Pvr (PVR cell adhesion molecule) - Rat Genome Database

Name: Pvr
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Pvr (PVR cell adhesion molecule) Rattus norvegicus

Analyze

Symbol:

Pvr

Name:

PVR cell adhesion molecule

RGD ID:

3813

Description:

Enables virus receptor activity. Predicted to be involved in heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules; homophilic cell adhesion via plasma membrane adhesion molecules; and positive regulation of leukocyte mediated cytotoxicity. Predicted to act upstream of or within cell migration and cell-cell adhesion. Predicted to be located in cell surface and plasma membrane. Predicted to be active in adherens junction. Orthologous to human PVR (PVR cell adhesion molecule); INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

poliovirus receptor; Taa1; Tage4; tumor-associated antigen 1; tumor-associated glycoprotein E4; tumor-associated glycoprotein pE4

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PVR (PVR cell adhesion molecule)	HGNC	OrthoDB, Panther
Mus musculus (house mouse):	Pvr (poliovirus receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PVR (PVR cell adhesion molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PVR (PVR cell adhesion molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pvr (PVR cell adhesion molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PVR (PVR cell adhesion molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LOC103234825 (PVR cell adhesion molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	NECTIN2 (nectin cell adhesion molecule 2)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	PVR (PVR cell adhesion molecule)	Alliance	DIOPT (Ensembl Compara\|HGNC\|OrthoFinder\|PANTHER\|PhylomeDB)
Mus musculus (house mouse):	Pvr (poliovirus receptor)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:ch73-22o12.1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pvrl2l (poliovirus receptor-related 2 like)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	nectin2	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	88,689,235 - 88,704,641 (-)	NCBI		GRCr8
mRatBN7.2	1	79,561,294 - 79,576,700 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	79,546,879 - 79,576,715 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	84,955,696 - 84,971,120 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	93,505,836 - 93,521,203 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	86,710,813 - 86,726,237 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	80,820,306 - 80,835,712 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	80,820,050 - 80,835,701 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	82,085,555 - 82,100,961 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	79,213,654 - 79,229,063 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	79,291,499 - 79,307,163 (-)	NCBI
Celera	1	74,018,461 - 74,033,867 (-)	NCBI		Celera
RH 3.4 Map	1	819.8	RGD
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

acute myeloid leukemia (ISO)

ethylmalonic encephalopathy (ISO)

orofacial cleft 1 (ISO)

poliomyelitis (ISO)

Prostatic Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-diaminotoluene (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3,3',5,5'-tetrabromobisphenol A (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-amino-2,6-dinitrotoluene (EXP)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrylamide (EXP)

aflatoxin B1 (EXP)

aldehydo-D-glucose (ISO)

amitrole (EXP)

ammonium chloride (EXP)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bromobenzene (EXP)

cadmium dichloride (EXP,ISO)

carbofuran (EXP)

carbon nanotube (ISO)

cefaloridine (EXP)

chloroform (EXP)

cisplatin (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

cyproconazole (EXP)

D-glucose (ISO)

dibutyl phthalate (EXP)

dicrotophos (ISO)

dioxygen (EXP,ISO)

doxorubicin (EXP,ISO)

endosulfan (EXP)

fluoranthene (ISO)

folic acid (ISO)

formaldehyde (EXP)

furan (EXP)

gentamycin (EXP)

glucose (ISO)

glycidol (EXP)

gold atom (ISO)

gold(0) (ISO)

graphite (EXP)

indole-3-methanol (EXP)

isoprenaline (EXP)

ivermectin (ISO)

lead(0) (ISO)

leflunomide (ISO)

lidocaine (EXP)

lipopolysaccharide (EXP,ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

mercury dichloride (EXP)

methamphetamine (EXP)

methapyrilene (EXP)

methimazole (EXP)

methoxychlor (EXP)

N1'-[2-[[5-[(dimethylamino)methyl]-2-furanyl]methylthio]ethyl]-N1-methyl-2-nitroethene-1,1-diamine (EXP)

nickel atom (ISO)

nickel dichloride (EXP)

orphenadrine (EXP)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

paraquat (EXP)

PCB138 (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP,ISO)

phenobarbital (EXP)

phenylephrine (EXP)

pirinixic acid (EXP,ISO)

propiconazole (ISO)

ranitidine (EXP)

rotenone (EXP,ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silicon dioxide (ISO)

Soman (EXP)

sulfadimethoxine (EXP)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (EXP,ISO)

tetracycline (EXP)

thioacetamide (EXP)

topotecan (EXP)

torcetrapib (ISO)

triadimefon (EXP)

trichloroethene (EXP)

triptonide (ISO)

valproic acid (ISO)

vancomycin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell migration (ISO)

cell-cell adhesion (ISO)

heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules (IBA)

homophilic cell adhesion via plasma membrane adhesion molecules (IBA)

natural killer cell mediated cytotoxicity (ISO)

negative regulation of natural killer cell mediated cytotoxicity (ISO)

positive regulation of natural killer cell mediated cytotoxicity (ISO)

positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target (ISO)

susceptibility to natural killer cell mediated cytotoxicity (ISO)

susceptibility to T cell mediated cytotoxicity (ISO)

symbiont entry into host cell (IEA)

Cellular Component

adherens junction (IBA)

cell surface (ISO)

membrane (ISO)

plasma membrane (ISO)

Molecular Function

cell adhesion molecule binding (ISO)

dynein light chain binding (ISO)

protein binding (ISO)

receptor ligand activity (ISO)

virus receptor activity (IMP)

References

References - curated

#	Reference Title	Reference Citation
1.	Organization of the rat Tage4 gene and herpesvirus entry activity of the encoded protein.	Baury B, etal., Gene 2001 Mar 7;265(1-2):185-94.
2.	A novel member of the immunoglobulin gene superfamily expressed in rat carcinoma cell lines.	Chadeneau C, etal., J Biol Chem 1994 Jun 3;269(22):15601-5.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:11751937	PMID:12477932	PMID:12740392	PMID:12913096	PMID:15039383	PMID:16304049	PMID:16440345	PMID:16831868	PMID:20680398	PMID:21423176	PMID:22027834	PMID:23376485
PMID:27733379

Genomics

Comparative Map Data

Pvr
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	88,689,235 - 88,704,641 (-)	NCBI		GRCr8
mRatBN7.2	1	79,561,294 - 79,576,700 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	79,546,879 - 79,576,715 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	84,955,696 - 84,971,120 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	93,505,836 - 93,521,203 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	86,710,813 - 86,726,237 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	80,820,306 - 80,835,712 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	80,820,050 - 80,835,701 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	82,085,555 - 82,100,961 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	79,213,654 - 79,229,063 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	79,291,499 - 79,307,163 (-)	NCBI
Celera	1	74,018,461 - 74,033,867 (-)	NCBI		Celera
RH 3.4 Map	1	819.8	RGD
Cytogenetic Map	1	q21	NCBI

PVR
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	44,643,910 - 44,666,162 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	44,643,798 - 44,666,162 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	45,147,210 - 45,169,430 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	49,839,066 - 49,858,690 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	49,839,065 - 49,858,689	NCBI
Celera	19	41,951,144 - 41,973,471 (+)	NCBI		Celera
Cytogenetic Map	19	q13.31	NCBI
HuRef	19	41,579,341 - 41,601,754 (+)	NCBI		HuRef
CHM1_1	19	45,149,748 - 45,172,111 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	47,468,632 - 47,490,944 (+)	NCBI		T2T-CHM13v2.0

Pvr
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	19,637,503 - 19,655,068 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	19,637,503 - 19,655,085 (-)	Ensembl		GRCm39 Ensembl
GRCm38	7	19,903,578 - 19,921,143 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	19,903,578 - 19,921,160 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	20,488,927 - 20,506,492 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	19,062,100 - 19,079,613 (-)	NCBI		MGSCv36	mm8
Celera	7	17,310,717 - 17,327,912 (-)	NCBI		Celera
Cytogenetic Map	7	A3	NCBI
cM Map	7	9.95	NCBI

PVR
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	50,803,497 - 50,823,257 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	52,675,478 - 52,695,282 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	41,592,042 - 41,614,397 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	50,196,980 - 50,216,832 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	50,196,980 - 50,217,006 (+)	Ensembl	panpan1.1		panPan2

PVR
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	110,692,906 - 110,713,209 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	110,697,911 - 110,754,296 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	110,175,812 - 110,196,115 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	111,257,096 - 111,277,399 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	111,261,295 - 111,277,390 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	110,898,742 - 110,919,041 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	110,534,429 - 110,554,736 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	111,404,145 - 111,424,445 (-)	NCBI		UU_Cfam_GSD_1.0

Pvr
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	17,009,613 - 17,022,236 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936706	1,357,041 - 1,370,442 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936706	1,356,690 - 1,369,547 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PVR
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	6	51,161,320 - 51,178,464 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	47,020,048 - 47,038,024 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103234825
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	38,127,864 - 38,141,612 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023667612	773 - 12,781 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Pvr
83 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	253
Count of miRNA genes:	82
Interacting mature miRNAs:	98
Transcripts:	ENSRNOT00000043096, ENSRNOT00000064305
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	78479925	123479925	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
4889929	Bss87	Bone structure and strength QTL 87	6.7		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	53895117	82174945	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
8552900	Pigfal1	Plasma insulin-like growth factor 1 level QTL 1	7.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
1300121	Hrtrt1	Heart rate QTL 1	3.7		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	65789093	115540829	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	66023617	118608521	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	72197680	90508767	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	77876254	106047988	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
4889962	Bss94	Bone structure and strength QTL 94	3.8		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	49361465	82174945	Rat
61344	Bp29	Blood pressure QTL 29	7.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	78350581	123350581	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	77494165	122494165	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	53863041	90532583	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
9589820	Insglur3	Insulin/glucose ratio QTL 3	10.75	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	1	34836858	79836858	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	50343510	99980958	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	77857876	122857876	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	78430536	123430536	Rat
4889919	Bss86	Bone structure and strength QTL 86	4.1		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	1	53895117	82174945	Rat
8552948	Pigfal11	Plasma insulin-like growth factor 1 level QTL 11	4.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat
61433	Cia2	Collagen induced arthritis QTL 2	5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	78430754	91209302	Rat

Markers in Region

RH133112

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	79,561,340 - 79,561,528 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	80,820,353 - 80,820,540	NCBI	Rnor6.0
Rnor_5.0	1	82,085,602 - 82,085,789	UniSTS	Rnor5.0
RGSC_v3.4	1	79,213,701 - 79,213,888	UniSTS	RGSC3.4
Celera	1	74,018,508 - 74,018,695	UniSTS
RH 3.4 Map	1	787.1	UniSTS
Cytogenetic Map	1	q22	UniSTS

RH142229

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	79,561,654 - 79,561,824 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	80,820,667 - 80,820,836	NCBI	Rnor6.0
Rnor_5.0	1	82,085,916 - 82,086,085	UniSTS	Rnor5.0
RGSC_v3.4	1	79,214,015 - 79,214,184	UniSTS	RGSC3.4
Celera	1	74,018,822 - 74,018,991	UniSTS
RH 3.4 Map	1	819.8	UniSTS
Cytogenetic Map	1	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_017076	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF176671	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AH007579	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC085741	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L12025	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000064305 ⟹ ENSRNOP00000061458

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	79,546,879 - 79,576,715 (-)	Ensembl
Rnor_6.0 Ensembl	1	80,820,050 - 80,835,701 (-)	Ensembl

RefSeq Acc Id:

NM_017076 ⟹ NP_058772

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	88,689,235 - 88,704,641 (-)	NCBI
mRatBN7.2	1	79,561,294 - 79,576,700 (-)	NCBI
Rnor_6.0	1	80,820,306 - 80,835,712 (-)	NCBI
Rnor_5.0	1	82,085,555 - 82,100,961 (-)	NCBI
RGSC_v3.4	1	79,213,654 - 79,229,063 (-)	RGD
Celera	1	74,018,461 - 74,033,867 (-)	RGD

Sequence:

show sequence

GAGAAAGGACGCTTGCCCGCTCGCTGCTAGCTTGGATCCGCGTGGACTACAGGGACTGAATCGG
ACCCGGAACCACATGGCCCCACTCGCCGGTGCCTCTCGCTCCCGGGTGTGGTCAGTGGGGCTAC
TGAGGCTGCTGCTGCTGTCCTGCTTTACGCTCCAGAAAGCGGGTGGGGAGATAGCTGTGCAGGT
GCTCTCCAATTCGACCGGCTTCTTGGGAGGGTCTACAGTCTTGCACTGTAGTCTGGCTTCCAAA
GACAATGTGACAATCACTCAGCTAACATGGATGAAGAGGGATCCAGATGGATCCCACCCTTCCG
TGGCTGTCTTCCACCCCAAGAAGGGGCCCAGCATCTCTGATCCAGAGAGGGTGAAGTTCTTGGT
TGCCAAGGTGTACGAGGATCTGAGGAACGCATCTCTGGCCATCTCGAACTTGCGTGTAGAAGAC
GAAGGCATCTATGAGTGTCAGATTGCCACGTTCCCCACAGGCAGTAAGAGCGCCAATGTCTGGC
TGAAGGTGTTCGCCCGACCTAAAAACACAGCAGAGGCCCTGGAGCCCTCTCCCACCTTGATGCC
GCAGGACGTGGCCAAATGCATCTCTGCTGATGGTCACCCTCCTGGACGAATCACGTGGTCCTCG
AATGTGAATGGAAGCTACCGTGAAATGAAGGAAACAGGGTCCCAGCCGGGCACCACCACAGTTA
TCAGCTACCTCTCCATGGTGCCTTCTAGCCAGGCAGATGGCACGAACATCACCTGCACAGTGGA
ACATGAAAGCTTCCAGGAGCCGGACCAGCAGCCATTGATCCTTTCCCTACCTTATCCACCCGAA
GTGTCCATCTCTGGCTATGAAGGCAACTGGTACATTGGCCTCACTAACGTGAACCTGACCTGTG
AAGCTCGCAGCAAACCACCGCCCACCAACTATAGCTGGAGCACGGCCACGGGTCCCCTTCCCAA
CTCCACTCATTTCCAGGAAAACGGCAGTCACCTGCTAATCTCCACCGTGGATGACCTCAATAAC
ACGATCTTTGTGTGCAAAGCCATCAATGCCCTAGGGTCTGGGCAGGGCCAAGTGACCATCCTAG
TTAAAGAGGCATCTGAGATTCTGCCGCCAAAGACAAGCTTAGGCACTGGCTACATCATTGCCAT
CGTCTTTTGTGTCCTGATCATCGGAGTAGTAGCAGGCATTGTATTCTGGAAATACAGGCGTGGT
TGTGGTCGGCAGTCCAGGACCTTAGACAGGGAGAACGTCCGCTATTCAGCAGCGAATGGCGTCT
CTGTCCCAAACGTGGAGACGAACAACTTGAGGTGATGGTGCTGGGGTAGACAGAACTAAGGAAC
TTGAAGACATAACAACTGGAACCCTACTTCCACAAAAGAAAAAGCCTCCAGAGAGACTTGACTG
TCCAGTGTGGCGAACATAGCAAGGTTGGGGGTCTCCTTGGCCGCTGCCGAATTCCGCATTGTCG
AAAGGACTCATGGAACCCGGTGTGCTGACTCACACTTGACATCTCAGCAAGCGAGGGCCACATA
AAGCAAGGTTGAGTCTAGCACGGCTGTAGAGAGAAGCCCTGTCTATACACAGGCAAGCTAAGGG
GCTTTGAGACAGTCAGAAACTGAAGTCTTTCTTTGGGTAAGGTAAATCCTCTACCTCGTGTATG
TGACAAACTTGAAAGACTTCTACCTCTGAGACTCAAGTGCGGACTCTCTTTATAAGCTGACTCA
GCTGGGGCTAACCCCTCTCTCCTCTCTGGACAAGGTCTCAGAGTGTAGCCAAAGCTAGACCGAA
ACTCACAGAGGTCCGTCTGTCTCTACCTCCCAAGTGCTGCAGTTAAAGGTTTGTGTGTGCCACA
CTCCTTTGCTAGGTCTTTTTAATAAAGTAAAATATTTAATAAAGTAATATATTTATAAAAAAAA
AAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_058772	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB80767	(Get FASTA)	NCBI Sequence Viewer
	AAD25486	(Get FASTA)	NCBI Sequence Viewer
	AAF13362	(Get FASTA)	NCBI Sequence Viewer
	AAH85741	(Get FASTA)	NCBI Sequence Viewer
	EDM08126	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000061458.1

RefSeq Acc Id:	NP_058772 ⟸ NM_017076
- Peptide Label:	precursor
- UniProtKB:	Q5U334 (UniProtKB/TrEMBL), A6J8V8 (UniProtKB/TrEMBL), Q9R1E1 (UniProtKB/TrEMBL), F7FK02 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAPLAGASRSRVWSVGLLRLLLLSCFTLQKAGGEIAVQVLSNSTGFLGGSTVLHCSLASKDNVT ITQLTWMKRDPDGSHPSVAVFHPKKGPSISDPERVKFLVAKVYEDLRNASLAISNLRVEDEGIY ECQIATFPTGSKSANVWLKVFARPKNTAEALEPSPTLMPQDVAKCISADGHPPGRITWSSNVNG SYREMKETGSQPGTTTVISYLSMVPSSQADGTNITCTVEHESFQEPDQQPLILSLPYPPEVSIS GYEGNWYIGLTNVNLTCEARSKPPPTNYSWSTATGPLPNSTHFQENGSHLLISTVDDLNNTIFV CKAINALGSGQGQVTILVKEASEILPPKTSLGTGYIIAIVFCVLIIGVVAGIVFWKYRRGCGRQ SRTLDRENVRYSAANGVSVPNVETNNLR hide sequence

Ensembl Acc Id:

ENSRNOP00000061458 ⟸ ENSRNOT00000064305

Protein Domains

Ig-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5U334-F1-model_v2	AlphaFold	Q5U334	1-412	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689784

Promoter ID:

EPDNEW_R309

Type:

single initiation site

Name:

PVR_1

Description:

poliovirus receptor

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	80,835,733 - 80,835,793	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3813	AgrOrtholog
BioCyc Gene	G2FUF-60480	BioCyc
Ensembl Genes	ENSRNOG00000019202	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000064305.4	UniProtKB/TrEMBL
Gene3D-CATH	2.60.40.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7191422	IMAGE-MGC_LOAD
InterPro	CD80_C2-set	UniProtKB/TrEMBL
	Ig-like	UniProtKB/TrEMBL
	Ig-like_dom_sf	UniProtKB/TrEMBL
	Ig-like_fold	UniProtKB/TrEMBL
	Ig_sub	UniProtKB/TrEMBL
	Ig_V-set	UniProtKB/TrEMBL
	Nectin/PVR	UniProtKB/TrEMBL
KEGG Report	rno:25066	UniProtKB/TrEMBL
MGC_CLONE	MGC:93502	IMAGE-MGC_LOAD
NCBI Gene	25066	ENTREZGENE
PANTHER	NECTIN-2	UniProtKB/TrEMBL
	NECTIN-2	UniProtKB/TrEMBL
Pfam	C2-set_2	UniProtKB/TrEMBL
	Ig_3	UniProtKB/TrEMBL
	V-set	UniProtKB/TrEMBL
PhenoGen	Pvr	PhenoGen
PROSITE	IG_LIKE	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000019202	RatGTEx
SMART	IGv	UniProtKB/TrEMBL
	SM00409	UniProtKB/TrEMBL
Superfamily-SCOP	SSF48726	UniProtKB/TrEMBL
UniProt	A6J8V8	ENTREZGENE, UniProtKB/TrEMBL
	F7FK02	ENTREZGENE, UniProtKB/TrEMBL
	Q5U334	ENTREZGENE
	Q9R1E1	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	Q5U334	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-04-03	Pvr	PVR cell adhesion molecule	PVR	poliovirus receptor	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	PVR	poliovirus receptor	Taa1	tumor-associated antigen 1	Symbol and Name updated	1299863	APPROVED
2003-04-09	Taa1	tumor-associated antigen 1	Tage4	tumor-associated glycoprotein pE4	Symbol and Name updated	629477	APPROVED
2002-06-10	Tage4	tumor-associated glycoprotein pE4			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_disease	overexpressed in colon tumors	68704
gene_process	may mediate entry of some viruses	68704
gene_product	member of the immunoglobulin superfamily	68704

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD