Gcat (glycine C-acetyltransferase)

Advanced Search (OLGA)

Gene: Gcat (glycine C-acetyltransferase) Rattus norvegicus

Analyze

Symbol:

Gcat

Name:

glycine C-acetyltransferase

RGD ID:

1307291

Description:

Predicted to enable glycine C-acetyltransferase activity and pyridoxal phosphate binding activity. Predicted to be involved in biosynthetic process and threonine catabolic process. Predicted to be located in nuclear speck. Predicted to be active in mitochondrion. Orthologous to human GCAT (glycine C-acetyltransferase); PARTICIPATES IN dihydropyrimidine dehydrogenase deficiency pathway; dimethylglycine dehydrogenase deficiency pathway; nonketotic hyperglycinemia pathway; INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial; glycine C-acetyltransferase (2-amino-3-ketobutyrate-coenzyme A ligase); LOC366959; MGC109060

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GCAT (glycine C-acetyltransferase)	RGD	RGD
Mus musculus (house mouse):	Gcat (glycine C-acetyltransferase (2-amino-3-ketobutyrate-coenzyme A ligase))	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Gcat (glycine C-acetyltransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GCAT (glycine C-acetyltransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GCAT (glycine C-acetyltransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gcat (glycine C-acetyltransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GCAT (glycine C-acetyltransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GCAT (glycine C-acetyltransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gcat (glycine C-acetyltransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	GCAT (glycine C-acetyltransferase)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gcat (glycine C-acetyltransferase (2-amino-3-ketobutyrate-coenzyme A ligase))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gcat (glycine C-acetyltransferase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG10361	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	T25B9.1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gcat	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	112,475,572 - 112,481,920 (+)	NCBI		GRCr8
mRatBN7.2	7	110,595,126 - 110,601,474 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	110,595,091 - 110,601,473 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	112,344,758 - 112,350,975 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	114,568,289 - 114,574,506 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	114,536,921 - 114,543,140 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	120,263,068 - 120,269,365 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	120,263,054 - 120,269,451 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	120,254,453 - 120,290,686 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	117,003,626 - 117,010,396 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	117,037,855 - 117,044,625 (+)	NCBI
Celera	7	106,929,404 - 106,935,689 (+)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adenylosuccinase lyase deficiency (ISO)

Emery-Dreifuss muscular dystrophy (ISO)

Experimental Liver Cirrhosis (ISO)

myoclonic dystonia 26 (ISO)

neurodegeneration with brain iron accumulation 2A (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,1-dichloroethene (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-diaminotoluene (ISO)

2,4-dinitrotoluene (EXP)

3-methylcholanthrene (ISO)

4,4'-diaminodiphenylmethane (EXP)

6-propyl-2-thiouracil (EXP)

7,12-dimethyltetraphene (ISO)

acetamide (EXP)

acrylamide (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

aristolochic acid A (ISO)

avobenzone (ISO)

belinostat (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

carbon nanotube (ISO)

cisplatin (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

diazinon (ISO)

dibutyl phthalate (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

entinostat (ISO)

fenofibrate (ISO)

folic acid (ISO)

fumonisin B1 (ISO)

indole-3-methanol (EXP)

indometacin (EXP)

N-nitrosodimethylamine (EXP)

nefazodone (EXP)

nickel dichloride (EXP)

nimesulide (EXP)

ozone (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

pirinixic acid (ISO)

resveratrol (ISO)

selenium atom (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

sodium fluoride (ISO)

testosterone (ISO)

testosterone enanthate (ISO)

tetrachloroethene (ISO)

tetrachloromethane (EXP,ISO)

thapsigargin (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

trimellitic anhydride (ISO)

triptonide (ISO)

trovafloxacin (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

biosynthetic process (IEA)

threonine catabolic process (IEA)

Cellular Component

mitochondrion (IBA,ISO)

nuclear speck (IEA,ISO)

nucleoplasm (ISO)

nucleus (ISO)

Molecular Function

glycine C-acetyltransferase activity (IEA)

pyridoxal phosphate binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

dihydropyrimidine dehydrogenase deficiency pathway (ISO)

dimethylglycine dehydrogenase deficiency pathway (ISO)

glycine, serine and threonine metabolic pathway (IEA)

nonketotic hyperglycinemia pathway (ISO)

sarcosinemia pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:12477932	PMID:12865426	PMID:14651853	PMID:18614015

Genomics

Comparative Map Data

Gcat
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	112,475,572 - 112,481,920 (+)	NCBI		GRCr8
mRatBN7.2	7	110,595,126 - 110,601,474 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	110,595,091 - 110,601,473 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	112,344,758 - 112,350,975 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	114,568,289 - 114,574,506 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	114,536,921 - 114,543,140 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	120,263,068 - 120,269,365 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	120,263,054 - 120,269,451 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	120,254,453 - 120,290,686 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	117,003,626 - 117,010,396 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	117,037,855 - 117,044,625 (+)	NCBI
Celera	7	106,929,404 - 106,935,689 (+)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

GCAT
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	22	37,807,934 - 37,817,183 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	22	37,807,905 - 37,817,176 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	22	38,203,941 - 38,213,190 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	22	36,533,901 - 36,542,850 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	22	36,528,454 - 36,537,403	NCBI
Celera	22	22,005,704 - 22,014,976 (+)	NCBI		Celera
Cytogenetic Map	22	q13.1	NCBI
HuRef	22	21,170,909 - 21,180,178 (+)	NCBI		HuRef
CHM1_1	22	38,162,662 - 38,171,933 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	22	38,269,561 - 38,278,815 (+)	NCBI		T2T-CHM13v2.0

Gcat
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	78,915,074 - 78,926,731 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	78,915,074 - 78,922,553 (+)	Ensembl		GRCm39 Ensembl
GRCm39 Ensembl	15	78,915,101 - 78,926,731 (+)	Ensembl		GRCm39 Ensembl
GRCm38	15	79,030,874 - 79,042,531 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	79,030,874 - 79,038,353 (+)	Ensembl	GRCm38		mm10	GRCm38
GRCm38.p6 Ensembl	15	79,030,901 - 79,042,531 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	78,861,304 - 78,872,961 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	78,858,175 - 78,865,609 (+)	NCBI		MGSCv36	mm8
Celera	15	81,132,500 - 81,144,160 (+)	NCBI		Celera
Cytogenetic Map	15	E1	NCBI
cM Map	15	37.7	NCBI

Gcat
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955413	24,184,997 - 24,192,229 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955413	24,184,997 - 24,192,178 (+)	NCBI	ChiLan1.0	ChiLan1.0

GCAT
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	23	47,666,252 - 47,675,318 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	22	50,354,605 - 50,363,681 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	22	18,722,886 - 18,731,963 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	22	36,554,050 - 36,563,429 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	22	36,554,067 - 36,563,429 (+)	Ensembl	panpan1.1		panPan2

GCAT
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	26,821,121 - 26,827,496 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	26,821,027 - 26,827,707 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	26,775,846 - 26,782,054 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	27,612,460 - 27,618,671 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	27,605,669 - 27,619,049 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	27,335,676 - 27,341,859 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	27,644,101 - 27,650,310 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	27,821,320 - 27,827,528 (-)	NCBI		UU_Cfam_GSD_1.0

Gcat
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	10,296,601 - 10,303,032 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936492	3,304,031 - 3,313,475 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936492	3,307,015 - 3,313,441 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GCAT
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	10,027,044 - 10,038,433 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	10,027,133 - 10,038,494 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	7,426,530 - 7,437,953 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GCAT
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	19	20,508,082 - 20,516,911 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	19	20,508,506 - 20,516,732 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	105,275,789 - 105,285,784 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gcat
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624752	10,089,827 - 10,103,515 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624752	10,095,979 - 10,103,442 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Gcat
39 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	80
Count of miRNA genes:	66
Interacting mature miRNAs:	71
Transcripts:	ENSRNOT00000014173
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	43747012	135012528	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	80221299	124373579	Rat
1331731	Bp216	Blood pressure QTL 216	2.851		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	102297359	133492884	Rat
2298475	Eau6	Experimental allergic uveoretinitis QTL 6		0.0029	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	7	84257275	129257275	Rat
71114	Niddm14	Non-insulin dependent diabetes mellitus QTL 14	4.5		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	7	84257275	129257275	Rat
1357336	Gluco6	Glucose level QTL 6	3.4		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	7	94811326	116294265	Rat
70159	Bp61	Blood pressure QTL 61		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	103146217	116738842	Rat
631687	Hcas1	Hepatocarcinoma susceptibility QTL 1	3.9	0.001	liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	7	91412594	129807172	Rat
1357338	Stl17	Serum triglyceride level QTL 17	3.23		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	69736356	112729554	Rat
634331	Pia17	Pristane induced arthritis QTL 17	4.7		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	7	73829340	130221005	Rat
1358914	Bp266	Blood pressure QTL 266			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	44421311	118198041	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	83153392	128153392	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	64002457	135012528	Rat
1549899	Stresp8	Stress response QTL 8	4.37	0.0008	stress-related behavior trait (VT:0010451)	defensive burying duration (CMO:0001961)	7	90482196	135012528	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	81737938	126737938	Rat
731176	Glom5	Glomerulus QTL 5	2.5	0.0035	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	7	96670164	135012528	Rat
2306821	Bp335	Blood pressure QTL 335		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	106571501	135012528	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
1558655	Swd4	Spike wave discharge measurement QTL 4	3.68	0.0002	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge severity grade (CMO:0001988)	7	86983365	131983365	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	80221299	125221299	Rat
731174	Uae23	Urinary albumin excretion QTL 23	2.4	0.0042	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	7	104603555	135012528	Rat
2313102	Bmd79	Bone mineral density QTL 79	2.3	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	7	94811085	116738842	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	41333674	119109060	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	68938720	113886318	Rat
1331746	Kidm9	Kidney mass QTL 9	3.934		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	7	80221299	112308525	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
2299163	Iddm34	Insulin dependent diabetes mellitus QTL 34	2.71		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	7	91281130	135012528	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	68938720	113886318	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	68938720	113886318	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	69736226	117455174	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat

Markers in Region

D7Wox47

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	110,605,830 - 110,605,979 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	120,273,722 - 120,273,876	NCBI	Rnor6.0
Rnor_5.0	7	120,264,722 - 120,264,876	UniSTS	Rnor5.0
RGSC_v3.4	7	117,014,753 - 117,014,907	UniSTS	RGSC3.4
Celera	7	106,940,046 - 106,940,199	UniSTS
Cytogenetic Map	7	q34	UniSTS

U18295

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	110,593,725 - 110,593,889 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	120,261,668 - 120,261,831	NCBI	Rnor6.0
Rnor_5.0	7	120,253,053 - 120,253,216	UniSTS	Rnor5.0
RGSC_v3.4	7	117,002,226 - 117,002,389	UniSTS	RGSC3.4
Celera	7	106,928,004 - 106,928,167	UniSTS
Cytogenetic Map	7	q34	UniSTS

BI278594

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	110,617,212 - 110,617,425 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	120,285,113 - 120,285,325	NCBI	Rnor6.0
Rnor_5.0	7	120,276,113 - 120,276,325	UniSTS	Rnor5.0
RGSC_v3.4	7	117,026,590 - 117,026,802	UniSTS	RGSC3.4
Celera	7	106,951,525 - 106,951,737	UniSTS
RH 3.4 Map	7	817.8	UniSTS
Cytogenetic Map	7	q34	UniSTS

RH128164

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	110,593,931 - 110,594,428 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	120,261,874 - 120,262,370	NCBI	Rnor6.0
Rnor_5.0	7	120,253,259 - 120,253,755	UniSTS	Rnor5.0
RGSC_v3.4	7	117,002,432 - 117,002,928	UniSTS	RGSC3.4
Celera	7	106,928,210 - 106,928,706	UniSTS
Cytogenetic Map	7	q34	UniSTS

AW531813

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	110,608,753 - 110,608,927 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	120,276,650 - 120,276,823	NCBI	Rnor6.0
Rnor_5.0	7	120,267,650 - 120,267,823	UniSTS	Rnor5.0
RGSC_v3.4	7	117,018,127 - 117,018,300	UniSTS	RGSC3.4
Celera	7	106,943,060 - 106,943,233	UniSTS
RH 3.4 Map	7	819.3	UniSTS
Cytogenetic Map	7	q34	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001024277	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC096473	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC092591	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000078383 ⟹ ENSRNOP00000072331

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	110,595,091 - 110,601,473 (+)	Ensembl
Rnor_6.0 Ensembl	7	120,263,054 - 120,269,451 (+)	Ensembl

RefSeq Acc Id:

NM_001024277 ⟹ NP_001019448

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	112,475,572 - 112,481,920 (+)	NCBI
mRatBN7.2	7	110,595,126 - 110,601,474 (+)	NCBI
Rnor_6.0	7	120,263,068 - 120,269,365 (+)	NCBI
Rnor_5.0	7	120,254,453 - 120,290,686 (+)	NCBI
RGSC_v3.4	7	117,003,626 - 117,010,396 (+)	RGD
Celera	7	106,929,404 - 106,935,689 (+)	RGD

Sequence:

show sequence

GATGTGGGTCAACTTCTTGTGGCGCGCGGCGCTGTCCCCCGGCCGCCGTGCTCACTCAGCGCTG
GCTCAGCTGCGCTGCGTCCTGGACCGCGAGCTGGAAGGGATCCGCGGAGCCGGCACCTGGAAGA
GTGAGCGGGTGATCACGTCCCGCCAGGGACCGTGTATCCGCGTGGAAGGCATCTCCGGAGGAAT
CCTCAACTTCTGTGCCAATAACTACCTGGGCCTGAGCAGCCACCCTGAGGTGATCCAGGCAGGT
CTGCAGGCTCTGGAGGAGTTTGGAGCTGGCCTCATTTCTACTCGCTTTATATGTGGGACCCAGA
GCATCCATAAGAATCTAGAAGCCAAGATAGCCCGCTTCCACCAGCGCGAGGACGCCATCCTCTA
TCCCAGCTGTTTTGATGCCAACACTGGCCTATTTGAGGCTCTGCTGACCCCAGAGGATGCAGTT
CTGTCAGATGAGCTGAACCACGCTTCCGTCATCGACGGCATCCGACTGTGCAAGGCCCACAAGT
ACCGTTACCGCCACCTGGACATGGCTGACTTGGAAGCTAAGCTGAAGGAGGCTCAGAAGCACAG
GCTGCGCCTGGTGGCCACGGATGGAGCCTTCTCCATGGATGGTGATGTCGCTCCCCTACAGGAG
ATCTGCCGCCTTGCTGCTCAATATGGTGCCCTGGTCTTTGTGGATGAATGCCACGCCACTGGCT
TTCTTGGGCCCACTGGAAGAGGCACAGATGAGCTGCTAGGTGTGATGGACCAGGTCACCATCAT
CAACTCCACTCTGGGGAAGGCGCTGGGTGGAGCATCAGGAGGCTACACCACGGGGCCTGAGCCG
CTGATCTCCCTGATGCGGCAGCGTTCTAGGCCCTACCTCTTCTCCAACAGCCTGCCCCCTGCTG
TTGTTGGCTGTGCTTCTAAGGCCCTGGACCTGCTCATGGAGAGTAATACCATCGTTCAGTCCAT
GGCCGCCAAGACCCGGCGGTTCCGAAGTAAGATGGAAGCCGCCGGCTTCACTATCTCAGGAGCT
GATCACCCCATCTGTCCTGTGATGCTTGGTGATGCCCGGCTGTCCTCTCAAATGGCTGAGGACA
TGCTAAAGAAAGGTATCTTTGTCATTGGATTTAGCTACCCTGTGGTCCCGAAGGGCAAGGCCCG
GATCCGGGTGCAGATCTCAGCCGTACACAGTGAGGAAGACATCGACCGCTGTGTGGAGGCCTTT
GTGGAGGTGGGGAAGCTGCACGGAGCTCTGCCCTAGGCTCAGACCAGAGGCTCTGACTCAACCC
AGAGTTCTAGAGCCTGGTTAAAAATGGGCCTGTAGGGGTTGGGGATTTAGCTCAGTGGTAGAGC
GCTTGCCTAGGAAGCGCAAGGCCCTGGGTTCGGTCCCCAGCTCCGAAAAAAAGAACCAAAAAAA
AAAAAAAAAAAAAAAGGCCTGTACCTGTGGTTAGAGAGACAACAATGTGGAAATTGACTTTGAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001019448	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH92591	(Get FASTA)	NCBI Sequence Viewer
	EDM15831	(Get FASTA)	NCBI Sequence Viewer
	EDM15832	(Get FASTA)	NCBI Sequence Viewer
	EDM15833	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000072331.1

RefSeq Acc Id:

NP_001019448 ⟸ NM_001024277

- UniProtKB:

Q562C3 (UniProtKB/TrEMBL), A0A0G2K2Q2 (UniProtKB/TrEMBL), A6HSN9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MWVNFLWRAALSPGRRAHSALAQLRCVLDRELEGIRGAGTWKSERVITSRQGPCIRVEGISGGI
LNFCANNYLGLSSHPEVIQAGLQALEEFGAGLISTRFICGTQSIHKNLEAKIARFHQREDAILY
PSCFDANTGLFEALLTPEDAVLSDELNHASVIDGIRLCKAHKYRYRHLDMADLEAKLKEAQKHR
LRLVATDGAFSMDGDVAPLQEICRLAAQYGALVFVDECHATGFLGPTGRGTDELLGVMDQVTII
NSTLGKALGGASGGYTTGPEPLISLMRQRSRPYLFSNSLPPAVVGCASKALDLLMESNTIVQSM
AAKTRRFRSKMEAAGFTISGADHPICPVMLGDARLSSQMAEDMLKKGIFVIGFSYPVVPKGKAR
IRVQISAVHSEEDIDRCVEAFVEVGKLHGALP

hide sequence

Ensembl Acc Id:

ENSRNOP00000072331 ⟸ ENSRNOT00000078383

Protein Domains

Aminotransferase class I/classII

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A0G2K2Q2-F1-model_v2	AlphaFold	A0A0G2K2Q2	1-416	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695474

Promoter ID:

EPDNEW_R5999

Type:

initiation region

Name:

Gcat_1

Description:

glycine C-acetyltransferase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	120,263,055 - 120,263,115	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307291	AgrOrtholog
BioCyc Gene	G2FUF-32786	BioCyc
BioCyc Pathway	THREONINE-DEG2-PWY [L-threonine degradation II]	BioCyc
BioCyc Pathway Image	THREONINE-DEG2-PWY	BioCyc
Ensembl Genes	ENSRNOG00000055408	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000078383.2	UniProtKB/TrEMBL
Gene3D-CATH	3.40.640.10	UniProtKB/TrEMBL
	3.90.1150.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7372269	IMAGE-MGC_LOAD
InterPro	2am3keto_CoA_ligase	UniProtKB/TrEMBL
	Aminotrans_II_pyridoxalP_BS	UniProtKB/TrEMBL
	Aminotransferase_I/II	UniProtKB/TrEMBL
	AON_synthase_class-II	UniProtKB/TrEMBL
	PyrdxlP-dep_Trfase_major_dom	UniProtKB/TrEMBL
	PyrdxlP-dep_Trfase_major_sub1	UniProtKB/TrEMBL
	PyrdxlP-dep_Trfase_major_sub2	UniProtKB/TrEMBL
KEGG Report	rno:366959	UniProtKB/TrEMBL
MGC_CLONE	MGC:109060	IMAGE-MGC_LOAD
NCBI Gene	366959	ENTREZGENE
PANTHER	2-AMINO-3-KETOBUTYRATE COENZYME A LIGASE, MITOCHONDRIAL	UniProtKB/TrEMBL
	CLASS II AMINOTRANSFERASE/8-AMINO-7-OXONONANOATE SYNTHASE	UniProtKB/TrEMBL
Pfam	Aminotran_1_2	UniProtKB/TrEMBL
PhenoGen	Gcat	PhenoGen
PROSITE	AA_TRANSFER_CLASS_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000055408	RatGTEx
Superfamily-SCOP	PyrdxlP-dep_Trfase_major	UniProtKB/TrEMBL
UniProt	A0A0G2K2Q2	ENTREZGENE, UniProtKB/TrEMBL
	A6HSN9	ENTREZGENE, UniProtKB/TrEMBL
	A6HSP0_RAT	UniProtKB/TrEMBL
	A6HSP1_RAT	UniProtKB/TrEMBL
	Q562C3	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-08-02	Gcat	glycine C-acetyltransferase	Gcat	glycine C-acetyltransferase (2-amino-3-ketobutyrate-coenzyme A ligase)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Gcat	glycine C-acetyltransferase (2-amino-3-ketobutyrate-coenzyme A ligase)	Gcat_predicted	glycine C-acetyltransferase (2-amino-3-ketobutyrate-coenzyme A ligase) (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Gcat_predicted	glycine C-acetyltransferase (2-amino-3-ketobutyrate-coenzyme A ligase) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways