Advanced Search (OLGA)

Gene: Mix23 (mitochondrial matrix import factor 23) Rattus norvegicus

Analyze

Symbol:

Mix23

Name:

mitochondrial matrix import factor 23

RGD ID:

1564582

Description:

Predicted to be located in mitochondrial intermembrane space. Predicted to be active in mitochondrion. Orthologous to human MIX23 (mitochondrial matrix import factor 23); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Ccdc58; coiled-coil domain containing 58; coiled-coil domain-containing protein 58; hypothetical LOC288065; LOC288065; RGD1564582

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MIX23 (mitochondrial matrix import factor 23)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Mix23 (mitochondrial matrix import factor 23)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Mix23 (mitochondrial matrix import factor 23)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MIX23 (mitochondrial matrix import factor 23)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MIX23 (mitochondrial matrix import factor 23)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mix23 (mitochondrial matrix import factor 23)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MIX23 (mitochondrial matrix import factor 23)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MIX23 (mitochondrial matrix import factor 23)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mix23 (mitochondrial matrix import factor 23)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	MIX23 (mitochondrial matrix import factor 23)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Mix23 (mitochondrial matrix import factor 23)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ccdc58 (coiled-coil domain containing 58)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ccdc58	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	mix23	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	78,166,038 - 78,186,323 (-)	NCBI		GRCr8
mRatBN7.2	11	64,660,711 - 64,681,000 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	64,660,711 - 64,681,000 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	11	73,485,696 - 73,505,976 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	66,147,958 - 66,168,238 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	65,179,206 - 65,199,486 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	67,598,419 - 67,618,704 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	67,598,419 - 67,618,704 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	11	70,685,891 - 70,706,181 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	11	66,497,108 - 66,518,067 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	11	64,128,930 - 64,149,211 (-)	NCBI		Celera
Cytogenetic Map	11	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

alkaptonuria (ISO)

familial hypocalciuric hypercalcemia (ISO)

Primary Lymphedema with Myelodysplasia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-methylcholine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4-hydroxyphenyl retinamide (ISO)

aflatoxin B1 (EXP,ISO)

aflatoxin M1 (ISO)

arsenite(3-) (ISO)

beta-lapachone (ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium dichloride (ISO)

cannabidiol (ISO)

chloroprene (EXP)

cisplatin (ISO)

cobalt dichloride (EXP)

copper atom (ISO)

copper(0) (ISO)

cordycepin (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

cylindrospermopsin (ISO)

dexamethasone (ISO)

dicrotophos (ISO)

disulfiram (ISO)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

gentamycin (EXP)

indometacin (ISO)

isoprenaline (ISO)

ivermectin (ISO)

methidathion (ISO)

nefazodone (EXP)

nickel dichloride (EXP)

nimesulide (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

paraquat (EXP)

perfluorononanoic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

succimer (ISO)

temozolomide (ISO)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

trovafloxacin (ISO)

tungsten (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

mitochondrial intermembrane space (IEA)

mitochondrion (IBA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:18614015	PMID:34800366

Genomics

Comparative Map Data

Mix23
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	78,166,038 - 78,186,323 (-)	NCBI		GRCr8
mRatBN7.2	11	64,660,711 - 64,681,000 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	64,660,711 - 64,681,000 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	11	73,485,696 - 73,505,976 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	66,147,958 - 66,168,238 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	65,179,206 - 65,199,486 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	67,598,419 - 67,618,704 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	67,598,419 - 67,618,704 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	11	70,685,891 - 70,706,181 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	11	66,497,108 - 66,518,067 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	11	64,128,930 - 64,149,211 (-)	NCBI		Celera
Cytogenetic Map	11	q22	NCBI

MIX23
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	122,359,591 - 122,383,231 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	122,359,591 - 122,383,231 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	122,078,438 - 122,102,078 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	123,561,126 - 123,584,764 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	3	120,488,064 - 120,511,702 (-)	NCBI		Celera
Cytogenetic Map	3	q21.1	NCBI
HuRef	3	119,451,754 - 119,475,393 (-)	NCBI		HuRef
CHM1_1	3	122,041,957 - 122,065,559 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	125,079,165 - 125,102,783 (-)	NCBI		T2T-CHM13v2.0

Mix23
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	35,892,030 - 35,912,488 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	35,892,055 - 35,912,490 (+)	Ensembl		GRCm39 Ensembl
GRCm38	16	36,071,660 - 36,092,118 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	36,071,685 - 36,092,120 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	16	36,071,746 - 36,092,204 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	16	35,991,432 - 36,011,413 (+)	NCBI		MGSCv36	mm8
Celera	16	36,554,962 - 36,575,941 (+)	NCBI		Celera
Cytogenetic Map	16	B3	NCBI
cM Map	16	25.43	NCBI

Mix23
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955427	21,639,392 - 21,667,696 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955427	21,639,392 - 21,667,642 (-)	NCBI	ChiLan1.0	ChiLan1.0

MIX23
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	120,305,092 - 120,328,814 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	120,309,680 - 120,333,594 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	119,447,990 - 119,473,899 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	126,356,033 - 126,379,627 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	126,356,033 - 126,379,627 (-)	Ensembl	panpan1.1		panPan2

MIX23
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	33	25,498,248 - 25,524,037 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	33	25,500,540 - 25,524,063 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	33	25,525,298 - 25,548,627 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	33	25,736,219 - 25,759,558 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	33	25,736,236 - 25,759,543 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	33	25,533,461 - 25,556,620 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	33	25,576,226 - 25,599,542 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	33	26,134,152 - 26,157,820 (-)	NCBI		UU_Cfam_GSD_1.0

Mix23
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	128,825,203 - 128,850,758 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936536	8,671,172 - 8,696,886 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936536	8,671,244 - 8,696,754 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MIX23
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	138,152,491 - 138,178,444 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	138,152,426 - 138,178,458 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	147,763,368 - 147,842,723 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MIX23
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	58,477,053 - 58,501,342 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	58,489,161 - 58,502,366 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	107,841,280 - 107,865,562 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mix23
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624912	694,859 - 727,275 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624912	696,488 - 739,862 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Mix23
79 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	167
Count of miRNA genes:	114
Interacting mature miRNAs:	126
Transcripts:	ENSRNOT00000042208
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300147	Bp187	Blood pressure QTL 187	3.67		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	11	1	69446234	Rat
724554	Iddm17	Insulin dependent diabetes mellitus QTL 17		0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	18976208	86241447	Rat
70208	Niddm22	Non-insulin dependent diabetes mellitus QTL 22	3.61		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	11	59802794	82566553	Rat
70180	BpQTLcluster10	Blood pressure QTL cluster 10	3.19		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	11	34918041	79918041	Rat
1581565	Pur10	Proteinuria QTL 10		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	44803318	82846466	Rat
4889859	Pur28	Proteinuria QTL 28	19.5	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	11	45459323	75190161	Rat
8694376	Bw156	Body weight QTL 156	2.25	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	23280456	68280456	Rat
10755497	Bp388	Blood pressure QTL 388	2.76		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	19456205	76331918	Rat
10058952	Gmadr6	Adrenal mass QTL 6	2.29	0.0072	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	11	22959403	67959403	Rat
10058954	Gmadr7	Adrenal mass QTL 7	2.49	0.0049	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	11	60346590	86241447	Rat
1558659	Tescar1	Testicular tumor resistance QTL 1	3.9		testis integrity trait (VT:0010572)	percentage of study population developing testis tumors during a period of time (CMO:0001261)	11	1041931	66113562	Rat
2298551	Neuinf10	Neuroinflammation QTL 10	3.7		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	11	31239134	78851519	Rat
1300135	Rf19	Renal function QTL 19	3.38		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	11	40946188	82566702	Rat
2312566	Glom20	Glomerulus QTL 20	3.6	0.001	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	11	44285759	82566702	Rat
724563	Uae10	Urinary albumin excretion QTL 10	6		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	11	27672410	82846715	Rat
9589032	Epfw10	Epididymal fat weight QTL 10	9.29	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	11	23280456	68280456	Rat
724561	Plsm4	Polydactyly-luxate syndrome (PLS) morphotypes QTL 4		0.0003	forelimb integrity trait (VT:0010562)	front foot phalanges count (CMO:0001947)	11	54457534	86241447	Rat
9590313	Scort20	Serum corticosterone level QTL 20	6.51	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	11	23280456	68280456	Rat
4889521	Gluco62	Glucose level QTL 62	2.82	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	55136729	82993457	Rat
7411658	Foco27	Food consumption QTL 27	16.2	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	11	56351424	86241447	Rat
631506	Bp104	Blood pressure QTL 104	2.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	59802794	82566545	Rat
8694424	Bw162	Body weight QTL 162	3.8	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	23280456	68280456	Rat
1581572	Uae35	Urinary albumin excretion QTL 35		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	44803318	82846466	Rat
1300110	Stl7	Serum triglyceride level QTL 7	4.64		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	11	29528418	82566702	Rat

Markers in Region

RH139177

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	11	78,185,475 - 78,186,000 (+)	Marker Load Pipeline
mRatBN7.2	11	64,680,152 - 64,680,677 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	67,617,857 - 67,618,381	NCBI	Rnor6.0
Rnor_5.0	11	70,705,334 - 70,705,858	UniSTS	Rnor5.0
RGSC_v3.4	11	66,517,220 - 66,517,744	UniSTS	RGSC3.4
Celera	11	64,148,364 - 64,148,888	UniSTS
RH 3.4 Map	11	485.4	UniSTS
Cytogenetic Map	11	q22	UniSTS

RH130063

Rat Assembly	Chr	Position (strand)	Source	JBrowse
RH 3.4 Map	14	579.6	UniSTS
Cytogenetic Map	11	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001105875	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270378	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473967	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221021	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000042208 ⟹ ENSRNOP00000047028

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	64,660,711 - 64,681,000 (-)	Ensembl
Rnor_6.0 Ensembl	11	67,598,419 - 67,618,704 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000095212 ⟹ ENSRNOP00000082309

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	64,660,711 - 64,679,074 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114839 ⟹ ENSRNOP00000089537

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	64,660,711 - 64,680,459 (-)	Ensembl

RefSeq Acc Id:

NM_001105875 ⟹ NP_001099345

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	78,166,038 - 78,186,323 (-)	NCBI
mRatBN7.2	11	64,660,711 - 64,681,000 (-)	NCBI
Rnor_6.0	11	67,598,419 - 67,618,704 (-)	NCBI
Rnor_5.0	11	70,685,891 - 70,706,181 (-)	NCBI
RGSC_v3.4	11	66,497,108 - 66,518,067 (-)	RGD
Celera	11	64,128,930 - 64,149,211 (-)	RGD

Sequence:

show sequence

CGGCCGCGGCGCTGGCGCTCAATGTCACCGAGTGCCCGCGTGGGGAGGGCGCAGGCGGGGTGGG
CGGGGCGTGCTGCCGTGACGCAGCGGGCGTGCGGGACGTGCGCGACGAGCAAAGGACCCGGCCA
AGCGCCCTGCCTGCCTGGGCATGAAGGCGGAGGAGGAAGGGCGATGTCTGCCAACTGTGAAGCG
CTGAGTAGTGTTTTCGATCTGTGCAAGCGAGTCACACACGCGGAAGGACTCGGGAGCCTGGGTC
CTATGGCTTTCTGGCTTCGGGAATGTCCGAGGGAAGCCTGCTTTCCACTTAGCTATGTTTTAAA
AAAAATCTAGTTCTCACCGCTTGCCCACTCTCACGGCCCCAAACGCCCCTGTTTGTCGACGCTT
CTTCGCGGTCTCATTCCTCTATGCTCTAGGATCAGAGAGAGGAGGGCAAGCCTTGCTCTCCGCT
CCCCGGGCTCACAGTACTTGCTGTCAGGCAGTACCGCGGACACCTCTGCTCCACGGTGATTGGC
CAGCTGCGGGGTCCTCGCGTTCGTCCAATATGGCGGCGCCCAGTGGCGGTGTGAACTGTGAAGA
GTTCGCCGAGTTCCAGGAATTACTCAAGGTGATGAGGACAATTGATGACAGGATAGTACATGAA
TTAAACACTACGGTTCCAACAGCTTCCTTTGCAGGAAAAATTGATGCCAGCCAAACCTGTAAAC
AACTATATGAGTCTTTGATGGCAGCTCATGTCAGTAGGGACAGAGTTATAAAGAACTGTATAGC
CCAGACCTCAGCAGTAGTAAAACGTCTCCGAGAAGAGAGAGAAAAGAACCTGGATGACTTAACG
TTATTAAAACAACTTAGAAAAGAACAGACAAAGTTGAAATGGATGCAGTCAGAACTCAATGTTG
AAGAAGTGGTAAATGACAGGAGCTGGAAGGTGTTTAATGAACGCTGCCGAATTCACTTCAAGCC
TCCAAAGAATGAGTAGAGAGAGAGTTTTTTCTTAAAAAAGACCCGGTCATCTCGTCGCCTGAGC
ATGACAGATGTCAGCAGGCCAACTTCTGAGAGTGGTCTCTGAGCCAGCAGGTCAAGGCCTTTGG
TTGGTTCAGCCCCATCCAGCCAAGACCGCGAGTCTAATTCTCATAATTATAAAATAATCAATTG
CTATTTTATACTGATTCTGTAAAAAATGTTTTGTAACTATTAAAATAATTTTCTGACTCTGTGT

hide sequence

RefSeq Acc Id:

XM_063270378 ⟹ XP_063126448

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	78,166,045 - 78,183,126 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001099345	(Get FASTA)	NCBI Sequence Viewer
	XP_063126448	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM11289	(Get FASTA)	NCBI Sequence Viewer
	EDM11290	(Get FASTA)	NCBI Sequence Viewer
	EDM11291	(Get FASTA)	NCBI Sequence Viewer
	EDM11292	(Get FASTA)	NCBI Sequence Viewer
	EDM11293	(Get FASTA)	NCBI Sequence Viewer
	EDM11294	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000047028.3
	ENSRNOP00000082309.1
	ENSRNOP00000089537.1

RefSeq Acc Id:	NP_001099345 ⟸ NM_001105875
- UniProtKB:	D4A305 (UniProtKB/TrEMBL), A6IRD9 (UniProtKB/TrEMBL), A6IRE0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAAPSGGVNCEEFAEFQELLKVMRTIDDRIVHELNTTVPTASFAGKIDASQTCKQLYESLMAAH VSRDRVIKNCIAQTSAVVKRLREEREKNLDDLTLLKQLRKEQTKLKWMQSELNVEEVVNDRSWK VFNERCRIHFKPPKNE hide sequence

Ensembl Acc Id:

ENSRNOP00000047028 ⟸ ENSRNOT00000042208

Ensembl Acc Id:

ENSRNOP00000082309 ⟸ ENSRNOT00000095212

Ensembl Acc Id:

ENSRNOP00000089537 ⟸ ENSRNOT00000114839

RefSeq Acc Id:	XP_063126448 ⟸ XM_063270378
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5ZWL7 (UniProtKB/TrEMBL), A6IRE0 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A305-F1-model_v2	AlphaFold	D4A305	1-144	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698184

Promoter ID:

EPDNEW_R8709

Type:

single initiation site

Name:

Ccdc58_1

Description:

coiled-coil domain containing 58

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	11	67,618,170 - 67,618,230	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1564582	AgrOrtholog
BioCyc Gene	G2FUF-21212	BioCyc
Ensembl Genes	ENSRNOG00000031653	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000042208.4	UniProtKB/TrEMBL
	ENSRNOT00000095212.1	UniProtKB/TrEMBL
	ENSRNOT00000114839.1	UniProtKB/TrEMBL
InterPro	Caffeine_induced_death_Cid2	UniProtKB/TrEMBL
KEGG Report	rno:288065	UniProtKB/TrEMBL
NCBI Gene	288065	ENTREZGENE
PANTHER	PROTEIN MIX23	UniProtKB/TrEMBL
	PTHR31905	UniProtKB/TrEMBL
Pfam	Cid2	UniProtKB/TrEMBL
PhenoGen	Mix23	PhenoGen
RatGTEx	ENSRNOG00000031653	RatGTEx
UniProt	A0A8I5ZWL7	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A8F4_RAT	UniProtKB/TrEMBL
	A6IRD9	ENTREZGENE, UniProtKB/TrEMBL
	A6IRE0	ENTREZGENE, UniProtKB/TrEMBL
	D4A305	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2020-11-12	Mix23	mitochondrial matrix import factor 23	Ccdc58	coiled-coil domain containing 58	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Ccdc58	coiled-coil domain containing 58	Ccdc58_predicted	coiled-coil domain containing 58 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-30	Ccdc58_predicted	coiled-coil domain containing 58 (predicted)	RGD1564582_predicted	RGD1564582 (predicted)	Symbol and Name updated	1299863	APPROVED
2006-03-07	RGD1564582_predicted	RGD1564582 (predicted)	LOC288065	hypothetical LOC288065	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC288065	hypothetical LOC288065			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar