Advanced Search (OLGA)

Gene: Srrd (SRR1 domain containing) Rattus norvegicus

Analyze

Symbol:

Srrd

Name:

SRR1 domain containing

RGD ID:

1562579

Description:

Predicted to be involved in regulation of circadian rhythm and regulation of heme biosynthetic process. Predicted to be located in cytoplasm. Orthologous to human SRRD (SRR1 domain containing); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; gentamycin.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC288717; RGD1562579; similar to SRR1-like protein; SRR1-like protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SRRD (SRR1 domain containing)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Srrd (SRR1 domain containing)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Srrd (SRR1 domain containing)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SRRD (SRR1 domain containing)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SRRD (SRR1 domain containing)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Srrd (SRR1 domain containing)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SRRD (SRR1 domain containing)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SRRD (SRR1 domain containing)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Srrd (SRR1 domain containing)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	SRRD (SRR1 domain containing)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Srrd (SRR1 domain containing)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	srrd (SRR1 domain containing)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	BER1	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG7988	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	49,955,081 - 49,960,693 (+)	NCBI		GRCr8
mRatBN7.2	12	44,294,675 - 44,300,287 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	44,294,271 - 44,300,287 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	45,463,654 - 45,469,266 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	46,073,930 - 46,079,542 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	45,134,468 - 45,140,080 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	50,315,876 - 50,321,488 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	50,315,933 - 50,321,144 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	52,072,936 - 52,078,566 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	14,318,678 - 14,324,706 (-)	ENTREZGENE	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.4	19	14,318,678 - 14,324,706 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	12	45,877,839 - 45,883,451 (+)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

cataract 23 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4,4'-sulfonyldiphenol (ISO)

atrazine (ISO)

bisphenol A (EXP)

CGP 52608 (ISO)

chlorpyrifos (ISO)

cylindrospermopsin (ISO)

Dibutyl phosphate (ISO)

dicrotophos (ISO)

gentamycin (EXP)

paracetamol (EXP,ISO)

resveratrol (ISO)

temozolomide (ISO)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (EXP)

thalidomide (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

regulation of circadian rhythm (ISO)

regulation of heme biosynthetic process (ISO)

Cellular Component

cytoplasm (IBA,ISO)

nucleus (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:28802827

Genomics

Comparative Map Data

Srrd
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	49,955,081 - 49,960,693 (+)	NCBI		GRCr8
mRatBN7.2	12	44,294,675 - 44,300,287 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	44,294,271 - 44,300,287 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	45,463,654 - 45,469,266 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	46,073,930 - 46,079,542 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	45,134,468 - 45,140,080 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	50,315,876 - 50,321,488 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	50,315,933 - 50,321,144 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	52,072,936 - 52,078,566 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	14,318,678 - 14,324,706 (-)	ENTREZGENE	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.4	19	14,318,678 - 14,324,706 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	12	45,877,839 - 45,883,451 (+)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

SRRD
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	22	26,483,877 - 26,494,658 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	22	26,483,877 - 26,494,658 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	22	26,879,843 - 26,890,624 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	22	25,209,850 - 25,217,904 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	22	10,683,724 - 10,691,766 (+)	NCBI		Celera
Cytogenetic Map	22	q12.1	NCBI
HuRef	22	9,827,403 - 9,835,469 (+)	NCBI		HuRef
CHM1_1	22	26,839,268 - 26,847,300 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	22	26,946,287 - 26,957,060 (+)	NCBI		T2T-CHM13v2.0

Srrd
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	112,485,257 - 112,490,921 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	112,485,258 - 112,490,906 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	112,337,391 - 112,343,040 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	112,337,392 - 112,343,040 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	112,766,411 - 112,772,060 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	112,577,651 - 112,583,345 (-)	NCBI		MGSCv36	mm8
Celera	5	109,457,384 - 109,462,989 (-)	NCBI		Celera
Cytogenetic Map	5	F	NCBI
cM Map	5	54.69	NCBI

Srrd
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955455	1,075,652 - 1,083,102 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955455	1,076,113 - 1,090,346 (+)	NCBI	ChiLan1.0	ChiLan1.0

SRRD
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	23	36,489,446 - 36,504,347 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	22	39,188,625 - 39,203,521 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	22	7,545,779 - 7,559,431 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	22	25,268,684 - 25,276,668 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	22	25,268,727 - 25,276,402 (+)	Ensembl	panpan1.1		panPan2

SRRD
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	20,172,236 - 20,186,236 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	20,023,419 - 20,042,580 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	20,523,003 - 20,542,113 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	20,521,398 - 20,543,245 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	20,239,596 - 20,258,852 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	20,495,514 - 20,514,617 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	20,564,925 - 20,584,442 (+)	NCBI		UU_Cfam_GSD_1.0

Srrd
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	114,758,191 - 114,765,874 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936657	1,104,833 - 1,112,374 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936657	1,104,833 - 1,112,854 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SRRD
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	44,073,638 - 44,096,954 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	44,073,562 - 44,097,998 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	46,953,473 - 46,977,031 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SRRD
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	19	9,387,861 - 9,396,219 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	19	9,387,648 - 9,395,955 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	116,707,973 - 116,717,014 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Srrd
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624747	3,033,745 - 3,041,090 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624747	3,033,705 - 3,041,667 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Srrd
23 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	81
Count of miRNA genes:	66
Interacting mature miRNAs:	71
Transcripts:	ENSRNOT00000000826
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	19144362	46669029	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
8693635	Alc28	Alcohol consumption QTL 28	2.7	0.439	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	23081340	44726024	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	20328819	46669029	Rat
61324	Eae5	Experimental allergic encephalomyelitis QTL 5	14		nervous system integrity trait (VT:0010566)	percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402)	12	19610870	46669029	Rat
1549912	Bp268	Blood pressure QTL 268			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	13182736	46669029	Rat
2302060	Pia37	Pristane induced arthritis QTL 37	6.1	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	13198157	46669029	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	12812385	46669029	Rat
1300162	Bp188	Blood pressure QTL 188	3.19		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	32103174	45899022	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564498	46669029	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	9603277	46669029	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	6107579	46669029	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
1549902	Bp269	Blood pressure QTL 269			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	13182736	46669029	Rat
1600386	Calcic2	Intracellular calcium level QTL 2		0.001	platelet physiology trait (VT:0005464)	platelet intracellular calcium level (CMO:0000922)	12	28064433	46669029	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	7196730	46669029	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	12351619	46669029	Rat
1300175	Cm5	Cardiac mass QTL 5	3.78		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	28064433	45899022	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	10474137	46669029	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	45055165	Rat
634351	Apr5	Acute phase response QTL 5	6.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	12	1	44503507	Rat
634350	Apr4	Acute phase response QTL 4	6		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	1172005	46172005	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	5564495	46669029	Rat
737979	Pia22	Pristane induced arthritis QTL 22	53.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	1	44465750	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	12812385	46669029	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
2302042	Pia38	Pristane induced arthritis QTL 38	3.5	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	1	44503507	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	10474137	46669029	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat

Markers in Region

AA957943

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	44,300,129 - 44,300,250 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	50,321,331 - 50,321,451	NCBI	Rnor6.0
Rnor_5.0	12	52,078,409 - 52,078,529	UniSTS	Rnor5.0
RGSC_v3.4	19	14,319,177 - 14,319,297	UniSTS	RGSC3.4
Celera	12	45,883,294 - 45,883,414	UniSTS
RH 3.4 Map	12	776.22	UniSTS
Cytogenetic Map	19	p11	UniSTS

BI282368

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	44,299,873 - 44,300,088 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	50,321,075 - 50,321,289	NCBI	Rnor6.0
Rnor_5.0	12	52,078,153 - 52,078,367	UniSTS	Rnor5.0
RGSC_v3.4	19	14,319,339 - 14,319,553	UniSTS	RGSC3.4
Celera	12	45,883,038 - 45,883,252	UniSTS
Cytogenetic Map	19	p11	UniSTS

AA957943

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	44,300,006 - 44,300,203 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	50,321,208 - 50,321,404	NCBI	Rnor6.0
Rnor_5.0	12	52,078,286 - 52,078,482	UniSTS	Rnor5.0
RGSC_v3.4	19	14,319,224 - 14,319,420	UniSTS	RGSC3.4
Celera	12	45,883,171 - 45,883,367	UniSTS
RH 3.4 Map	12	776.22	UniSTS
Cytogenetic Map	19	p11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001305154	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC123358	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000000826 ⟹ ENSRNOP00000000826

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	44,294,708 - 44,300,282 (+)	Ensembl
Rnor_6.0 Ensembl	12	50,315,933 - 50,321,144 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114064 ⟹ ENSRNOP00000094420

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	44,294,271 - 44,300,287 (+)	Ensembl

RefSeq Acc Id:

NM_001305154 ⟹ NP_001292083

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	49,955,081 - 49,960,693 (+)	NCBI
mRatBN7.2	12	44,294,675 - 44,300,287 (+)	NCBI
Rnor_6.0	12	50,315,876 - 50,321,488 (+)	NCBI
Celera	12	45,877,839 - 45,883,451 (+)	NCBI

Sequence:

show sequence

ATGTCGGCGGCTTGGCGGCCGCTCTGGCGCGCTGGTGACGTCAGTGACATGGCGGCGGTCGTGG
CGGCTTCCGAACGGTGGAGTGCAGTGGCCCGGCGGAGGAAGCGCGCGGCAGGGAGACGGCCGCG
GCAGGGCGAGGAGCCCCAGGCAGAGCCGGAGGCGGACAGCGAGGCGGTGCTGCGCCGCCTGCTG
GAGGCCGAGGAGGACCTGCGGATCTCTGATTTCTGCAGTTCAGCTCTGGAAACCATCACCGAGT
GTCTTAGGAAGCAGCTGGAGCAACTGCAGTCCCTAACGGAAGCTCTTGGAAGACTGCACCTTGG
CTCATCACCTGGTGGGTCCGGGGAGCCCTTGGCCTTAAGCACCTCGAATGTGAAGTGTGTATGC
TATGGTCTTGGGACCTTTGCCTCCTGCCCCGCTGCTCGGATCCAGCTTGCTTTTTTGCTTCTCT
TTCTGGAGAAGTGCCAGATCCCCAGAAGTCACTGCTGGGTCTATGACCCTCTATTCAGTCAGAC
TGAGGTTTCCGTTCTCACCTCCCTGGGTGTGACAGTCCTCAGTGAGAATGAGGAAGGCAAGCAC
AGTGTCCAGAGCCAGCCCACTGTCTTCTACATGCCACACTGTGGGACAGCTCTATACAACAACC
TGCTGTGGAGCAACTGGTCTGCAGATGCCCTGTCCAGGGTGGTCATCATCGGGAACAGTTTCCA
AGGCCTCGAGGAAAGGTTGTTGGCGAGGATTCTTCAGGAAAATTACTCATACATTGCAAAGATT
CTGAAAGGCCTGGAGGAGTTCCCACTGCCTCAAACTCCCCAGTACACCGACACCTTCAATGACA
CATCTGTCCACTGGTTCCCTCTTCTGAAGCTGGAAGGCTTATCTGAGGACCTGTGGGCATCCCG
GGAAGAGCCTGACTACCAGAACTGTGAGGACCTGGAGATCATCAGGAAACCCACAGCCACTCAG
CTGGAGTAGCAGGACACCATTCTCTCCACCTGGGCCAGGGGCCACAGTGCACACCACACCAGCT
CTTTGCTAGGCCGGGACTACAGCCCGACTGGGGACACTGAGTCACATCCTGCCCTGGTGCCATG
GTCTCCCAAATAGAGACGTTATTTACCA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001292083	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM14000	(Get FASTA)	NCBI Sequence Viewer
	EDM14001	(Get FASTA)	NCBI Sequence Viewer
	EDM14002	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000000826.8
	ENSRNOP00000094420.1

RefSeq Acc Id:

NP_001292083 ⟸ NM_001305154

- UniProtKB:

A6J261 (UniProtKB/TrEMBL), A0A8I6AKY0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAAVVAASERWSAVARRRKRAAGRRPRQGEEPQAEPEADSEAVLRRLLEAEEDLRISDFCSSAL
ETITECLRKQLEQLQSLTEALGRLHLGSSPGGSGEPLALSTSNVKCVCYGLGTFASCPAARIQL
AFLLLFLEKCQIPRSHCWVYDPLFSQTEVSVLTSLGVTVLSENEEGKHSVQSQPTVFYMPHCGT
ALYNNLLWSNWSADALSRVVIIGNSFQGLEERLLARILQENYSYIAKILKGLEEFPLPQTPQYT
DTFNDTSVHWFPLLKLEGLSEDLWASREEPDYQNCEDLEIIRKPTATQLE

hide sequence

Ensembl Acc Id:

ENSRNOP00000000826 ⟸ ENSRNOT00000000826

Ensembl Acc Id:

ENSRNOP00000094420 ⟸ ENSRNOT00000114064

Protein Domains

SRR1-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1LTK4-F1-model_v2	AlphaFold	F1LTK4	1-246	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698743

Promoter ID:

EPDNEW_R9252

Type:

multiple initiation site

Name:

Srrd_1

Description:

Mus musculus SRR1 domain containing , transcript variant 1, mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	50,315,915 - 50,315,975	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1562579	AgrOrtholog
BioCyc Gene	G2FUF-18867	BioCyc
Ensembl Genes	ENSRNOG00000000662	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000000826.8	UniProtKB/TrEMBL
	ENSRNOT00000114064.1	UniProtKB/TrEMBL
InterPro	SRR1-like	UniProtKB/TrEMBL
	SRR1L	UniProtKB/TrEMBL
KEGG Report	rno:288717	UniProtKB/TrEMBL
NCBI Gene	288717	ENTREZGENE
PANTHER	PTHR28626	UniProtKB/TrEMBL
	SRR1-LIKE PROTEIN	UniProtKB/TrEMBL
Pfam	SRR1	UniProtKB/TrEMBL
PhenoGen	Srrd	PhenoGen
RatGTEx	ENSRNOG00000000662	RatGTEx
UniProt	A0A8I6AKY0	ENTREZGENE, UniProtKB/TrEMBL
	A6J261	ENTREZGENE, UniProtKB/TrEMBL
	F1LTK4_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-31	Srrd	SRR1 domain containing	RGD1562579_predicted	similar to SRR1-like protein (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1562579_predicted	similar to SRR1-like protein (predicted)	LOC288717	similar to SRR1-like protein	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC288717	similar to SRR1-like protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar