Symbol:
Ethe1
Name:
ETHE1, persulfide dioxygenase
RGD ID:
1311034
Description:
Predicted to enable identical protein binding activity; iron ion binding activity; and sulfur dioxygenase activity. Predicted to be involved in glutathione metabolic process and hydrogen sulfide metabolic process. Predicted to be located in mitochondrion and nucleoplasm. Human ortholog(s) of this gene implicated in ethylmalonic encephalopathy. Orthologous to human ETHE1 (ETHE1 persulfide dioxygenase); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
ethylmalonic encephalopathy 1; LOC292710; persulfide dioxygenase ETHE1, mitochondrial; protein ETHE1, mitochondrial
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ETHE1 (ETHE1 persulfide dioxygenase)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Ethe1 (ethylmalonic encephalopathy 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ethe1 (ETHE1 persulfide dioxygenase)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ETHE1 (ETHE1 persulfide dioxygenase)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ETHE1 (ETHE1 persulfide dioxygenase)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ethe1 (ETHE1 persulfide dioxygenase)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ETHE1 (ETHE1 persulfide dioxygenase)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ETHE1 (ETHE1 persulfide dioxygenase)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ethe1 (ETHE1 persulfide dioxygenase)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
TTLL6 (tubulin tyrosine ligase like 6)
HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
ETHE1 (ETHE1 persulfide dioxygenase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Ethe1 (ethylmalonic encephalopathy 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ethe1 (ETHE1 persulfide dioxygenase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG30022
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
ethe-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ethe1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 89,311,948 - 89,327,000 (+) NCBI GRCr8 mRatBN7.2 1 80,184,037 - 80,199,092 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 80,183,894 - 80,199,052 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 85,576,393 - 85,591,434 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 94,127,481 - 94,142,531 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 87,332,138 - 87,347,179 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 81,457,008 - 81,472,061 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 81,456,984 - 81,472,097 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 82,716,410 - 82,731,463 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 79,875,629 - 79,890,681 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 79,953,739 - 79,968,786 (+) NCBI Celera 1 74,636,910 - 74,651,962 (+) NCBI Celera Cytogenetic Map 1 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ethe1 Rat (1->4)-beta-D-glucan multiple interactions ISO Ethe1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ETHE1 mRNA CTD PMID:36331819 Ethe1 Rat 1,2-dimethylhydrazine multiple interactions ISO Ethe1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ETHE1 mRNA CTD PMID:22206623 Ethe1 Rat 17beta-estradiol affects expression ISO ETHE1 (Homo sapiens) 6480464 Estradiol affects the expression of ETHE1 mRNA CTD PMID:22574217 Ethe1 Rat 17beta-estradiol decreases expression ISO ETHE1 (Homo sapiens) 6480464 Estradiol results in decreased expression of ETHE1 mRNA CTD PMID:31614463 Ethe1 Rat 17beta-estradiol increases expression ISO Ethe1 (Mus musculus) 6480464 Estradiol results in increased expression of ETHE1 mRNA CTD PMID:39298647 Ethe1 Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of ETHE1 mRNA CTD PMID:32145629 Ethe1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ethe1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ETHE1 mRNA CTD PMID:21570461 Ethe1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ETHE1 mRNA CTD PMID:33387578 and PMID:34747641 Ethe1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ETHE1 mRNA CTD PMID:21215274 and PMID:21724226 Ethe1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of ETHE1 mRNA CTD PMID:21346803 Ethe1 Rat 2,6-dimethoxyphenol multiple interactions ISO ETHE1 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Ethe1 Rat 2-palmitoylglycerol increases expression ISO ETHE1 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of ETHE1 mRNA CTD PMID:37199045 Ethe1 Rat 3,3',5-triiodo-L-thyronine increases expression EXP 6480464 Triiodothyronine results in increased expression of ETHE1 mRNA CTD PMID:28299817 Ethe1 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of ETHE1 mRNA CTD PMID:28522335 Ethe1 Rat 4,4'-sulfonyldiphenol multiple interactions ISO Ethe1 (Mus musculus) 6480464 [bisphenol S co-treated with Tretinoin] results in decreased expression of ETHE1 mRNA CTD PMID:30951980 Ethe1 Rat 4,4'-sulfonyldiphenol increases methylation ISO Ethe1 (Mus musculus) 6480464 bisphenol S results in increased methylation of ETHE1 exon CTD PMID:33297965 Ethe1 Rat 4,4'-sulfonyldiphenol increases expression ISO Ethe1 (Mus musculus) 6480464 bisphenol S results in increased expression of ETHE1 mRNA CTD PMID:39298647 Ethe1 Rat 4-hydroxyphenyl retinamide increases expression ISO Ethe1 (Mus musculus) 6480464 Fenretinide results in increased expression of ETHE1 mRNA CTD PMID:28973697 Ethe1 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of ETHE1 mRNA CTD PMID:28959563 Ethe1 Rat actinomycin D multiple interactions ISO ETHE1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of ETHE1 protein CTD PMID:38460933 Ethe1 Rat aldrin increases expression ISO Ethe1 (Mus musculus) 6480464 Aldrin results in increased expression of ETHE1 mRNA CTD PMID:18579281 Ethe1 Rat all-trans-retinoic acid multiple interactions ISO Ethe1 (Mus musculus) 6480464 [bisphenol S co-treated with Tretinoin] results in decreased expression of ETHE1 mRNA CTD PMID:30951980 Ethe1 Rat all-trans-retinoic acid decreases expression ISO ETHE1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of ETHE1 mRNA CTD PMID:33167477 Ethe1 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of ETHE1 mRNA CTD PMID:30779732 Ethe1 Rat antirheumatic drug decreases expression ISO ETHE1 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of ETHE1 mRNA CTD PMID:24449571 Ethe1 Rat arsane multiple interactions ISO ETHE1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ETHE1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ETHE1 mRNA CTD PMID:39836092 Ethe1 Rat arsenic atom multiple interactions ISO ETHE1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ETHE1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ETHE1 mRNA CTD PMID:39836092 Ethe1 Rat arsenous acid decreases expression ISO ETHE1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of ETHE1 mRNA CTD PMID:27829220 Ethe1 Rat arsenous acid decreases response to substance ISO ETHE1 (Homo sapiens) 6480464 ETHE1 protein results in decreased susceptibility to Arsenic Trioxide CTD PMID:20707922 Ethe1 Rat atrazine decreases expression ISO ETHE1 (Homo sapiens) 6480464 Atrazine results in decreased expression of ETHE1 mRNA CTD PMID:22378314 Ethe1 Rat benzo[a]pyrene decreases expression ISO ETHE1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of ETHE1 protein CTD PMID:32717239 Ethe1 Rat benzo[a]pyrene increases methylation ISO ETHE1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of ETHE1 3' UTR and Benzo(a)pyrene results in increased methylation of ETHE1 promoter CTD PMID:27901495 Ethe1 Rat benzo[b]fluoranthene decreases expression ISO Ethe1 (Mus musculus) 6480464 benzo(b)fluoranthene results in decreased expression of ETHE1 mRNA CTD PMID:26377693 Ethe1 Rat beta-lapachone increases expression ISO ETHE1 (Homo sapiens) 6480464 beta-lapachone results in increased expression of ETHE1 mRNA CTD PMID:38218311 Ethe1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ETHE1 mRNA CTD PMID:25181051 more ... Ethe1 Rat bisphenol A decreases expression ISO Ethe1 (Mus musculus) 6480464 bisphenol A results in decreased expression of ETHE1 mRNA CTD PMID:35598803 Ethe1 Rat bisphenol A increases expression ISO Ethe1 (Mus musculus) 6480464 bisphenol A results in increased expression of ETHE1 mRNA CTD PMID:32156529 and PMID:33221593 Ethe1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ETHE1 mRNA CTD PMID:32145629 Ethe1 Rat Bisphenol B increases expression ISO ETHE1 (Homo sapiens) 6480464 bisphenol B results in increased expression of ETHE1 protein CTD PMID:34186270 Ethe1 Rat butanal increases expression ISO ETHE1 (Homo sapiens) 6480464 butyraldehyde results in increased expression of ETHE1 mRNA CTD PMID:26079696 Ethe1 Rat cadmium dichloride affects expression EXP 6480464 Cadmium Chloride affects the expression of ETHE1 mRNA CTD PMID:22110744 Ethe1 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of ETHE1 mRNA CTD PMID:25993096 Ethe1 Rat carbon nanotube decreases expression ISO Ethe1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Ethe1 Rat carbon nanotube increases expression ISO Ethe1 (Mus musculus) 6480464 Nanotubes and Carbon analog results in increased expression of ETHE1 mRNA CTD PMID:25554681 Ethe1 Rat CGP 52608 multiple interactions ISO ETHE1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to ETHE1 gene] CTD PMID:28238834 Ethe1 Rat chlordecone increases expression ISO Ethe1 (Mus musculus) 6480464 Chlordecone results in increased expression of ETHE1 mRNA CTD PMID:33711761 Ethe1 Rat chlorpyrifos decreases expression ISO Ethe1 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of ETHE1 mRNA CTD PMID:37019170 Ethe1 Rat chromium(6+) affects expression ISO Ethe1 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of ETHE1 mRNA CTD PMID:28472532 Ethe1 Rat cisplatin multiple interactions ISO ETHE1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of ETHE1 mRNA CTD PMID:27392435 Ethe1 Rat cisplatin increases expression ISO ETHE1 (Homo sapiens) 6480464 Cisplatin results in increased expression of ETHE1 mRNA CTD PMID:27392435 Ethe1 Rat clofibrate multiple interactions ISO Ethe1 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of ETHE1 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of ETHE1 mRNA] CTD PMID:17585979 Ethe1 Rat clofibric acid affects expression EXP 6480464 Clofibric Acid affects the expression of ETHE1 mRNA CTD PMID:17602206 Ethe1 Rat copper(II) sulfate increases expression ISO Ethe1 (Mus musculus) 6480464 Copper Sulfate results in increased expression of ETHE1 mRNA CTD PMID:18579281 Ethe1 Rat cyclosporin A decreases expression ISO ETHE1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of ETHE1 mRNA CTD PMID:20106945 Ethe1 Rat diarsenic trioxide decreases response to substance ISO ETHE1 (Homo sapiens) 6480464 ETHE1 protein results in decreased susceptibility to Arsenic Trioxide CTD PMID:20707922 Ethe1 Rat diarsenic trioxide decreases expression ISO ETHE1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of ETHE1 mRNA CTD PMID:27829220 Ethe1 Rat dibenz[a,h]anthracene decreases expression ISO Ethe1 (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Ethe1 Rat Dibutyl phosphate affects expression ISO ETHE1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of ETHE1 mRNA CTD PMID:37042841 Ethe1 Rat diquat increases expression ISO Ethe1 (Mus musculus) 6480464 Diquat results in increased expression of ETHE1 mRNA CTD PMID:36851058 Ethe1 Rat diuron increases expression EXP 6480464 Diuron results in increased expression of ETHE1 mRNA CTD PMID:21551480 Ethe1 Rat dorsomorphin multiple interactions ISO ETHE1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ETHE1 mRNA CTD PMID:27188386 Ethe1 Rat doxorubicin decreases expression ISO ETHE1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of ETHE1 mRNA CTD PMID:29803840 Ethe1 Rat epoxiconazole increases expression ISO Ethe1 (Mus musculus) 6480464 epoxiconazole results in increased expression of ETHE1 mRNA CTD PMID:35436446 Ethe1 Rat ethyl methanesulfonate increases expression ISO ETHE1 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of ETHE1 mRNA CTD PMID:23649840 Ethe1 Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of ETHE1 mRNA CTD PMID:23962444 Ethe1 Rat folic acid multiple interactions ISO Ethe1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ETHE1 mRNA CTD PMID:22206623 Ethe1 Rat furfural multiple interactions ISO ETHE1 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Ethe1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of ETHE1 mRNA CTD PMID:33387578 Ethe1 Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of ETHE1 mRNA CTD PMID:24136188 Ethe1 Rat glyphosate decreases expression ISO Ethe1 (Mus musculus) 6480464 Glyphosate results in decreased expression of ETHE1 protein CTD PMID:36173347 Ethe1 Rat hydrogen peroxide affects expression ISO ETHE1 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of ETHE1 mRNA CTD PMID:20044591 Ethe1 Rat inulin multiple interactions ISO Ethe1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of ETHE1 mRNA CTD PMID:36331819 Ethe1 Rat iodide salt increases expression EXP 6480464 Iodides deficiency results in increased expression of ETHE1 protein CTD PMID:26795019 Ethe1 Rat ivermectin decreases expression ISO ETHE1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of ETHE1 protein CTD PMID:32959892 Ethe1 Rat leflunomide decreases expression EXP 6480464 leflunomide results in decreased expression of ETHE1 mRNA CTD PMID:24136188 Ethe1 Rat manganese atom multiple interactions ISO ETHE1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ETHE1 mRNA CTD PMID:39836092 Ethe1 Rat manganese(0) multiple interactions ISO ETHE1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ETHE1 mRNA CTD PMID:39836092 Ethe1 Rat manganese(II) chloride multiple interactions ISO ETHE1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ETHE1 mRNA CTD PMID:39836092 Ethe1 Rat methotrexate affects expression ISO Ethe1 (Mus musculus) 6480464 Methotrexate affects the expression of ETHE1 mRNA CTD PMID:18502557 Ethe1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in decreased expression of ETHE1 mRNA CTD PMID:28943392 Ethe1 Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of ETHE1 mRNA CTD PMID:24136188 Ethe1 Rat nickel atom increases expression ISO ETHE1 (Homo sapiens) 6480464 Nickel results in increased expression of ETHE1 mRNA CTD PMID:25583101 Ethe1 Rat niclosamide increases expression ISO ETHE1 (Homo sapiens) 6480464 Niclosamide results in increased expression of ETHE1 mRNA CTD PMID:36318118 Ethe1 Rat nitrates multiple interactions ISO Ethe1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of ETHE1 mRNA CTD PMID:35964746 Ethe1 Rat Nutlin-3 multiple interactions ISO ETHE1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of ETHE1 protein CTD PMID:38460933 Ethe1 Rat p-toluidine decreases expression EXP 6480464 4-toluidine results in decreased expression of ETHE1 mRNA CTD PMID:27638505 Ethe1 Rat paracetamol multiple interactions ISO Ethe1 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of ETHE1 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of ETHE1 mRNA] CTD PMID:17585979 Ethe1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of ETHE1 mRNA CTD PMID:33387578 Ethe1 Rat paracetamol affects expression ISO ETHE1 (Homo sapiens) 6480464 Acetaminophen affects the expression of ETHE1 mRNA CTD PMID:25704631 Ethe1 Rat paracetamol affects expression ISO Ethe1 (Mus musculus) 6480464 Acetaminophen affects the expression of ETHE1 mRNA CTD PMID:17562736 Ethe1 Rat perfluorododecanoic acid decreases expression EXP 6480464 perfluorododecanoic acid results in decreased expression of ETHE1 protein CTD PMID:26168851 Ethe1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Ethe1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ETHE1 mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of ETHE1 mRNA CTD PMID:36331819 Ethe1 Rat perfluorooctanoic acid increases expression ISO ETHE1 (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of ETHE1 protein CTD PMID:26879310 Ethe1 Rat pirinixic acid multiple interactions ISO ETHE1 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of ETHE1 mRNA CTD PMID:19710929 Ethe1 Rat pirinixic acid increases expression ISO Ethe1 (Mus musculus) 6480464 pirinixic acid results in increased expression of ETHE1 mRNA CTD PMID:17426115 Ethe1 Rat pirinixic acid decreases expression ISO Ethe1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of ETHE1 mRNA CTD PMID:15302862 and PMID:18445702 Ethe1 Rat potassium chromate decreases expression ISO ETHE1 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of ETHE1 mRNA CTD PMID:22714537 Ethe1 Rat resveratrol increases expression ISO Ethe1 (Mus musculus) 6480464 resveratrol results in increased expression of ETHE1 protein CTD PMID:25505154 Ethe1 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of ETHE1 mRNA CTD PMID:28374803 Ethe1 Rat SB 431542 multiple interactions ISO ETHE1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ETHE1 mRNA CTD PMID:27188386 Ethe1 Rat senecionine decreases expression EXP 6480464 senecionine results in decreased expression of ETHE1 mRNA CTD PMID:32419051 Ethe1 Rat sodium arsenite decreases expression ISO ETHE1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of ETHE1 mRNA CTD PMID:38568856 Ethe1 Rat sodium arsenite multiple interactions ISO ETHE1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ETHE1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ETHE1 mRNA CTD PMID:39836092 Ethe1 Rat sodium chloride multiple interactions ISO ETHE1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of ETHE1 protein more ... CTD PMID:38598786 Ethe1 Rat sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of ETHE1 mRNA CTD PMID:25993096 Ethe1 Rat sodium fluoride decreases expression ISO Ethe1 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of ETHE1 protein CTD PMID:28918527 Ethe1 Rat tetrachloroethene decreases expression ISO Ethe1 (Mus musculus) 6480464 Tetrachloroethylene results in decreased expression of ETHE1 mRNA CTD PMID:28973375 Ethe1 Rat tetrachloromethane decreases expression ISO Ethe1 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of ETHE1 mRNA CTD PMID:27339419 and PMID:31919559 Ethe1 Rat thapsigargin decreases expression ISO Ethe1 (Mus musculus) 6480464 Thapsigargin results in decreased expression of ETHE1 protein CTD PMID:24648495 Ethe1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of ETHE1 mRNA CTD PMID:23411599 and PMID:34492290 Ethe1 Rat thioacetamide multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in decreased expression of ETHE1 mRNA CTD PMID:28943392 Ethe1 Rat titanium dioxide increases methylation ISO Ethe1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of ETHE1 promoter CTD PMID:35295148 Ethe1 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of ETHE1 gene CTD PMID:27618143 Ethe1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of ETHE1 mRNA CTD PMID:33387578 Ethe1 Rat tris(2-butoxyethyl) phosphate affects expression ISO ETHE1 (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate affects the expression of ETHE1 mRNA CTD PMID:29024780 Ethe1 Rat troglitazone decreases expression ISO Ethe1 (Mus musculus) 6480464 troglitazone results in decreased expression of ETHE1 protein CTD PMID:18495193 Ethe1 Rat valdecoxib decreases expression EXP 6480464 valdecoxib results in decreased expression of ETHE1 mRNA CTD PMID:24136188 Ethe1 Rat valproic acid affects expression ISO Ethe1 (Mus musculus) 6480464 Valproic Acid affects the expression of ETHE1 mRNA CTD PMID:17292431 Ethe1 Rat valproic acid increases expression ISO Ethe1 (Mus musculus) 6480464 Valproic Acid results in increased expression of ETHE1 mRNA CTD PMID:21427059 Ethe1 Rat valproic acid affects expression ISO ETHE1 (Homo sapiens) 6480464 Valproic Acid affects the expression of ETHE1 mRNA CTD PMID:25979313 Ethe1 Rat valproic acid multiple interactions ISO ETHE1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ETHE1 mRNA CTD PMID:27188386 Ethe1 Rat valproic acid increases expression ISO ETHE1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of ETHE1 mRNA CTD PMID:23179753 more ...
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 2-palmitoylglycerol (ISO) 3,3',5-triiodo-L-thyronine (EXP) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) acrylamide (EXP) actinomycin D (ISO) aldrin (ISO) all-trans-retinoic acid (ISO) amphetamine (EXP) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) atrazine (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) Bisphenol B (ISO) butanal (ISO) cadmium dichloride (EXP) carbon nanotube (ISO) CGP 52608 (ISO) chlordecone (ISO) chlorpyrifos (ISO) chromium(6+) (ISO) cisplatin (ISO) clofibrate (ISO) clofibric acid (EXP) copper(II) sulfate (ISO) cyclosporin A (ISO) diarsenic trioxide (ISO) dibenz[a,h]anthracene (ISO) Dibutyl phosphate (ISO) diquat (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) epoxiconazole (ISO) ethyl methanesulfonate (ISO) fipronil (EXP) folic acid (ISO) furfural (ISO) gentamycin (EXP) glafenine (EXP) glyphosate (ISO) hydrogen peroxide (ISO) inulin (ISO) iodide salt (EXP) ivermectin (ISO) leflunomide (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methotrexate (ISO) N-nitrosodiethylamine (EXP) nefazodone (EXP) nickel atom (ISO) niclosamide (ISO) nitrates (ISO) Nutlin-3 (ISO) p-toluidine (EXP) paracetamol (EXP,ISO) perfluorododecanoic acid (EXP) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) pirinixic acid (ISO) potassium chromate (ISO) resveratrol (ISO) rotenone (EXP) SB 431542 (ISO) senecionine (EXP) sodium arsenite (ISO) sodium chloride (ISO) sodium dichromate (EXP) sodium fluoride (ISO) tetrachloroethene (ISO) tetrachloromethane (ISO) thapsigargin (ISO) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (EXP) tris(2-butoxyethyl) phosphate (ISO) troglitazone (ISO) valdecoxib (EXP) valproic acid (ISO)
Ethe1 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 89,311,948 - 89,327,000 (+) NCBI GRCr8 mRatBN7.2 1 80,184,037 - 80,199,092 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 80,183,894 - 80,199,052 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 85,576,393 - 85,591,434 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 94,127,481 - 94,142,531 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 87,332,138 - 87,347,179 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 81,457,008 - 81,472,061 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 81,456,984 - 81,472,097 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 82,716,410 - 82,731,463 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 79,875,629 - 79,890,681 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 79,953,739 - 79,968,786 (+) NCBI Celera 1 74,636,910 - 74,651,962 (+) NCBI Celera Cytogenetic Map 1 q21 NCBI
ETHE1 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 43,506,719 - 43,527,201 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 43,506,719 - 43,527,230 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 44,010,871 - 44,031,353 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 48,702,711 - 48,723,236 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 48,702,711 - 48,723,236 NCBI Celera 19 40,811,624 - 40,834,029 (-) NCBI Celera Cytogenetic Map 19 q13.31 NCBI HuRef 19 40,440,766 - 40,462,063 (-) NCBI HuRef CHM1_1 19 44,012,533 - 44,033,058 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 46,327,106 - 46,348,785 (-) NCBI T2T-CHM13v2.0
Ethe1 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 24,286,968 - 24,308,350 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 24,286,968 - 24,308,350 (+) Ensembl GRCm39 Ensembl GRCm38 7 24,587,543 - 24,608,925 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 24,587,543 - 24,608,925 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 25,372,562 - 25,393,944 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 24,296,303 - 24,317,685 (+) NCBI MGSCv36 mm8 Celera 7 19,201,450 - 19,222,832 (+) NCBI Celera Cytogenetic Map 7 A3 NCBI cM Map 7 11.66 NCBI
Ethe1 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955555 1,262,802 - 1,279,714 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955555 1,262,860 - 1,279,714 (-) NCBI ChiLan1.0 ChiLan1.0
ETHE1 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 49,664,616 - 49,686,290 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 51,533,548 - 51,555,217 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 40,447,367 - 40,469,037 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3
ETHE1 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 111,583,690 - 111,607,420 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 111,471,522 - 111,607,386 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 111,063,414 - 111,087,138 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 112,193,836 - 112,217,585 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 112,081,868 - 112,217,551 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 111,782,087 - 111,805,730 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 111,415,757 - 111,439,468 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 112,300,036 - 112,323,637 (+) NCBI UU_Cfam_GSD_1.0
Ethe1 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
ETHE1 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 50,375,841 - 50,396,237 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 50,375,836 - 50,395,769 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 46,148,306 - 46,150,857 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ETHE1 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 37,024,015 - 37,045,628 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 37,024,014 - 37,045,737 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666073 16,563,865 - 16,584,962 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ethe1 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 50 Count of miRNA genes: 46 Interacting mature miRNAs: 49 Transcripts: ENSRNOT00000027075 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1578649 Bmd8 Bone mineral density QTL 8 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 49393172 94393172 Rat 1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 78479925 123479925 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 4889929 Bss87 Bone structure and strength QTL 87 6.7 tibia area (VT:1000281) tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722) 1 53895117 82174945 Rat 2313062 Bmd73 Bone mineral density QTL 73 3.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 11481312 82174945 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 1554320 Bmd1 Bone mineral density QTL 1 12.2 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 509108 86060548 Rat 2302059 Pia36 Pristane induced arthritis QTL 36 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 43333002 88333002 Rat 2313065 Bss67 Bone structure and strength QTL 67 3.1 0.0001 tibia area (VT:1000281) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 2313069 Bss68 Bone structure and strength QTL 68 2.9 0.0001 tibia size trait (VT:0100001) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 2313075 Bss66 Bone structure and strength QTL 66 3.4 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 11481312 82174945 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 631512 Scl6 Serum cholesterol level QTL 6 9.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 72197680 90508767 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 2313077 Bss69 Bone structure and strength QTL 69 3.5 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 11481312 82174945 Rat 1549903 Bp267 Blood pressure QTL 267 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 77876254 106047988 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 61342 Bp27 Blood pressure QTL 27 3.4 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 56732668 98773277 Rat 1300172 Bp172 Blood pressure QTL 172 3.56 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 32737273 90665040 Rat 4889962 Bss94 Bone structure and strength QTL 94 3.8 tibia area (VT:1000281) tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722) 1 49361465 82174945 Rat 61344 Bp29 Blood pressure QTL 29 7.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 78350581 123350581 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 6903308 Scl36 Serum cholesterol QTL 36 2 0.0125 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 53863041 90532583 Rat 2313092 Bmd72 Bone mineral density QTL 72 2.5 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 11481312 82174945 Rat 2300164 Bmd44 Bone mineral density QTL 44 5.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 1 56949932 101949932 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 2313097 Bss70 Bone structure and strength QTL 70 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 152025249 Scl82 Serum cholesterol level QTL 82 4.77 blood cholesterol amount (VT:0000180) 1 50343510 99980958 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 77857876 122857876 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 78430536 123430536 Rat 4889919 Bss86 Bone structure and strength QTL 86 4.1 tibia area (VT:1000281) tibia midshaft total cross-sectional area (CMO:0001715) 1 53895117 82174945 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat 61433 Cia2 Collagen induced arthritis QTL 2 5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 78430754 91209302 Rat
RH139493
Rat Assembly Chr Position (strand) Source JBrowse RH 3.4 Map 1 823.9 UniSTS Cytogenetic Map 1 q21 UniSTS
ETHE1
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 1 89,325,673 - 89,326,172 (+) Marker Load Pipeline mRatBN7.2 1 80,197,764 - 80,198,264 (+) MAPPER mRatBN7.2 Rnor_6.0 1 81,470,734 - 81,471,233 NCBI Rnor6.0 Rnor_5.0 1 82,730,136 - 82,730,635 UniSTS Rnor5.0 RGSC_v3.4 1 79,889,354 - 79,889,853 UniSTS RGSC3.4 Celera 1 74,650,635 - 74,651,134 UniSTS Cytogenetic Map 1 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000027075 ⟹ ENSRNOP00000027076
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 80,183,894 - 80,199,052 (+) Ensembl Rnor_6.0 Ensembl 1 81,456,984 - 81,472,097 (+) Ensembl
RefSeq Acc Id:
NM_001106234 ⟹ NP_001099704
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 89,311,948 - 89,327,000 (+) NCBI mRatBN7.2 1 80,184,037 - 80,199,092 (+) NCBI Rnor_6.0 1 81,457,008 - 81,472,061 (+) NCBI Rnor_5.0 1 82,716,410 - 82,731,463 (+) NCBI RGSC_v3.4 1 79,875,629 - 79,890,681 (+) RGD Celera 1 74,636,910 - 74,651,962 (+) RGD
Sequence:
GGACTCTGGCGGGGCCGGCTGCTGGGCTCAGTGTGGAGTGGGCTCTGGCACCATGGCGAGCACGGCCGTCAGAGTCGCCGGGCGGCGGCTGAGCCAGCAAAGCGCATCCGGAGCGCCGGTCCTCCTGC GTCAGATGTTTGAGCCCAAGAGCTGCACCTACACCTACCTGCTGGGTGACCGGGACTCCCGAGAGGCCATCCTGATCGACCCTGTTCTGGAGACAGCGCACCGGGATGCTCAGCTGATTAAGGAGCTG GGGCTGAAGCTGCTCTATGCGGTGAACACCCACTGCCATGCTGATCACATCACGGGCTCAGGGGTTCTCCGATCCCTCCTCCCGGGCTGTCAGTCCGTCATCTCTCGCCTCAGCGGAGCTCAGGCTGA TTTGCATATCGGGGAAGGTGATTCCATCCCCTTTGGACGCTTTGCTTTGGAGACTCGGGCCAGCCCTGGCCACACCCCAGGCTGTGTCACCTTTGTCCTGAATGACCAGAGCATGGCTTTCACTGGAG ATGCCCTACTGATCCGAGGGTGTGGACGAACAGACTTCCAACAAGGTTGCGCGAAGACTTTGTACCACTCAGTGCACGAGAAGATCTTCACACTTCCAGGCAACTGTCTAATCTACCCTGCTCATGAT TACCACGGGCTCACAGTTTCTACTGTGGAGGAGGAACGGACTCTGAACCCACGGCTCACTCTCAGCTGTGAGGAGTTTATCAAGGTCATGGACAACCTGAACTTGCCCAAGCCACATCAGATAGACAT TGCCGTTCCTGCAAATATGCGCTGTGGGGTCCAGACTCCACCTTCCTGATTCATCCCAGCCAGCTGCTCACATCCGTTAAGAAGGCACTAGGTGGGGTGAGGGGAGGGGTGTCACCCCAGGGCCTCTC TCCTCTCCTACCCCTACTCTCACCAGCTACTTCAGCTTCTTAAATAAAGTTTACTTTGATTTTGCCATGAG
hide sequence
RefSeq Acc Id:
NP_001099704 ⟸ NM_001106234
- UniProtKB:
B0BNJ4 (UniProtKB/TrEMBL), A6J903 (UniProtKB/TrEMBL), F7EWE8 (UniProtKB/TrEMBL)
- Sequence:
MASTAVRVAGRRLSQQSASGAPVLLRQMFEPKSCTYTYLLGDRDSREAILIDPVLETAHRDAQLIKELGLKLLYAVNTHCHADHITGSGVLRSLLPGCQSVISRLSGAQADLHIGEGDSIPFGRFALE TRASPGHTPGCVTFVLNDQSMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHEKIFTLPGNCLIYPAHDYHGLTVSTVEEERTLNPRLTLSCEEFIKVMDNLNLPKPHQIDIAVPANMRCGVQTPPS
hide sequence
Ensembl Acc Id:
ENSRNOP00000027076 ⟸ ENSRNOT00000027075
RGD ID: 13689801
Promoter ID: EPDNEW_R325
Type: multiple initiation site
Name: Ethe1_1
Description: ETHE1, persulfide dioxygenase
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 81,457,037 - 81,457,097 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-05-04
Ethe1
ETHE1, persulfide dioxygenase
Ethe1
ethylmalonic encephalopathy 1
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2008-04-30
Ethe1
ethylmalonic encephalopathy 1
Ethe1_predicted
ethylmalonic encephalopathy 1 (predicted)
'predicted' is removed
2292626
APPROVED