Advanced Search (OLGA)

Gene: Syngr2 (synaptogyrin 2) Rattus norvegicus

Analyze

Symbol:

Syngr2

Name:

synaptogyrin 2

RGD ID:

621334

Description:

Involved in regulated exocytosis and synaptic vesicle membrane organization. Acts upstream of or within protein targeting. Located in synaptic vesicle membrane. Orthologous to human SYNGR2 (synaptogyrin 2); INTERACTS WITH 6-propyl-2-thiouracil; aconitine; Allylamine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

cellugyrin; synaptogyrin-2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SYNGR2 (synaptogyrin 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, Panther
Mus musculus (house mouse):	Syngr2 (synaptogyrin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Syngr2 (synaptogyrin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SYNGR2 (synaptogyrin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SYNGR2 (synaptogyrin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Syngr2 (synaptogyrin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SYNGR2 (synaptogyrin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SYNGR2 (synaptogyrin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Syngr2 (synaptogyrin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	KRTAP13-1 (keratin associated protein 13-1)	HGNC	OMA
Homo sapiens (human):	KRTAP13-4 (keratin associated protein 13-4)	HGNC	OMA
Homo sapiens (human):	KRTAP13-2 (keratin associated protein 13-2)	HGNC	OMA
Homo sapiens (human):	KRTAP13-3 (keratin associated protein 13-3)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	SYNGR2 (synaptogyrin 2)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Syngr2 (synaptogyrin 2)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	syngr2b (synaptogyrin 2b)	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Syngr	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	sng-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	syngr2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	103,528,599 - 103,533,167 (+)	NCBI		GRCr8
mRatBN7.2	10	103,029,903 - 103,034,473 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	103,029,917 - 103,034,473 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	108,131,052 - 108,135,567 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	107,594,163 - 107,598,678 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	102,950,723 - 102,955,261 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	106,812,740 - 106,816,675 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	106,812,739 - 106,816,675 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	106,451,965 - 106,455,900 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	10	101,589,921 - 101,593,857 (+)	NCBI		Celera
Cytogenetic Map	10	q32.2	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

idiopathic generalized epilepsy (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

(S)-nicotine (ISO)

1,2-dimethylhydrazine (ISO)

1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2-hydroxypropanoic acid (ISO)

3,3',4,4'-tetrachlorobiphenyl (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

aconitine (EXP)

all-trans-retinoic acid (ISO)

Allylamine (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bortezomib (ISO)

chlorpyrifos (ISO)

cisplatin (EXP)

clofibrate (ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

Cuprizon (EXP)

DDE (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP)

dioxygen (ISO)

doxorubicin (ISO)

entinostat (ISO)

epoxiconazole (ISO)

fenthion (ISO)

folic acid (ISO)

FR900359 (ISO)

fulvestrant (ISO)

ivermectin (ISO)

N-methyl-4-phenylpyridinium (ISO)

nefazodone (EXP)

nicotine (ISO)

paracetamol (EXP)

perfluorooctane-1-sulfonic acid (ISO)

potassium chromate (ISO)

rac-lactic acid (ISO)

Soman (EXP)

sulforaphane (ISO)

thiram (ISO)

titanium dioxide (ISO)

triclosan (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

protein targeting (IDA)

regulated exocytosis (IMP)

synaptic vesicle membrane organization (IMP)

Cellular Component

membrane (IDA,IEA)

mitochondrion (IDA)

neuromuscular junction (IBA)

nucleus (IDA)

synaptic vesicle (IDA,IEA,ISO)

synaptic vesicle membrane (IBA,IDA)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Cellugyrin and synaptogyrin facilitate targeting of synaptophysin to a ubiquitous synaptic vesicle-sized compartment in PC12 cells.	Belfort GM and Kandror KV, J Biol Chem. 2003 Nov 28;278(48):47971-8. Epub 2003 Aug 18.
2.	Cellugyrin induces biogenesis of synaptic-like microvesicles in PC12 cells.	Belfort GM, etal., J Biol Chem. 2005 Feb 25;280(8):7262-72. Epub 2004 Dec 7.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Cellugyrin, a novel ubiquitous form of synaptogyrin that is phosphorylated by pp60c-src.	Janz R and Sudhof TC, J Biol Chem 1998 Jan 30;273(5):2851-7.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	GOA pipeline	RGD automated data pipeline
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Synaptogyrins regulate Ca2+-dependent exocytosis in PC12 cells.	Sugita S, etal., J Biol Chem. 1999 Jul 2;274(27):18893-901.

Additional References at PubMed

PMID:20458337	PMID:23376485

Genomics

Comparative Map Data

Syngr2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	103,528,599 - 103,533,167 (+)	NCBI		GRCr8
mRatBN7.2	10	103,029,903 - 103,034,473 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	103,029,917 - 103,034,473 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	108,131,052 - 108,135,567 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	107,594,163 - 107,598,678 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	102,950,723 - 102,955,261 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	106,812,740 - 106,816,675 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	106,812,739 - 106,816,675 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	106,451,965 - 106,455,900 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	10	101,589,921 - 101,593,857 (+)	NCBI		Celera
Cytogenetic Map	10	q32.2	NCBI

SYNGR2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	78,168,545 - 78,172,964 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	78,168,581 - 78,173,527 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	76,164,626 - 76,169,045 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	73,676,266 - 73,680,604 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	73,676,265 - 73,680,604	NCBI
Celera	17	72,761,072 - 72,765,440 (+)	NCBI		Celera
Cytogenetic Map	17	q25.3	NCBI
HuRef	17	71,588,828 - 71,593,141 (+)	NCBI		HuRef
CHM1_1	17	76,229,214 - 76,233,546 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	79,062,641 - 79,067,058 (+)	NCBI		T2T-CHM13v2.0

Syngr2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	117,700,459 - 117,705,112 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	117,700,494 - 117,705,109 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	117,809,646 - 117,814,286 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	117,809,668 - 117,814,283 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	117,670,981 - 117,675,600 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	117,625,771 - 117,630,371 (+)	NCBI		MGSCv36	mm8
Celera	11	129,554,769 - 129,559,410 (+)	NCBI		Celera
Cytogenetic Map	11	E2	NCBI
cM Map	11	82.96	NCBI

Syngr2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955506	4,391,587 - 4,393,476 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955506	4,391,587 - 4,393,475 (-)	NCBI	ChiLan1.0	ChiLan1.0

SYNGR2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	94,219,313 - 94,223,536 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	99,047,987 - 99,052,216 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	72,245,844 - 72,250,031 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	77,800,214 - 77,802,541 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	77,800,484 - 77,802,541 (+)	Ensembl	panpan1.1		panPan2

SYNGR2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	2,972,561 - 2,976,775 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	3,656,078 - 3,660,221 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	3,650,453 - 3,654,639 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	3,650,453 - 3,656,924 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	3,673,474 - 3,677,612 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	3,797,676 - 3,801,820 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	3,879,107 - 3,883,250 (-)	NCBI		UU_Cfam_GSD_1.0

Syngr2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	3,628,065 - 3,631,182 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936594	2,775,144 - 2,783,892 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936594	2,775,144 - 2,783,894 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SYNGR2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	3,795,892 - 3,802,913 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	3,795,888 - 3,799,663 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

SYNGR2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	70,180,139 - 70,184,694 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	70,180,093 - 70,183,917 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666077	41,288,935 - 41,293,545 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Syngr2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624801	7,680,465 - 7,684,164 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624801	7,680,551 - 7,684,166 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Syngr2
12 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	132
Count of miRNA genes:	100
Interacting mature miRNAs:	119
Transcripts:	ENSRNOT00000074225
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354641	Bvd2	Brain ventricular dilatation QTL 2	6.36	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	10	93223816	107057807	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63221094	107211142	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
1579915	Bp280	Blood pressure QTL 280		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	90404397	107211142	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	72224939	107211142	Rat
1302404	Cia27	Collagen induced arthritis QTL 27	2.6	0.0045	joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	10	76452683	107211142	Rat
2317754	Glom25	Glomerulus QTL 25	3.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	82685200	107211142	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	53797385	107211142	Rat
10450493	Bp382	Blood pressure QTL 382		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	94759759	107211142	Rat
1578672	Bmd16	Bone mineral density QTL 16	6.2		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	96703043	107057807	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62057807	107057807	Rat
2293646	Bss25	Bone structure and strength QTL 25	10.96	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	10	69738412	107211142	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
2300172	Bmd57	Bone mineral density QTL 57	9.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	10	69738412	107211142	Rat
70193	Mcs7	Mammary carcinoma susceptibility QTL 7	2.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72224939	107211142	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62057807	107057807	Rat
61363	Oia3	Oil induced arthritis QTL 3		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87307617	107211142	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
724530	Bp149	Blood pressure QTL 149		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	90627439	107211142	Rat
1300137	Bp186	Blood pressure QTL 186	3.57		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	10	90627439	107057807	Rat
2293663	Bss33	Bone structure and strength QTL 33	9.34	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	10	69738412	107211142	Rat
1578663	Bss18	Bone structure and strength QTL 18	3.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	10	96703043	107057807	Rat
7387312	Bw125	Body weight QTL 125	3	0.0047	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight (CMO:0000356)	10	64890616	107211142	Rat
12880384	Cm107	Cardiac mass QTL 107		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)		90404397	107211142	Rat
12880385	Cm108	Cardiac mass QTL 108		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)		90404397	107211142	Rat
2317029	Aia19	Adjuvant induced arthritis QTL 19	2.98		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	66978955	107211142	Rat
2303589	Bw87	Body weight QTL 87	2		body mass (VT:0001259)	body weight (CMO:0000012)	10	81285008	107211142	Rat
12880396	Am13	Aortic mass QTL 13		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	90404397	107211142	Rat
12880398	Kidm67	Kidney mass QTL 67		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	90404397	107211142	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	51770177	107211142	Rat
2317039	Aia6	Adjuvant induced arthritis QTL 6	4.31		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	66978955	107211142	Rat
12880395	Cm109	Cardiac mass QTL 109		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	10	90404397	107211142	Rat
61396	Bp9	Blood pressure QTL 9	4.8	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68420376	107211142	Rat
634320	Niddm49	Non-insulin dependent diabetes mellitus QTL 49	4.41		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	10	88539139	107211142	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
10450498	Bp384	Blood pressure QTL 384		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	67750049	107211142	Rat
4889492	Pancm2	Pancreatic morphology QTL 2	3.2		pancreatic beta cell morphology trait (VT:0005217)	ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814)	10	76748906	107211142	Rat
6893366	Bw106	Body weight QTL 106	0.3	0.47	body mass (VT:0001259)	body weight (CMO:0000012)	10	70199100	107211142	Rat
2293698	Bss43	Bone structure and strength QTL 43	5.33	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	10	59209888	104209888	Rat
1576313	Pia25	Pristane induced arthritis QTL 25			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	96120911	104060283	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1576307	Cia28	Collagen induced arthritis QTL 28			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	96120911	104060283	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
2292438	Bp311	Blood pressure QTL 311			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	76246085	107211142	Rat
2292436	Bp310	Blood pressure QTL 310			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	94759759	107211142	Rat
1600367	Mcs15	Mammary carcinoma susceptibility QTL 15	4.5		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	85565469	103884409	Rat
631539	Oia6	Oil induced arthritis QTL 6			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	97010147	104670812	Rat
631538	Oia5	Oil induced arthritis QTL 5			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87055121	107211142	Rat
61436	Cia5	Collagen induced arthritis QTL 5	4.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	91228102	104060283	Rat
1642980	Bp300	Blood pressure QTL 300			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68383129	107211142	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053553	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039087001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF039085	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218897	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224907	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ235153	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000074225 ⟹ ENSRNOP00000064123

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	103,029,917 - 103,034,458 (+)	Ensembl
Rnor_6.0 Ensembl	10	106,812,739 - 106,816,675 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000105161 ⟹ ENSRNOP00000096171

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	103,030,414 - 103,034,473 (+)	Ensembl

RefSeq Acc Id:

NM_053553 ⟹ NP_446005

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	103,528,629 - 103,533,167 (+)	NCBI
mRatBN7.2	10	103,029,935 - 103,034,473 (+)	NCBI
Rnor_6.0	10	106,812,740 - 106,816,675 (+)	NCBI
Rnor_5.0	10	106,451,965 - 106,455,900 (+)	NCBI
Celera	10	101,589,921 - 101,593,857 (+)	RGD

Sequence:

show sequence

TTGCTTTTAATAACACTGAACCCCATCAGAGCCAGAAGCAGGTGCCCGCTGCAGTTTTTGACAC
ATGCCACTTTCCCTACAGCTGGAGGCCTTGGGTTCCATTTACAGTACTGGGGTGGGGGGATAAG
GCCTAGTAAAACCCTCTCCTCAAAGATGCCCTTGAGGGTCGGCGGCGACGGCGACATGGAGAGC
GGGGCCTATGGCGCGGCCAACGCGGGCGGCTCCTTCGACCTGCGGCGCTATGTGTCCCAGCCTC
AGGTGGTGACACGCCTCGTGAGCATGGTCTTGGCCTTGATCGTATTCTCCTGCATCTTCGGCGA
GGGCTACATCAACCTTCACTCATCTGACCAGCTACACTGTGTGTTCAACCGGAACGAAGATGCC
TGCCGCTACGGCAGTGCCATTGGGGTGCTGGCCTTCCTGGCCTCAGCCTTCTTCCTTGTGGTGG
ATGCGTTTTTCTCTCAGATAAGCAATGCCACTGACCGCAAGTATCTGGTCATTGGTGACCTGCT
CTTCTCAGCTCTCTGGACCTTCCTGTGGTTTGTCGGTTTCTGCTTTCTGACCAACCAGTGGGCA
GCCACCAAACCTGATGACGTGTTGGTGGGAGCAGACTCAGCCCGGGCTGCCATCACCTTCAGTT
TCTTCTCCATCTTCTCCTGGGGTGTGCTGGCCTCCCTGGCCTACCAGCGTTACAAGGCTGGAGT
GGATGCCTTCATTCAGAACTATGTGGACCCCACGCCGGATCCCACCACAGCCTACGCCTCCTAC
CCTAGTGCCTCGGTGGAAAACTACCAGCAGCCGCCCTTCACCCAGAATGTGGAGACTACTGAGG
GCTACCAGCCTCCCCCAGTGTACTGAGCAGCCAGGGACAAAGAGGCAGGAGGGTGCTTGGTGGG
GCTGCCCCTCCACCCTGGACTTCTCTCAAGGTTTGCTGTCCAGAACTGTAGTCCCTTGGCTGTT
ACAGTTGACAGCCCGAGTCCATGCCTTTCTGCACCCCAGCAGCCAGAGCACACCTGAAGTGCCC
ATGCCCAGAGGGGCTTCACCGCCACCCGCCTGACCCTCAAGGGCATCTTTGAGGAGAGGGTTTT
ACTAGGCCTTATCCCCCCAC

hide sequence

RefSeq Acc Id:

XM_039087001 ⟹ XP_038942929

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	103,528,599 - 103,533,160 (+)	NCBI
mRatBN7.2	10	103,029,903 - 103,034,470 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_446005	(Get FASTA)	NCBI Sequence Viewer
	XP_038942929	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB96666	(Get FASTA)	NCBI Sequence Viewer
	EDM06731	(Get FASTA)	NCBI Sequence Viewer
	EDM06732	(Get FASTA)	NCBI Sequence Viewer
	EDM06733	(Get FASTA)	NCBI Sequence Viewer
	EDM06734	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000064123.2
	ENSRNOP00000096171.1
GenBank Protein	O54980	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_446005 ⟸ NM_053553

- UniProtKB:

O54980 (UniProtKB/Swiss-Prot), A6HL26 (UniProtKB/TrEMBL), M0R446 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPLRVGGDGDMESGAYGAANAGGSFDLRRYVSQPQVVTRLVSMVLALIVFSCIFGEGYINLHSS
DQLHCVFNRNEDACRYGSAIGVLAFLASAFFLVVDAFFSQISNATDRKYLVIGDLLFSALWTFL
WFVGFCFLTNQWAATKPDDVLVGADSARAAITFSFFSIFSWGVLASLAYQRYKAGVDAFIQNYV
DPTPDPTTAYASYPSASVENYQQPPFTQNVETTEGYQPPPVY

hide sequence

Ensembl Acc Id:

ENSRNOP00000064123 ⟸ ENSRNOT00000074225

RefSeq Acc Id:	XP_038942929 ⟸ XM_039087001
- Peptide Label:	isoform X1
- UniProtKB:	A6HL28 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000096171 ⟸ ENSRNOT00000105161

Protein Domains

MARVEL

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O54980-F1-model_v2	AlphaFold	O54980	1-224	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697931

Promoter ID:

EPDNEW_R8456

Type:

multiple initiation site

Name:

Syngr2_1

Description:

synaptogyrin 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	106,812,734 - 106,812,794	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621334	AgrOrtholog
BioCyc Gene	G2FUF-22539	BioCyc
Ensembl Genes	ENSRNOG00000050547	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000074225.3	UniProtKB/TrEMBL
	ENSRNOT00000105161.1	UniProtKB/TrEMBL
InterPro	Marvel	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Synaptogyrin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:89815	UniProtKB/Swiss-Prot
NCBI Gene	89815	ENTREZGENE
PANTHER	PTHR10838	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SYNAPTOGYRIN-2 LIKE PROTEIN-RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	MARVEL	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Syngr2	PhenoGen
PIRSF	Synaptogyrin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	MARVEL	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PROKAR_LIPOPROTEIN	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000050547	RatGTEx
UniProt	A0A8I6AQB9_RAT	UniProtKB/TrEMBL
	A6HL26	ENTREZGENE, UniProtKB/TrEMBL
	A6HL27_RAT	UniProtKB/TrEMBL
	A6HL28	ENTREZGENE, UniProtKB/TrEMBL
	A6HL29_RAT	UniProtKB/TrEMBL
	M0R446	ENTREZGENE, UniProtKB/TrEMBL
	O54980	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-01-20	Syngr2	synaptogyrin 2			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Syngr2	synaptogyrin 2			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar