Advanced Search (OLGA)

Gene: Pum3 (pumilio RNA-binding family member 3) Rattus norvegicus

Analyze

Symbol:

Pum3 (Ensembl: Pum3l1)

Name:

pumilio RNA-binding family member 3 (Ensembl:pumilio RNA-binding family member 3 like 1)

RGD ID:

1564753

Description:

Predicted to enable mRNA binding activity. Predicted to be involved in regulation of translation. Predicted to be located in chromosome; endoplasmic reticulum; and nucleoplasm. Predicted to be active in nucleolus. Orthologous to human PUM3 (pumilio RNA binding family member 3); INTERACTS WITH (+)-schisandrin B; bisphenol A; dioxygen.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

hypothetical protein LOC499339; LOC499339; pumilio domain-containing protein KIAA0020 homolog; pumilio homolog 3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PUM3 (pumilio RNA binding family member 3)	HGNC	Ensembl, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Pum3 (pumilio RNA-binding family member 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pum3 (pumilio RNA binding family member 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PUM3 (pumilio RNA binding family member 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PUM3 (pumilio RNA binding family member 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pum3 (pumilio RNA binding family member 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PUM3 (pumilio RNA binding family member 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PUM3 (pumilio RNA binding family member 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pum3 (pumilio RNA binding family member 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PUM3 (pumilio RNA binding family member 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Pum3 (pumilio RNA-binding family member 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	PUF6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	peng	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	puf-12	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pum3	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Related Pseudogenes:

Pum3-ps3

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	234,483,482 - 234,527,718 (-)	NCBI		GRCr8
mRatBN7.2	1	225,074,332 - 225,113,995 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	225,074,333 - 225,114,025 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	233,480,657 - 233,520,350 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	240,410,777 - 240,450,470 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	233,231,506 - 233,271,200 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	245,476,400 - 245,517,081 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	245,476,529 - 245,514,252 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	252,719,064 - 252,763,821 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	230,911,438 - 230,951,099 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	222,249,359 - 222,289,062 (-)	NCBI		Celera
Cytogenetic Map	1	q52	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

chromosome 9p deletion syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,4,6-tribromophenol (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

all-trans-retinoic acid (ISO)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

chromium(6+) (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

DDE (ISO)

decabromodiphenyl ether (ISO)

dexamethasone (ISO)

dicrotophos (ISO)

diethylstilbestrol (ISO)

dioxygen (EXP)

doxorubicin (ISO)

endosulfan (EXP)

fenthion (ISO)

flutamide (EXP)

fulvestrant (ISO)

glafenine (EXP)

hydrogen peroxide (ISO)

indometacin (ISO)

menadione (ISO)

nefazodone (EXP)

nickel atom (ISO)

nickel sulfate (ISO)

paraquat (EXP)

parathion (ISO)

pentachlorophenol (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorononanoic acid (ISO)

pirinixic acid (ISO)

resveratrol (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trimellitic anhydride (ISO)

triphenyl phosphate (ISO)

tungsten (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

regulation of translation (IBA)

Cellular Component

chromosome (ISO,ISS)

endoplasmic reticulum (ISO)

nucleolus (IBA,ISO,ISS)

nucleoplasm (ISO,ISS)

Molecular Function

DNA binding (IEA)

mRNA binding (IBA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:10942595	PMID:15489334	PMID:20813266	PMID:21266351	PMID:22658674	PMID:22681889

Genomics

Comparative Map Data

Pum3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	234,483,482 - 234,527,718 (-)	NCBI		GRCr8
mRatBN7.2	1	225,074,332 - 225,113,995 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	225,074,333 - 225,114,025 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	233,480,657 - 233,520,350 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	240,410,777 - 240,450,470 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	233,231,506 - 233,271,200 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	245,476,400 - 245,517,081 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	245,476,529 - 245,514,252 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	252,719,064 - 252,763,821 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	230,911,438 - 230,951,099 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	222,249,359 - 222,289,062 (-)	NCBI		Celera
Cytogenetic Map	1	q52	NCBI

PUM3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	2,804,152 - 2,844,095 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	2,720,469 - 2,844,095 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	2,804,152 - 2,844,095 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	2,794,152 - 2,834,130 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	2,794,163 - 2,828,505	NCBI
Celera	9	2,722,408 - 2,762,387 (-)	NCBI		Celera
Cytogenetic Map	9	p24.2	NCBI
HuRef	9	2,759,220 - 2,799,199 (-)	NCBI		HuRef
CHM1_1	9	2,804,479 - 2,844,443 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	9	2,807,740 - 2,847,894 (-)	NCBI		T2T-CHM13v2.0

Pum3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	27,366,105 - 27,407,264 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	27,366,098 - 27,407,225 (-)	Ensembl		GRCm39 Ensembl
GRCm38	19	27,388,698 - 27,429,908 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	27,388,698 - 27,429,825 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	19	27,463,192 - 27,504,310 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	19	27,456,980 - 27,496,919 (-)	NCBI		MGSCv36	mm8
Celera	19	28,172,798 - 28,213,903 (-)	NCBI		Celera
Cytogenetic Map	19	C1	NCBI
cM Map	19	21.96	NCBI

Pum3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955434	7,198,558 - 7,245,324 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955434	7,208,319 - 7,245,324 (-)	NCBI	ChiLan1.0	ChiLan1.0

PUM3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	121,742,941 - 121,785,274 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	121,748,884 - 121,791,218 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	2,606,386 - 2,645,943 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	2,797,964 - 2,837,399 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	2,797,969 - 2,837,321 (-)	Ensembl	panpan1.1		panPan2

PUM3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	91,391,619 - 91,436,378 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	91,391,627 - 91,436,310 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	91,859,463 - 91,898,703 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	91,937,938 - 91,977,212 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	91,937,941 - 91,982,635 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	91,583,552 - 91,623,040 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	91,295,645 - 91,334,897 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	92,070,321 - 92,109,573 (-)	NCBI		UU_Cfam_GSD_1.0

Pum3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	138,927,317 - 138,973,299 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936503	2,199,637 - 2,237,178 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936503	2,199,766 - 2,237,171 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PUM3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	218,994,200 - 219,038,506 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	218,994,139 - 219,038,208 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	244,815,651 - 244,861,526 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PUM3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	76,708,246 - 76,749,520 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	76,714,791 - 76,750,847 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	65,048,070 - 65,089,360 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pum3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624736	7,501,432 - 7,536,990 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Pum3
94 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	42
Count of miRNA genes:	39
Interacting mature miRNAs:	41
Transcripts:	ENSRNOT00000033724
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
8693637	Alc29	Alcohol consumption QTL 29	2.7	0.258	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	1	207987464	234238494	Rat
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	150700247	252085048	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
1357335	Bw39	Body weight QTL 39	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	1	197814409	242814409	Rat
2302375	Bw83	Body weight QTL 83	4.87	0.0002	body mass (VT:0001259)	body weight (CMO:0000012)	1	197697768	242697768	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	177227632	256448636	Rat
2293674	Bss39	Bone structure and strength QTL 39	7.1	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	1	201554356	246554356	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
61455	Niddm7	Non-insulin dependent diabetes mellitus QTL 7	5.5		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	214537555	238757011	Rat
61327	Eae7	Experimental allergic encephalomyelitis QTL 7	5.6		body mass (VT:0001259)	change in body weight (CMO:0002045)	1	216255568	260522016	Rat
1600392	Bw123	Body weight QTL 123		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	223201027	260522016	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	179567751	260522016	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	195804352	257091168	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	177227632	256448636	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
1600397	Edcs4	Endometrial carcinoma susceptibility QTL 4	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	1	206081677	251081677	Rat
631838	Niddm36	Non-insulin dependent diabetes mellitus QTL 36		0.01	insulin secretion trait (VT:0003564)	calculated pancreatic islet insulin release measurement (CMO:0001217)	1	184550676	229550676	Rat
8693661	Alc34	Alcohol consumption QTL 34	2.2	0.611	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	1	207987464	228627600	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	123556856	242907031	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
2293694	Bss38	Bone structure and strength QTL 38	7.05	0.0001	femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	1	201554356	246554356	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	150700247	252085048	Rat
8655655	Arrd2	Age-related retinal degeneration QTL 2	7.79		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	183970203	243914901	Rat
734767	Niddm57	Non-insulin dependent diabetes mellitus QTL 57			body mass (VT:0001259)	body weight (CMO:0000012)	1	224054293	260122809	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	191019702	246062233	Rat
631843	Bw116	Body weight QTL 116	4.1	0.016	abdominal adipose amount (VT:1000220)	abdominal fat pad weight (CMO:0000088)	1	224054293	260122809	Rat
2300175	Bmd40	Bone mineral density QTL 40	15.4	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	1	201554356	246554356	Rat
731175	Uae20	Urinary albumin excretion QTL 20	3.5	0.0018	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	221264111	259647894	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
724538	Kidm1	Kidney mass QTL 1	3.2		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	213707201	252085212	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	151162766	225824951	Rat
737977	Bp160	Blood pressure QTL 160		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	181133855	226133855	Rat
2293655	Bss36	Bone structure and strength QTL 36	10.66	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	201554356	246554356	Rat
1298084	Thym4	Thymus enlargement QTL 4	10.68		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	197814409	242814409	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	150700142	252085212	Rat
8552891	Epfw5	Epididymal fat weight QTL 5	4.4		epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	1	193113876	238113876	Rat
734769	Niddm58	Non-insulin dependent diabetes mellitus QTL 58			body mass (VT:0001259)	body weight (CMO:0000012)	1	224569538	260122809	Rat
734768	Niddm59	Non-insulin dependent diabetes mellitus QTL 59			body mass (VT:0001259)	body weight (CMO:0000012)	1	213843987	258843987	Rat
1358890	Bp259	Blood pressure QTL 259	3.06		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	210702053	260522016	Rat
724533	Rf51	Renal function QTL 51	5.3	0.0002	kidney plasma flow trait (VT:0005524)	renal plasma flow (CMO:0001914)	1	218753816	256448513	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	156677124	256448636	Rat
1358292	Cm37	Cardiac mass QTL 37	6.2	8e-07	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	1	196248093	241248093	Rat
61376	Bp42	Blood pressure QTL 42	23.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	197814409	242814409	Rat
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	199050459	259647894	Rat
1549910	Bw54	Body weight QTL 54		0.05	body mass (VT:0001259)	body weight (CMO:0000012)	1	214647894	259647894	Rat
70211	Niddm24	Non-insulin dependent diabetes mellitus QTL 24	3.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	214647894	259647894	Rat
1357399	Bw45	Body weight QTL 45	3.05		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	1	206329708	251329708	Rat
724552	Glom2	Glomerulus QTL 2	3.3	0.0001	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	1	222363780	260522016	Rat
1357404	Bw42	Body weight QTL 42	4.49	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	1	206329708	251329708	Rat
10053715	Scort24	Serum corticosterone level QTL 24	2.13	0.0088	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	221414816	260522016	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
1358916	Kidm22	Kidney mass QTL 22	3.32		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	210702053	240947965	Rat
2312564	Glom18	Glomerulus QTL 18	2.4	0.003	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	185356336	231689108	Rat
634321	Hc1	Hypercalciuria QTL 1	2.91		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	178810256	240830002	Rat
61400	Niddm1	Non-insulin dependent diabetes mellitus QTL 1	11		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	218753689	245907899	Rat
1331790	Bp201	Blood pressure QTL 201	3.127		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	198211513	225126682	Rat
10059587	Bw173	Body weight QTL 173	3.23	0.025	body mass (VT:0001259)	body weight (CMO:0000012)	1	202069611	247069611	Rat
2292216	Bw80	Body weight QTL 80	3.23	0.0019	body mass (VT:0001259)	body weight (CMO:0000012)	1	213533809	243914901	Rat
1300168	Bp170	Blood pressure QTL 170	2.76		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	207702246	228581766	Rat
2292220	Bp306	Blood pressure QTL 306	3.47	0.00087	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	243914901	Rat
10059590	Kidm44	Kidney mass QTL 44	3.42	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	191033875	236033875	Rat
1641926	Teswt2	Testicular weight QTL 2	2.82		testis mass (VT:1000644)	both testes wet weight (CMO:0000175)	1	197697768	238755659	Rat
631658	Cm7	Cardiac mass QTL 7	5.32	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	1	196248093	241248093	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
2293700	Bmd27	Bone mineral density QTL 27	6.6	0.0001	femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	224054293	243747962	Rat
2293701	Bmd34	Bone mineral density QTL 34	8.3	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	1	224054293	243747962	Rat
7387289	Uae45	Urinary albumin excretion QTL 45	2.86	0.0021	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	223262787	260522016	Rat
8655855	Arrd3	Age-related retinal degeneration QTL 3	3.07		lens clarity trait (VT:0001304)	cataract incidence/prevalence measurement (CMO:0001585)	1	183970203	243914901	Rat
634340	Hcar5	Hepatocarcinoma resistance QTL 5	8		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	214537555	226660468	Rat
1600374	Mcs17	Mammary carcinoma susceptibility QTL 17	3		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	197670404	242670404	Rat
1600363	Hc6	Hypercalciuria QTL 6	2.7		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	203995416	244113296	Rat
8693618	Alc25	Alcohol consumption QTL 25	3	0.28	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	1	207987464	228627600	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	176426412	257976495	Rat
1358191	Ept10	Estrogen-induced pituitary tumorigenesis QTL 10	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	192825253	243914732	Rat
2302040	Pia35	Pristane induced arthritis QTL 35	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	216255568	260522016	Rat
7394701	Uae46	Urinary albumin excretion QTL 46	3.6	0.0056	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	201554356	246554356	Rat
1598821	Rf55	Renal function QTL 55	6.3		renal blood flow trait (VT:2000006)	ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239)	1	218748008	257976495	Rat

Markers in Region

RH142051

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_5.0	12	13,070,923 - 13,071,136	NCBI	Rnor5.0
Rnor_5.0	16	69,740,296 - 69,740,509	NCBI	Rnor5.0
Rnor_5.0	1	252,723,196 - 252,723,409	NCBI	Rnor5.0
RGSC_v3.4	X	157,317,939 - 157,318,151	UniSTS	RGSC3.4
RGSC_v3.4	1	230,911,479 - 230,911,691	UniSTS	RGSC3.4
Celera	1	222,249,400 - 222,249,612	UniSTS
RH 3.4 Map	1	1614.01	UniSTS
Cytogenetic Map	X	q37	UniSTS
Cytogenetic Map	1	q51	UniSTS

BE118140

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	225,080,480 - 225,080,630 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	245,482,551 - 245,482,700	NCBI	Rnor6.0
Rnor_5.0	1	252,729,305 - 252,729,454	UniSTS	Rnor5.0
RGSC_v3.4	1	230,917,587 - 230,917,736	UniSTS	RGSC3.4
Celera	1	222,255,508 - 222,255,657	UniSTS
RH 3.4 Map	1	1609.5	UniSTS
Cytogenetic Map	1	q51	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001025036	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006231246	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271704	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271708	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271710	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271714	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271719	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271722	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271726	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010056425	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC092579	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC098744	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234057	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000033724 ⟹ ENSRNOP00000034834

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	225,074,333 - 225,114,025 (-)	Ensembl
Rnor_6.0 Ensembl	1	245,476,529 - 245,514,252 (-)	Ensembl

RefSeq Acc Id:

NM_001025036 ⟹ NP_001020207

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	234,487,951 - 234,527,612 (-)	NCBI
mRatBN7.2	1	225,074,332 - 225,113,995 (-)	NCBI
Rnor_6.0	1	245,476,402 - 245,517,026 (-)	NCBI
Rnor_5.0	1	252,719,064 - 252,763,821 (-)	NCBI
RGSC_v3.4	1	230,911,438 - 230,951,099 (-)	RGD
Celera	1	222,249,359 - 222,289,062 (-)	RGD

Sequence:

show sequence

GCGGAACTCCGTGAGCTTCTTCCCCACGTGTGCGAAGTACTGTGATGGAAGTCAAAGGGAAGAA
AAAAATTACAGGAAAGAGTCCACAGACATCACAAGGAAAGAATAAATTTCATAAAAACAGTGAG
TCTAGTTCTGCAAAGGCATTCCCAAGGAAAGCTGCTAAGGAAGGCGGGCCTAAAGTCACATCTA
AGAACTTTGAGAAAGGTGCCACAAAACCTGGCAAGAAGCGTGTGAAGCAGTTCAAGAACAAGCC
ACAAGGGGGCAAAGGACCGAAGGACAAATTCCAGAAGGCAAATAAATTCAACAAGAAGCGGAAA
TTCCAGCCAGATGGGAAAAGTGATGAATCAGCAGCCAAGAAACCCAAGTGGGATGACTTCAAAA
AGAAGAAGAAAGAGCTGAAGCAGAACAGACAGCTCAGTGATAAGACCAATTACGACGTCGTGGT
TCGAGCAAAGCACATTTGGGAGAGCTTGAGAAGAAAAGACTGTGACAAAGAAAAAAGGGTGAAG
CTCATGAGTGATTTGCAGAAGCTGATTCAAGGAAAAATTAAAACTATTGCCTTTGCGCATGACT
CAACTCGAGTGATCCAGTGCCTCATTCAGTATGGGAGCGAGGAGCAGAGGAAGTGGGCTTTCGA
AGAATTGCAAGGTGACTTGGTTGAATTAAGTAAAGCCAAATATTCCAGGAATATCGTTAAGAAA
TTTCTCATGTATGGAAGTAAACCACAGATTGCGGAGATAATCAGAAGTTTTAAAGGTCATGTGA
GGAAGATGCTGCGGCATTCAGAGGCATCGGCCATTGTGGAGTATGCGTACAACGACAAAGCCAT
TTTGGAACAGAGGAACATGCTGACAGAGGAGCTCTATGGGAACACATTTCAGCTTTACAAGTCA
GCAGATCACCCAACGCTGGAAAAGGTGCTAGAGGTGCAGCCAGGGAAGCTAGAACTTATCCTGG
ATGAGATGAAGCAGATTCTGACTCCCATGGCCCAAAAGGAAGCTGTGATTAAGCACTCACTGGT
TCATAAAGTATTCTTGGACTTTTTTACCTATGCACCCCCAAAACTTCGATCAGAACTAATTGAA
GCCATCCGGGAAGCAGTGGTGTACCTGGCCCACACACACGATGGCGCCAGAGTGGCCATGCATT
GCTTGTGGCATGGTACACCCAAGGACAGGAAAGTGATTGTGAAAACAATGAAGACGTATGTGGA
GAAGATTGCTAATGGCCAGTACTCTCACCTGGTTCTCCTGGCAGCGTTCGATTGTATTGATGAT
ACCAAGCTTGTGAAGCAGATAATCATATCAGAAGTCATCAGCTCCTTGCCCAGCATCGTTAATG
ACAAATATGGAAGGAAAGTGCTGCTGTACCTGCTGAGCCCCCGAGCCCCCGCCCACTTGGTGCC
AGAGATCATCCAGCTGCTGCAGAAGGGCGACGGCAATGCACACAGTAAGAAGGACACTGCAATC
CGCCGGCGTGAGCTCTTGGAGTCCATCTCTCCAGCTTTGCTGAGCTACCTGCAAGGACACACTC
GGGAGGTGGTGCTGGACAAGTCCGTGTGTGTGCTGGTGTCTGACATCCTGGGATCTGCTACTGG
GGACGCTCAGCCTGCTATGGATGCCATCGCCGGTTTGGCAGCAGAGGAACTGTATCCTGGGGGC
AAGGACGGAGAGCTCCACATTGCTGAGCATCCTGCAGGACATCTGGTCCTCAAATGGTTAATAG
AGCAAGATAAAAAGATAAAAGAAAATGGAAAAGAAGGTTGTTTTGCAAAAACCCTTGTAGAGTG
CGTTGGTATGAAGAACCTCAAGTCCTGGGCCAGCATCAACCGAGGAGCCATCGTTCTTTCCAGC
CTTCTTCAGAGTTGTGACCAGGACGTTGTAAACAAAGTCAAAGCTGGACTGAAAACCCTGATTC
CTACCTTGGAAAAAACCAAAAGCACCAGCAAAGGCATCCAGACTCTGCTTGAGAAGTTGACTGC
ATAGGCGCGCCAGATGAGCAAGCTGGAACCCGCTTCCCGAGGGGAAGGGTGGAATCTGTCACAC
TCATAACTGGATGCCCTATGCATGTACTTGTTAAAGGACCTATTTATATATAAAATTGTAAAAG
AGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063271704 ⟹ XP_063127774

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	234,483,482 - 234,527,718 (-)	NCBI

RefSeq Acc Id:

XM_063271708 ⟹ XP_063127778

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	234,483,482 - 234,527,714 (-)	NCBI

RefSeq Acc Id:

XM_063271710 ⟹ XP_063127780

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	234,483,482 - 234,527,714 (-)	NCBI

RefSeq Acc Id:

XM_063271714 ⟹ XP_063127784

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	234,483,482 - 234,527,564 (-)	NCBI

RefSeq Acc Id:

XM_063271719 ⟹ XP_063127789

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	234,497,533 - 234,527,718 (-)	NCBI

RefSeq Acc Id:

XM_063271722 ⟹ XP_063127792

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	234,487,951 - 234,520,518 (-)	NCBI

RefSeq Acc Id:

XM_063271726 ⟹ XP_063127796

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	234,487,951 - 234,520,044 (-)	NCBI

RefSeq Acc Id:

XR_010056425

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	234,497,533 - 234,527,718 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001020207	(Get FASTA)	NCBI Sequence Viewer
	XP_063127774	(Get FASTA)	NCBI Sequence Viewer
	XP_063127778	(Get FASTA)	NCBI Sequence Viewer
	XP_063127780	(Get FASTA)	NCBI Sequence Viewer
	XP_063127784	(Get FASTA)	NCBI Sequence Viewer
	XP_063127789	(Get FASTA)	NCBI Sequence Viewer
	XP_063127792	(Get FASTA)	NCBI Sequence Viewer
	XP_063127796	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH92579	(Get FASTA)	NCBI Sequence Viewer
	AAH98744	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000034834.4
GenBank Protein	Q562C7	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001020207 ⟸ NM_001025036

- UniProtKB:

Q4G054 (UniProtKB/Swiss-Prot), Q562C7 (UniProtKB/Swiss-Prot), A0A8L2QIX0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEVKGKKKITGKSPQTSQGKNKFHKNSESSSAKAFPRKAAKEGGPKVTSKNFEKGATKPGKKRV
KQFKNKPQGGKGPKDKFQKANKFNKKRKFQPDGKSDESAAKKPKWDDFKKKKKELKQNRQLSDK
TNYDVVVRAKHIWESLRRKDCDKEKRVKLMSDLQKLIQGKIKTIAFAHDSTRVIQCLIQYGSEE
QRKWAFEELQGDLVELSKAKYSRNIVKKFLMYGSKPQIAEIIRSFKGHVRKMLRHSEASAIVEY
AYNDKAILEQRNMLTEELYGNTFQLYKSADHPTLEKVLEVQPGKLELILDEMKQILTPMAQKEA
VIKHSLVHKVFLDFFTYAPPKLRSELIEAIREAVVYLAHTHDGARVAMHCLWHGTPKDRKVIVK
TMKTYVEKIANGQYSHLVLLAAFDCIDDTKLVKQIIISEVISSLPSIVNDKYGRKVLLYLLSPR
APAHLVPEIIQLLQKGDGNAHSKKDTAIRRRELLESISPALLSYLQGHTREVVLDKSVCVLVSD
ILGSATGDAQPAMDAIAGLAAEELYPGGKDGELHIAEHPAGHLVLKWLIEQDKKIKENGKEGCF
AKTLVECVGMKNLKSWASINRGAIVLSSLLQSCDQDVVNKVKAGLKTLIPTLEKTKSTSKGIQT
LLEKLTA

hide sequence

Ensembl Acc Id:

ENSRNOP00000034834 ⟸ ENSRNOT00000033724

RefSeq Acc Id:	XP_063127774 ⟸ XM_063271704
- Peptide Label:	isoform X1
- UniProtKB:	A0A8L2QIX0 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063127780 ⟸ XM_063271710
- Peptide Label:	isoform X2
- UniProtKB:	Q562C7 (UniProtKB/Swiss-Prot), Q4G054 (UniProtKB/Swiss-Prot), A0A8L2QIX0 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063127778 ⟸ XM_063271708
- Peptide Label:	isoform X1
- UniProtKB:	A0A8L2QIX0 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063127784 ⟸ XM_063271714
- Peptide Label:	isoform X2
- UniProtKB:	Q562C7 (UniProtKB/Swiss-Prot), Q4G054 (UniProtKB/Swiss-Prot), A0A8L2QIX0 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063127792 ⟸ XM_063271722
- Peptide Label:	isoform X4
- UniProtKB:	A6I0T5 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063127796 ⟸ XM_063271726
- Peptide Label:	isoform X5

RefSeq Acc Id:	XP_063127789 ⟸ XM_063271719
- Peptide Label:	isoform X3

Protein Domains

PUM-HD

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q562C7-F1-model_v2	AlphaFold	Q562C7	1-647	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1564753	AgrOrtholog
BioCyc Gene	G2FUF-56017	BioCyc
Ensembl Genes	ENSRNOG00000012574	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000033724.5	UniProtKB/TrEMBL
Gene3D-CATH	1.25.10.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7323921	IMAGE-MGC_LOAD
	IMAGE:7387202	IMAGE-MGC_LOAD
InterPro	ARM-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ARM-type_fold	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CPL_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PUM-HD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PUM3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Pumilio_RNA-bd_rpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:499339	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:108809	IMAGE-MGC_LOAD
	MGC:112738	IMAGE-MGC_LOAD
NCBI Gene	499339	ENTREZGENE
PANTHER	PTHR13389	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PUMILIO HOMOLOG 3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	CPL	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Pum3	PhenoGen
PROSITE	PUM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PUM_HD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000012574	RatGTEx
SMART	Pumilio	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF48371	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8L2QIX0	ENTREZGENE, UniProtKB/TrEMBL
	A6I0T5	ENTREZGENE, UniProtKB/TrEMBL
	PUM3_RAT	UniProtKB/Swiss-Prot
	Q4G054	ENTREZGENE
	Q562C7	ENTREZGENE
UniProt Secondary	Q4G054	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-10-02	Pum3	pumilio RNA-binding family member 3	LOC499339	hypothetical protein LOC499339	Name and Symbol changed	629549	APPROVED
2006-02-09	LOC499339	hypothetical protein LOC499339			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar