;19:1169-77. Print 2013.
9.
Overexpression of PAX6(5a) in lens fiber cells results in cataract and upregulation of (alpha)5(beta)1 integrin expression.
Duncan MK, etal., J Cell Sci. 2000 Sep;113 ( Pt 18):3173-85.
10.
Absence of ventral cell populations in the developing brain in a rat model of the Smith-Lemli-Opitz syndrome.
Gofflot F, etal., Am J Med Genet. 1999 Nov 26;87(3):207-16.
11.
Three novel Pax6 alleles in the mouse leading to the same small-eye phenotype caused by different consequences at target promoters.
Graw J, etal., Invest Ophthalmol Vis Sci. 2005 Dec;46(12):4671-83.
12.
Association of PAX6 polymorphisms with high myopia in Han Chinese nuclear families.
Han W, etal., Invest Ophthalmol Vis Sci. 2009 Jan;50(1):47-56. doi: 10.1167/iovs.07-0813.
13.
PAX6 haplotypes are associated with high myopia in Han chinese.
Jiang B, etal., PLoS One. 2011 May 12;6(5):e19587. doi: 10.1371/journal.pone.0019587.
14.
A recurrent PAX6 mutation is associated with aniridia and congenital progressive cataract in a Chinese family.
Jin C, etal., Mol Vis. 2012;18:465-70. Epub 2012 Feb 16.
15.
Mutation analysis of PAX6 in inherited and sporadic aniridia from northeastern China.
Kang Y, etal., Mol Vis. 2012;18:1750-4. Epub 2012 Jun 27.
16.
PAX6 is expressed in pancreatic adenocarcinoma and is downregulated during induction of terminal differentiation.
Lang D, etal., Mol Carcinog. 2008 Feb;47(2):148-56.
17.
PAX6 analysis of one family and one sporadic patient from southern China with classic aniridia.
Lin Y, etal., Mol Vis. 2011;17:3116-20. Epub 2011 Nov 26.
18.
Aberrant lens fiber differentiation in anterior subcapsular cataract formation: a process dependent on reduced levels of Pax6.
Lovicu FJ, etal., Invest Ophthalmol Vis Sci. 2004 Jun;45(6):1946-53.
19.
Overexpression of Pax6 results in microphthalmia, retinal dysplasia and defective retinal ganglion cell axon guidance.
Manuel M, etal., BMC Dev Biol. 2008 May 28;8:59. doi: 10.1186/1471-213X-8-59.
20.
Electronic Transfer of Homolog Data
MGD and Homologene mouse data transfer
21.
MGDs mouse GO annotations
MGD data from the GO Consortium
22.
MGD IEA
MGD IEA
23.
Mutation of the PAX6 gene in patients with autosomal dominant keratitis.
Mirzayans F, etal., Am J Hum Genet. 1995 Sep;57(3):539-48.
24.
Association of paired box 6 with high myopia in Japanese.
Miyake M, etal., Mol Vis. 2012;18:2726-35. Epub 2012 Nov 17.
25.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
26.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
27.
Developmental and cellular factors underlying corneal epithelial dysgenesis in the Pax6+/- mouse model of aniridia.
Ramaesh T, etal., Exp Eye Res. 2005 Aug;81(2):224-35.
28.
Histopathological characterisation of effects of the mouse Pax6(Leca4) missense mutation on eye development.
Ramaesh T, etal., Exp Eye Res. 2009 Aug;89(2):263-73. doi: 10.1016/j.exer.2009.03.016. Epub 2009 Apr 2.
29.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
30.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
31.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
32.
Transcription factor Pax6 is expressed by astroglia after transient brain ischemia in the rat model.
Steliga A, etal., Folia Neuropathol. 2013;51(3):203-13.
33.
Functional PAX-6 gene-linked polymorphic region: potential association with paranoid schizophrenia.
Stober G, etal., Biol Psychiatry 1999 Jun 15;45(12):1585-91.
34.
Evaluation of Pax6 mutant rat as a model for autism.
Umeda T, etal., PLoS One. 2010 Dec 21;5(12):e15500. doi: 10.1371/journal.pone.0015500.
35.
Variable phenotype related to a novel PAX 6 mutation (IVS4+5G>C) in a family presenting congenital nystagmus and foveal hypoplasia.
Vincent MC, etal., Am J Ophthalmol. 2004 Dec;138(6):1016-21.
36.
A splice site mutation in the PAX6 gene which induces exon skipping causes autosomal dominant inherited aniridia.
Weisschuh N, etal., Mol Vis. 2012;18:751-7. Epub 2012 Mar 29.
37.
Paired box 6 (PAX6) regulates glucose metabolism via proinsulin processing mediated by prohormone convertase 1/3 (PC1/3).
Wen JH, etal., Diabetologia. 2009 Mar;52(3):504-13. Epub 2008 Nov 26.
38.
Muller glia cells activation in rat retina after optic nerve injury: spatiotemporal correlation with transcription initiation factor IIb.
Xu Y, etal., J Mol Neurosci. 2013 Sep;51(1):37-46. doi: 10.1007/s12031-012-9941-z. Epub 2013 Jan 9.
Pax6 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 105,499,241 - 105,528,755 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 105,499,245 - 105,527,709 (+) Ensembl GRCm39 Ensembl GRCm38 2 105,668,896 - 105,698,410 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 105,668,900 - 105,697,364 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 105,516,602 - 105,537,226 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 105,477,284 - 105,497,908 (+) NCBI MGSCv36 mm8 Celera 2 106,897,827 - 106,918,452 (+) NCBI Celera Cytogenetic Map 2 E3 NCBI cM Map 2 55.31 NCBI
PAX6 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 31,789,026 - 31,817,961 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 31,784,779 - 31,817,961 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 31,810,574 - 31,839,509 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 31,767,034 - 31,789,455 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 31,768,057 - 31,789,341 NCBI Celera 11 31,953,799 - 31,986,960 (-) NCBI Celera Cytogenetic Map 11 p13 NCBI HuRef 11 31,501,758 - 31,535,259 (-) NCBI HuRef CHM1_1 11 31,805,847 - 31,839,030 (-) NCBI CHM1_1 T2T-CHM13v2.0 11 31,924,847 - 31,953,767 (-) NCBI T2T-CHM13v2.0
Pax6 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 112,590,034 - 112,611,771 (+) NCBI GRCr8 mRatBN7.2 3 92,128,772 - 92,157,022 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 92,135,637 - 92,157,014 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 95,631,693 - 95,652,650 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 104,230,622 - 104,251,579 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 102,058,594 - 102,079,600 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 95,700,241 - 95,728,682 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 95,707,386 - 95,728,624 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 102,320,059 - 102,348,223 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 91,127,605 - 91,149,178 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 91,023,827 - 91,045,776 (+) NCBI Celera 3 91,190,477 - 91,211,449 (+) NCBI Celera RH 3.4 Map 3 722.9 RGD Cytogenetic Map 3 q33 NCBI
Pax6 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955476 10,058,961 - 10,074,162 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955476 10,058,979 - 10,074,668 (-) NCBI ChiLan1.0 ChiLan1.0
PAX6 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 33,999,843 - 34,029,009 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 34,004,314 - 34,033,443 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 31,753,190 - 31,782,225 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 31,641,813 - 31,671,071 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 31,641,813 - 31,664,474 (-) Ensembl panpan1.1 panPan2
PAX6 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Dog10K_Boxer_Tasha 18 35,260,520 - 35,281,796 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 18 36,247,894 - 36,277,423 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 18 36,247,935 - 36,276,689 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 18 35,828,719 - 35,849,973 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 18 35,410,013 - 35,431,263 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 18 36,045,041 - 36,066,313 (+) NCBI UU_Cfam_GSD_1.0
Pax6 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 32,827,732 - 32,856,209 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936533 5,957,971 - 5,982,075 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936533 5,952,529 - 5,980,889 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PAX6 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 28,978,287 - 29,001,200 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 28,971,565 - 29,001,149 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 31,478,545 - 31,510,656 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PAX6 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 33,386,165 - 33,414,605 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 33,392,970 - 33,414,587 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 130,542,963 - 130,572,341 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pax6
.
Predicted Target Of
Count of predictions: 5376 Count of miRNA genes: 842 Interacting mature miRNAs: 1248 Transcripts: ENSMUST00000090391, ENSMUST00000090397, ENSMUST00000111082, ENSMUST00000111083, ENSMUST00000111085, ENSMUST00000111086, ENSMUST00000111087, ENSMUST00000111088, ENSMUST00000123000, ENSMUST00000123063, ENSMUST00000135412, ENSMUST00000138365, ENSMUST00000140173, ENSMUST00000142772, ENSMUST00000145744, ENSMUST00000146803, ENSMUST00000147923, ENSMUST00000147946, ENSMUST00000153011, ENSMUST00000153639, ENSMUST00000154302, ENSMUST00000154643, ENSMUST00000155081, ENSMUST00000156216, ENSMUST00000167211, ENSMUST00000172990 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
11038697 Ltpr2d_m Leishmania tropica response 2d (mouse) 2 86095716 120095823 Mouse 1301330 Tbbmd2_m total body bone mineral density 2 (mouse) Not determined 2 100942930 134943090 Mouse 11038698 Ltpr2c_m Leishmania tropica response 2c (mouse) 2 86095716 120095823 Mouse 39128209 Lwq14_m liver weight QTL 14 (mouse) 2 20897778 118894840 Mouse 1558738 W6q1_m weight 6 weeks QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 13824983 Vclq1_m curvilinear velocity QTL 1 (mouse) 2 61830344 136841920 Mouse 1301909 Smdq2_m segregation of mitochondrial DNA QTL 2 (mouse) Not determined 2 92778465 126778607 Mouse 11038702 Ltpr2_m Leishmania tropica response 2 (mouse) 2 103095716 167212356 Mouse 11049568 Lmr28c_m leishmaniasis resistance 28c (mouse) 2 97123370 131123532 Mouse 11049569 Lmr28d_m leishmaniasis resistance 28d (mouse) 2 97123370 131123532 Mouse 11528549 Sluc31_m susceptibility to lung cancer 31 (mouse) 2 74524117 129213005 Mouse 1302174 Dssc2_m dextran sodium sulfate induced colitis QTL2 (mouse) Not determined 2 24224632 148700377 Mouse 1558915 W3q1_m weight 3 weeks QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 11532731 Sluc31a_m susceptibility to lung cancer 31a (mouse) 2 88015003 122015170 Mouse 4141802 Ignpq1_m IgA nephropathy QTL 1 (mouse) Not determined 2 100824060 134824269 Mouse 27226761 Feml18_m femur length 18, 16 week (mouse) 2 94230345 154241920 Mouse 1301834 Bits1_m bitterness sensitivity 1 (mouse) Not determined 2 87440643 121440778 Mouse 1357454 Kidq1_m kidney weight QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 11041906 Lmr28a_m leishmaniasis resistance 28a (mouse) 2 103095716 129213005 Mouse 4141155 Plast2b_m plasma plant sterol 2b (mouse) Not determined 2 84013198 148522175 Mouse 1357577 Trmq3_m T cell ratio modifier QTL 3 (mouse) Not determined 2 60520612 119355518 Mouse 1558966 W10q9_m weight 10 weeks QTL 9 (mouse) Not determined 2 20897778 118894840 Mouse 4141854 T2dm2sa_m type 2 diabetes mellitus 2 in SMXA RI mice (mouse) Not determined 2 29307947 148374934 Mouse 1558901 Skmw8_m skeletal muscle weight 8 (mouse) Not determined 2 84008488 118008593 Mouse 12904935 Edlmmq2_m extensor digitorum longus muscle mass QTL 2 (mouse) 2 97210364 131210364 Mouse 1558899 Egq1_m early growth QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 1302071 Fembrs1_m femur breaking strength 1 (mouse) Not determined 2 100942930 134943090 Mouse 1357681 Hrtq1_m heart weight QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 1301109 Dntcs2_m dental caries susceptibility 2 (mouse) Not determined 2 40885493 114910165 Mouse 1300852 Lmr14_m leishmaniasis resistance 14 (mouse) Not determined 2 86095716 120095823 Mouse 1357436 Splq1_m spleen weight QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 1302203 Gvhd3_m graft-versus host disease 3 (mouse) Not determined 2 100942930 134943090 Mouse 10412082 Hylaq1_m Hyperlocomotor activity related QTL 1 (mouse) Not determined 2 84013198 148667470 Mouse 1357881 Estoq1_m embryo survival total QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 1301374 Cplaq7_m circadian period of locomotor activity 7 (mouse) Not determined 2 76421483 110421651 Mouse 5491197 Mobq5_m multigenic obesity QTL 5 (mouse) Not determined 2 65269746 162518926 Mouse 10043894 Bw22_m body weight QTL 22 (mouse) Not determined 2 80895334 114895334 Mouse 5491196 Mobq6_m multigenic obesity QTL 6 (mouse) Not determined 2 85724269 180896594 Mouse 15092054 Egrme5_m early growth rate, maternal effect 5 (mouse) 2 82190187 118004745 Mouse 4142223 Femwf4_m femur work to failure 4 (mouse) Not determined 88143423 122143570 Mouse 1301344 Lith1_m lithogenic gene 1 (mouse) Not determined 2 45347635 145312647 Mouse 11049565 Lmr28g_m leishmaniasis resistance 28g (mouse) 2 86095716 120095823 Mouse 4142088 Parms1_m patched associated RMS 1 (mouse) Not determined 74524117 114123532 Mouse 4141448 Mpaps1_m microphthalmia anophthalmia susceptibility 1 (mouse) Not determined 97028557 112115196 Mouse 1301098 Cd8mts3_m CD8 memory T cell subset 3 (mouse) Not determined 2 91089974 125090104 Mouse 27226788 Feml13_m femur length 13, 10 week (mouse) 2 102630345 159941920 Mouse 12904954 Gmmq2_m gastrocnemius muscle mass QTL 2 (mouse) 2 97210364 131210364 Mouse
X63963
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 2 105,696,371 - 105,696,472 UniSTS GRCm38 MGSCv37 2 105,536,528 - 105,536,629 UniSTS GRCm37 Celera 2 106,917,754 - 106,917,855 UniSTS Cytogenetic Map 2 E3 UniSTS cM Map 2 58.0 UniSTS Whitehead/MRC_RH 2 1413.64 UniSTS
PMC186446P1
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 2 105,692,589 - 105,692,772 UniSTS GRCm38 MGSCv37 2 105,532,746 - 105,532,929 UniSTS GRCm37 Celera 2 106,913,973 - 106,914,156 UniSTS Cytogenetic Map 2 E3 UniSTS cM Map 2 58.0 UniSTS
Pax6
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 2 E3 UniSTS cM Map 2 58.0 UniSTS
Pax6
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 2 105,683,845 - 105,683,956 UniSTS GRCm38 MGSCv37 2 105,524,002 - 105,524,113 UniSTS GRCm37 Celera 2 106,905,229 - 106,905,340 UniSTS Cytogenetic Map 2 E3 UniSTS cM Map 2 58.0 UniSTS
GDB:344354
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 2 105,683,828 - 105,683,958 UniSTS GRCm38 MGSCv37 2 105,523,985 - 105,524,115 UniSTS GRCm37 Celera 2 106,905,212 - 106,905,342 UniSTS Cytogenetic Map 2 E3 UniSTS cM Map 2 58.0 UniSTS
Pax6
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 2 E3 UniSTS cM Map 2 58.0 UniSTS
Pax6
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 2 E3 UniSTS cM Map 2 58.0 UniSTS
Pax6
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 2 E3 UniSTS cM Map 2 58.0 UniSTS
Pax6
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 2 E3 UniSTS cM Map 2 58.0 UniSTS
Pax6
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 2 E3 UniSTS cM Map 2 58.0 UniSTS
Pax6
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 2 E3 UniSTS cM Map 2 58.0 UniSTS
Pax6
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 2 E3 UniSTS cM Map 2 58.0 UniSTS
Pax6
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 2 105,683,845 - 105,685,074 UniSTS GRCm38 MGSCv37 2 105,524,002 - 105,525,231 UniSTS GRCm37 Celera 2 106,905,229 - 106,906,458 UniSTS Cytogenetic Map 2 E3 UniSTS cM Map 2 58.0 UniSTS
Pax6
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 2 E3 UniSTS cM Map 2 58.0 UniSTS
D12Bir2
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 2 105,683,840 - 105,684,937 UniSTS GRCm38 MGSCv37 2 105,523,997 - 105,525,094 UniSTS GRCm37 Celera 2 106,905,224 - 106,906,321 UniSTS Cytogenetic Map 2 E3 UniSTS cM Map 17 48.5 UniSTS cM Map 6 4.6 UniSTS cM Map 9 1.0 UniSTS cM Map 17 48.0 UniSTS cM Map 17 41.5 UniSTS cM Map 18 35.0 UniSTS cM Map 16 21.0 UniSTS cM Map 16 19.6 UniSTS cM Map 12 23.0 UniSTS cM Map X 49.0 UniSTS cM Map X 47.0 UniSTS cM Map 6 44.0 UniSTS cM Map 2 69.0 UniSTS cM Map 16 1.7 UniSTS cM Map X 33.0 UniSTS cM Map X 31.0 UniSTS cM Map X 17.0 UniSTS cM Map 7 69.0 UniSTS cM Map 6 26.0 UniSTS cM Map 3 26.8 UniSTS cM Map 9 9.0 UniSTS
Pax6
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 2 E3 UniSTS cM Map 2 58.0 UniSTS
Pax6
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 2 E3 UniSTS cM Map 2 58.0 UniSTS
Pax6
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 2 E3 UniSTS cM Map 2 58.0 UniSTS
Pax6
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 2 E3 UniSTS cM Map 2 58.0 UniSTS
Pax6
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 2 E3 UniSTS cM Map 2 58.0 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000090391 ⟹ ENSMUSP00000087870
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 105,506,473 - 105,527,416 (+) Ensembl GRCm38.p6 Ensembl 2 105,676,128 - 105,697,071 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000090397 ⟹ ENSMUSP00000087878
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 105,505,536 - 105,527,587 (+) Ensembl GRCm38.p6 Ensembl 2 105,675,191 - 105,697,242 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000111082 ⟹ ENSMUSP00000106711
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 105,506,474 - 105,527,706 (+) Ensembl GRCm38.p6 Ensembl 2 105,676,129 - 105,697,361 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000111083 ⟹ ENSMUSP00000106712
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 105,505,872 - 105,527,416 (+) Ensembl GRCm38.p6 Ensembl 2 105,675,527 - 105,697,071 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000111085 ⟹ ENSMUSP00000106714
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 105,505,778 - 105,527,689 (+) Ensembl GRCm38.p6 Ensembl 2 105,675,433 - 105,697,344 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000111086 ⟹ ENSMUSP00000106715
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 105,499,245 - 105,527,709 (+) Ensembl GRCm38.p6 Ensembl 2 105,668,900 - 105,697,364 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000111087 ⟹ ENSMUSP00000106716
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 105,499,245 - 105,527,709 (+) Ensembl GRCm38.p6 Ensembl 2 105,668,900 - 105,697,364 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000111088 ⟹ ENSMUSP00000106717
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 105,502,205 - 105,527,587 (+) Ensembl GRCm38.p6 Ensembl 2 105,671,860 - 105,697,242 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000123000
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 105,514,099 - 105,515,288 (+) Ensembl GRCm38.p6 Ensembl 2 105,683,754 - 105,684,943 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000123063
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 105,499,265 - 105,526,807 (+) Ensembl GRCm38.p6 Ensembl 2 105,668,920 - 105,696,462 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000135412
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 105,512,853 - 105,522,610 (+) Ensembl GRCm38.p6 Ensembl 2 105,682,508 - 105,692,265 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000138365
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 105,512,882 - 105,522,068 (+) Ensembl GRCm38.p6 Ensembl 2 105,682,537 - 105,691,723 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000140173
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 105,512,808 - 105,522,578 (+) Ensembl GRCm38.p6 Ensembl 2 105,682,463 - 105,692,233 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000142772 ⟹ ENSMUSP00000139168
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 105,499,280 - 105,514,215 (+) Ensembl GRCm38.p6 Ensembl 2 105,668,935 - 105,683,870 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000145744
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 105,512,892 - 105,522,588 (+) Ensembl GRCm38.p6 Ensembl 2 105,682,547 - 105,692,243 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000146803
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 105,515,667 - 105,527,709 (+) Ensembl GRCm38.p6 Ensembl 2 105,685,322 - 105,697,364 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000147923
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 105,504,308 - 105,506,221 (+) Ensembl GRCm38.p6 Ensembl 2 105,673,963 - 105,675,876 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000147946
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 105,522,828 - 105,523,470 (+) Ensembl GRCm38.p6 Ensembl 2 105,692,483 - 105,693,125 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000153011
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 105,510,212 - 105,522,567 (+) Ensembl GRCm38.p6 Ensembl 2 105,679,867 - 105,692,222 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000153639
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 105,505,536 - 105,506,167 (+) Ensembl GRCm38.p6 Ensembl 2 105,675,191 - 105,675,822 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000154302
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 105,512,057 - 105,515,327 (+) Ensembl GRCm38.p6 Ensembl 2 105,681,712 - 105,684,982 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000154643
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 105,512,880 - 105,526,698 (+) Ensembl GRCm38.p6 Ensembl 2 105,682,535 - 105,696,353 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000155081
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 105,512,982 - 105,522,039 (+) Ensembl GRCm38.p6 Ensembl 2 105,682,637 - 105,691,694 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000156216 ⟹ ENSMUSP00000119375
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 105,508,736 - 105,516,140 (+) Ensembl GRCm38.p6 Ensembl 2 105,678,391 - 105,685,795 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000167211 ⟹ ENSMUSP00000129344
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 105,505,858 - 105,527,706 (+) Ensembl GRCm38.p6 Ensembl 2 105,675,513 - 105,697,361 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000172990
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 105,505,454 - 105,506,317 (+) Ensembl GRCm38.p6 Ensembl 2 105,675,109 - 105,675,972 (+) Ensembl
RefSeq Acc Id:
NM_001244198 ⟹ NP_001231127
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 105,499,241 - 105,528,755 (+) NCBI GRCm38 2 105,668,896 - 105,698,410 (+) NCBI Celera 2 106,890,276 - 106,918,747 (+) ENTREZGENE cM Map 2 ENTREZGENE
Sequence:
ACCCTCTTTTCTTATCGTTGACATTTAAACTCTGGGGCAGGTCCTCGCGTAGAACCCGGTTGTCAGATCTGCTACTTCCCCCCGAGAAGCGGCTTTGAGAAGTGTGGGAACCAGCGCCACCAGACTCA
hide sequence
RefSeq Acc Id:
NM_001244200 ⟹ NP_001231129
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 105,506,089 - 105,528,755 (+) NCBI GRCm38 2 105,675,744 - 105,698,410 (+) NCBI Celera 2 106,890,276 - 106,918,747 (+) ENTREZGENE cM Map 2 ENTREZGENE
Sequence:
GGATCTGAGAATTGCTCTCACACACCAACCCAGCAGCGTCCGTGGAGAAAACTCTCACGAGCAACTCCTTTAAAATACCGTCATTTCAAACCGTTGTGGTCTTTAAGCAACAACAGGGGGGGGGGACC
hide sequence
RefSeq Acc Id:
NM_001244201 ⟹ NP_001231130
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 105,499,241 - 105,528,755 (+) NCBI GRCm38 2 105,668,896 - 105,698,410 (+) NCBI Celera 2 106,890,276 - 106,918,747 (+) ENTREZGENE cM Map 2 ENTREZGENE
Sequence:
ACCCTCTTTTCTTATCGTTGACATTTAAACTCTGGGGCAGGTCCTCGCGTAGAACCCGGTTGTC
hide sequence
RefSeq Acc Id:
NM_001244202 ⟹ NP_001231131
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 105,506,474 - 105,528,755 (+) NCBI GRCm38 2 105,676,129 - 105,698,410 (+) NCBI Celera 2 106,890,276 - 106,918,747 (+) ENTREZGENE cM Map 2 ENTREZGENE
Sequence:
ACTTCCAGCGAAAGCCCGCGTCGGAGGGCGACGGTCCGCGCGAGCCACAACAGCGCGGATCTTCAGGCAGGCGGCTGGCTCTGCACCAGCGCAAGTGCGGCTGGAGCTCTCGGAGAGCAGCTAGGCTG
hide sequence
RefSeq Acc Id:
NM_001310144 ⟹ NP_001297073
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 105,506,089 - 105,528,755 (+) NCBI GRCm38 2 105,675,744 - 105,698,410 (+) NCBI
Sequence:
GGATCTGAGAATTGCTCTCACACACCAACCCAGCAGCGTCCGTGGAGAAAACTCTCACGAGCAACTCCTTTAAAATACCGTCATTTCAAACCGTTGTGGTCTTTAAGCAACAACAGGGGGGGGGGACC
hide sequence
RefSeq Acc Id:
NM_001310145 ⟹ NP_001297074
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 105,512,808 - 105,528,755 (+) NCBI GRCm38 2 105,682,463 - 105,698,410 (+) NCBI
Sequence:
CATATTCCCCCCTCGTCTATATTTGGAGCTTATTTATTGCTAAGAAGCACAGGCTCCTGGAGTCAATTTATCAGGAGGCTCCAAGGAGAAGAGAGGAGAAGAGAGGAGACAAGAGAGGAGCTGAGAAC
hide sequence
RefSeq Acc Id:
NM_001310146 ⟹ NP_001297075
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 105,512,808 - 105,528,755 (+) NCBI GRCm38 2 105,682,463 - 105,698,410 (+) NCBI
Sequence:
CATATTCCCCCCTCGTCTATATTTGGAGCTTATTTATTGCTAAGAAGCACAGGCTCCTGGAGTCAATTTATCAGGAGGCTCCAAGGAGAAGAGAGGAGAAGAGAGGAGACAAGAGAGGAGCTGAGAAC
hide sequence
RefSeq Acc Id:
NM_013627 ⟹ NP_038655
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 105,506,474 - 105,528,755 (+) NCBI GRCm38 2 105,676,129 - 105,698,410 (+) NCBI MGSCv37 2 105,516,602 - 105,537,226 (+) RGD Celera 2 106,890,276 - 106,918,747 (+) ENTREZGENE cM Map 2 ENTREZGENE
Sequence:
ACTTCCAGCGAAAGCCCGCGTCGGAGGGCGACGGTCCGCGCGAGCCACAACAGCGCGGATCTTC
hide sequence
RefSeq Acc Id:
NP_038655 ⟸ NM_013627
- Peptide Label:
isoform 1
- UniProtKB:
P63015 (UniProtKB/Swiss-Prot)
- Sequence:
MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQTHADAKVQVLDNENVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTN
hide sequence
RefSeq Acc Id:
NP_001231127 ⟸ NM_001244198
- Peptide Label:
isoform 1
- UniProtKB:
P63015 (UniProtKB/Swiss-Prot)
- Sequence:
MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQTHADAKVQVLDNENVSN
hide sequence
RefSeq Acc Id:
NP_001231130 ⟸ NM_001244201
- Peptide Label:
isoform 2
- UniProtKB:
Q8VDB5 (UniProtKB/Swiss-Prot), Q8CEI5 (UniProtKB/Swiss-Prot), Q3UTV5 (UniProtKB/Swiss-Prot), Q921Q8 (UniProtKB/Swiss-Prot), Q64037 (UniProtKB/Swiss-Prot), Q62222 (UniProtKB/Swiss-Prot), P70601 (UniProtKB/Swiss-Prot), P32117 (UniProtKB/Swiss-Prot), P63015 (UniProtKB/Swiss-Prot)
- Sequence:
MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLR
hide sequence
RefSeq Acc Id:
NP_001231129 ⟸ NM_001244200
- Peptide Label:
isoform 1
- UniProtKB:
P63015 (UniProtKB/Swiss-Prot), Q8VBX9 (UniProtKB/TrEMBL)
- Sequence:
MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQTHADAKVQVLDNENVSN
hide sequence
RefSeq Acc Id:
NP_001231131 ⟸ NM_001244202
- Peptide Label:
isoform 2
- UniProtKB:
Q8VDB5 (UniProtKB/Swiss-Prot), Q8CEI5 (UniProtKB/Swiss-Prot), Q3UTV5 (UniProtKB/Swiss-Prot), Q921Q8 (UniProtKB/Swiss-Prot), Q64037 (UniProtKB/Swiss-Prot), Q62222 (UniProtKB/Swiss-Prot), P70601 (UniProtKB/Swiss-Prot), P32117 (UniProtKB/Swiss-Prot), P63015 (UniProtKB/Swiss-Prot)
- Sequence:
MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLR
hide sequence
RefSeq Acc Id:
NP_001297073 ⟸ NM_001310144
- Peptide Label:
isoform 2
- UniProtKB:
Q8VDB5 (UniProtKB/Swiss-Prot), Q8CEI5 (UniProtKB/Swiss-Prot), Q3UTV5 (UniProtKB/Swiss-Prot), Q921Q8 (UniProtKB/Swiss-Prot), Q64037 (UniProtKB/Swiss-Prot), Q62222 (UniProtKB/Swiss-Prot), P70601 (UniProtKB/Swiss-Prot), P32117 (UniProtKB/Swiss-Prot), P63015 (UniProtKB/Swiss-Prot)
- Sequence:
MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETG
hide sequence
RefSeq Acc Id:
NP_001297074 ⟸ NM_001310145
- Peptide Label:
isoform 3
- UniProtKB:
P63015 (UniProtKB/Swiss-Prot)
- Sequence:
MGADGMYDKLRMLNGQTGSWGTRPGWYPGTSVPGQPTQDGCQQQEGGGENTNSISSNGEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAK
hide sequence
RefSeq Acc Id:
NP_001297075 ⟸ NM_001310146
- Peptide Label:
isoform 3
- UniProtKB:
P63015 (UniProtKB/Swiss-Prot)
- Sequence:
MGADGMYDKLRMLNGQTGSWGTRPGWYPGTSVPGQPTQDGCQQQEGGGENTNSISSNGEDSDEA
hide sequence
Ensembl Acc Id:
ENSMUSP00000106717 ⟸ ENSMUST00000111088
Ensembl Acc Id:
ENSMUSP00000106714 ⟸ ENSMUST00000111085
Ensembl Acc Id:
ENSMUSP00000106715 ⟸ ENSMUST00000111086
Ensembl Acc Id:
ENSMUSP00000106716 ⟸ ENSMUST00000111087
Ensembl Acc Id:
ENSMUSP00000106711 ⟸ ENSMUST00000111082
Ensembl Acc Id:
ENSMUSP00000106712 ⟸ ENSMUST00000111083
Ensembl Acc Id:
ENSMUSP00000087870 ⟸ ENSMUST00000090391
Ensembl Acc Id:
ENSMUSP00000087878 ⟸ ENSMUST00000090397
Ensembl Acc Id:
ENSMUSP00000129344 ⟸ ENSMUST00000167211
Ensembl Acc Id:
ENSMUSP00000139168 ⟸ ENSMUST00000142772
Ensembl Acc Id:
ENSMUSP00000119375 ⟸ ENSMUST00000156216
RGD ID: 6830738 Promoter ID: MM_KWN:30882 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain, ES_Cell, Kidney, Lung Transcripts: ENSMUST00000111082, ENSMUST00000111083, ENSMUST00000111084, ENSMUST00000111085, ENSMUST00000111086, ENSMUST00000111088, NM_013627, OTTMUST00000035653, UC008LKX.1, UC008LKZ.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 2 105,513,971 - 105,516,652 (+) MPROMDB
RGD ID: 6832003 Promoter ID: MM_KWN:30885 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain Transcripts: ENSMUST00000099643, ENSMUST00000111078, OTTMUST00000035651, OTTMUST00000035656, OTTMUST00000035657, OTTMUST00000035658, OTTMUST00000035659, OTTMUST00000035660, OTTMUST00000035661, OTTMUST00000035662 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 2 105,521,791 - 105,523,142 (+) MPROMDB
RGD ID: 6832006 Promoter ID: MM_KWN:30887 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain Transcripts: OTTMUST00000035860 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 2 105,532,641 - 105,533,141 (+) MPROMDB
RGD ID: 6878134 Promoter ID: EPDNEW_M2518 Type: multiple initiation site Name: Pax6_1 Description: Mus musculus paired box 6 , transcript variant 8, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M2519 EPDNEW_M2520 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 2 105,668,896 - 105,668,956 EPDNEW
RGD ID: 6878136 Promoter ID: EPDNEW_M2519 Type: initiation region Name: Pax6_2 Description: Mus musculus paired box 6 , transcript variant 8, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M2518 EPDNEW_M2520 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 2 105,675,643 - 105,675,703 EPDNEW
RGD ID: 6878138 Promoter ID: EPDNEW_M2520 Type: multiple initiation site Name: Pax6_3 Description: Mus musculus paired box 6 , transcript variant 8, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M2518 EPDNEW_M2519 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 2 105,676,071 - 105,676,131 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-11-26
Pax6
paired box 6
paired box gene 6
Symbol and/or name change
5135510 APPROVED
