Suclg2 (succinate-CoA ligase GDP-forming subunit beta)

Gene: Suclg2 (succinate-CoA ligase GDP-forming subunit beta) Rattus norvegicus

Analyze

Symbol:

Suclg2

Name:

succinate-CoA ligase GDP-forming subunit beta

RGD ID:

1305008

Description:

Enables GDP binding activity and succinate-CoA ligase (GDP-forming) activity. Involved in succinate metabolic process; succinyl-CoA metabolic process; and tricarboxylic acid cycle. Part of succinate-CoA ligase complex (GDP-forming). Orthologous to human SUCLG2 (succinate-CoA ligase GDP-forming subunit beta); PARTICIPATES IN citric acid cycle pathway; fumaric aciduria pathway; mitochondrial complex II deficiency pathway; INTERACTS WITH (R)-adrenaline; 17beta-estradiol; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC362404; succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial; succinate-CoA ligase, GDP-forming beta subunit; succinate-CoA ligase, GDP-forming, beta subunit; succinate-Coenzyme A ligase, GDP-forming, beta subunit; succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	129,623,833 - 129,893,937 (-)	NCBI		GRCr8
mRatBN7.2	4	128,067,031 - 128,337,146 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	128,067,033 - 128,337,170 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	133,537,045 - 133,796,153 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	129,311,467 - 129,570,570 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	127,936,011 - 128,195,129 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	127,552,100 - 127,824,970 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	127,552,101 - 127,824,970 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	192,061,200 - 192,333,899 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	129,995,856 - 130,276,182 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	130,240,697 - 130,521,016 (-)	NCBI
Celera	4	116,961,947 - 117,231,527 (-)	NCBI		Celera
Cytogenetic Map	4	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Animal Disease Models (ISO)

endometriosis (ISO)

genetic disease (ISO)

lung adenocarcinoma (ISO)

methylmalonic acidemia (ISO)

mitochondrial DNA depletion syndrome 9 (ISO)

obesity (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

(R)-adrenaline (EXP)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-methyl-4-oxido-2-pyrazin-4-iumcarboxylic acid (ISO)

7H-xanthine (EXP)

9H-xanthine (EXP)

acetamide (EXP)

acrolein (ISO)

acrylamide (ISO)

aflatoxin B1 (ISO)

alpha-hexachlorocyclohexane (EXP)

alpha-pinene (ISO)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

choline (ISO)

chromium trinitrate (ISO)

cisplatin (ISO)

clofibrate (EXP)

clofibric acid (EXP)

cobalt dichloride (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (EXP,ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

folic acid (ISO)

formaldehyde (ISO)

fumonisin B1 (ISO)

gentamycin (EXP)

glyphosate (EXP)

inulin (ISO)

ivermectin (ISO)

L-ascorbic acid (ISO)

L-methionine (ISO)

methapyrilene (EXP)

methotrexate (ISO)

methyl methanesulfonate (ISO)

microcystin-LR (ISO)

N-nitrosodiethylamine (EXP)

N-nitrosomorpholine (EXP)

okadaic acid (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

perfluorododecanoic acid (EXP)

perfluorooctane-1-sulfonic acid (ISO)

phenethyl isothiocyanate (ISO)

phenylmercury acetate (ISO)

phlorizin (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

quercetin (ISO)

resveratrol (ISO)

SB 431542 (ISO)

senecionine (ISO)

sodium nitrate (ISO)

sunitinib (ISO)

temozolomide (ISO)

Tesaglitazar (EXP)

testosterone (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

succinate metabolic process (IDA)

succinyl-CoA metabolic process (IBA,IDA)

tricarboxylic acid cycle (IBA,IDA,IEA)

Cellular Component

mitochondrion (IBA,ISO)

plasma membrane (IEA,ISO)

protein-containing complex (IDA)

succinate-CoA ligase complex (IBA)

succinate-CoA ligase complex (GDP-forming) (IDA,ISO)

Molecular Function

ATP binding (IEA)

GDP binding (IDA)

GTP binding (IEA)

magnesium ion binding (IEA)

protein binding (ISO)

protein-containing complex binding (IDA)

succinate-CoA ligase (ADP-forming) activity (IBA)

succinate-CoA ligase (GDP-forming) activity (IBA,IDA)

Molecular Pathway Annotations Click to see Annotation Detail View

citric acid cycle pathway (IDA,IEA,ISO)

fumaric aciduria pathway (ISO)

mitochondrial complex II deficiency pathway (ISO)

propanoate metabolic pathway (IEA)

pyruvate dehydrogenase E2 deficiency pathway (ISO)

pyruvate dehydrogenase E3 deficiency pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Affinity chromatography and affinity labeling of rat liver succinyl-CoA synthetase.	Ball DJ and Nishimura JS, J Biol Chem. 1980 Nov 25;255(22):10805-12.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Mitochondrial GTP regulates glucose-stimulated insulin secretion.	Kibbey RG, etal., Cell Metab. 2007 Apr;5(4):253-64.
5.	Localization and characterization of the mitochondrial isoform of the nucleoside diphosphate kinase in the pancreatic beta cell: evidence for its complexation with mitochondrial succinyl-CoA synthetase.	Kowluru A, etal., Arch Biochem Biophys. 2002 Feb 15;398(2):160-9.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
8.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
9.	GOA pipeline	RGD automated data pipeline
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:14651853	PMID:18614015

Genomics

Comparative Map Data

Suclg2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	129,623,833 - 129,893,937 (-)	NCBI		GRCr8
mRatBN7.2	4	128,067,031 - 128,337,146 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	128,067,033 - 128,337,170 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	133,537,045 - 133,796,153 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	129,311,467 - 129,570,570 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	127,936,011 - 128,195,129 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	127,552,100 - 127,824,970 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	127,552,101 - 127,824,970 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	192,061,200 - 192,333,899 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	129,995,856 - 130,276,182 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	130,240,697 - 130,521,016 (-)	NCBI
Celera	4	116,961,947 - 117,231,527 (-)	NCBI		Celera
Cytogenetic Map	4	q34	NCBI

SUCLG2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	67,360,460 - 67,654,612 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	67,360,460 - 67,654,612 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	67,410,884 - 67,705,036 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	67,507,833 - 67,787,728 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	3	67,507,835 - 67,787,698	NCBI
Celera	3	67,353,993 - 67,645,444 (-)	NCBI		Celera
Cytogenetic Map	3	p14.1	NCBI
HuRef	3	67,427,311 - 67,718,351 (-)	NCBI		HuRef
CHM1_1	3	67,362,353 - 67,656,266 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	67,405,452 - 67,699,926 (-)	NCBI		T2T-CHM13v2.0

Suclg2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	95,449,992 - 95,695,799 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	95,449,990 - 95,695,781 (-)	Ensembl		GRCm39 Ensembl
GRCm38	6	95,473,009 - 95,718,858 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	95,473,009 - 95,718,800 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	95,424,128 - 95,668,831 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	95,439,609 - 95,684,251 (-)	NCBI		MGSCv36	mm8
Celera	6	97,363,804 - 97,602,843 (-)	NCBI		Celera
Cytogenetic Map	6	D2	NCBI
cM Map	6	44.63	NCBI

Suclg2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955421	20,089,237 - 20,350,843 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955421	20,089,471 - 20,350,334 (+)	NCBI	ChiLan1.0	ChiLan1.0

SUCLG2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	67,297,278 - 67,583,115 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	67,302,066 - 67,587,910 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	67,277,348 - 67,563,181 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	68,646,711 - 68,931,961 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	68,647,738 - 68,931,891 (-)	Ensembl	panpan1.1		panPan2

SUCLG2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	23,915,149 - 24,167,740 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	23,895,802 - 24,182,869 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	23,886,104 - 24,138,714 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	23,942,402 - 24,194,878 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	23,923,303 - 24,210,054 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	23,639,932 - 23,892,783 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	23,985,458 - 24,238,734 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	24,045,666 - 24,298,090 (+)	NCBI		UU_Cfam_GSD_1.0

Suclg2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404942	243,107 - 378,528 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936603	243,113 - 378,528 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936603	243,113 - 378,526 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SUCLG2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	48,823,733 - 49,090,468 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	48,650,851 - 49,090,521 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	53,872,520 - 54,030,696 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SUCLG2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	28,382,612 - 28,677,749 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	28,381,787 - 28,677,742 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	138,141,609 - 138,419,603 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Suclg2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624773	1,818,374 - 2,087,331 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624773	1,816,924 - 2,087,384 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Suclg2
1588 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	519
Count of miRNA genes:	234
Interacting mature miRNAs:	280
Transcripts:	ENSRNOT00000068274
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	38465774	146803430	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	44463720	155883716	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	44463908	148090542	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	44463908	148090542	Rat
2312567	Glom19	Glomerulus QTL 19	1.9	0.006	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	4	45456990	146803430	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	50119848	146803430	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	56647873	149491524	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	59948935	154902892	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
61418	Pia5	Pristane induced arthritis QTL 5	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	62277855	128289560	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	64528739	157573521	Rat
61330	Eau1	Experimental allergic uveoretinitis QTL 1		0.0003	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	4	70362013	132642728	Rat
631646	Stl4	Serum triglyceride level QTL 4	6.5	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	4	73169846	132642728	Rat
70177	Xhs1	X-ray hypersensitivity QTL 1	25.1		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	82798864	152731274	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	83428419	177635233	Rat
634334	Xhs3	X-ray hypersensitivity QTL 3	10		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	84728680	129854654	Rat
1582232	Gluco25	Glucose level QTL 25	3.6	0.0023	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	85253748	148090731	Rat
12798523	Anxrr56	Anxiety related response QTL 56	2.83	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	85253748	150276390	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	85379421	167139601	Rat
61476	Aia3	Adjuvant induced arthritis QTL 3	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	86730991	131730991	Rat
1578662	Bss15	Bone structure and strength QTL 15	19.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	4	87327165	132327165	Rat
1578670	Bss14	Bone structure and strength QTL 14	16.4		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	4	87327165	132327165	Rat
1578655	Bmd11	Bone mineral density QTL 11	11		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	4	90850165	135850165	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	93308457	167139447	Rat
631689	Scl4	Serum cholesterol level QTL 4	1.9	0.008	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	4	95174120	140174120	Rat
61434	Cia3	Collagen induced arthritis QTL 3	4.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	103194656	148194656	Rat
2302049	Pia32	Pristane induced arthritis QTL 32	5.1	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112)	4	105789505	150789505	Rat
731165	Uae21	Urinary albumin excretion QTL 21	2.4	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	106649412	151649412	Rat
61406	Scwia1	Streptococcal cell wall induced arthritis QTL 1	2.3		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	4	106805662	151805662	Rat
7207480	Bss105	Bone structure and strength QTL 105	8.1		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	4	109827074	154827074	Rat
1549832	Bss3	Bone structure and strength QTL 3	11		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	4	109827074	154827074	Rat
737821	Hcar9	Hepatocarcinoma resistance QTL 9	3.7		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	109866907	167139601	Rat
1331759	Hrtrt13	Heart rate QTL 13	3.54628		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	110275411	168266883	Rat
6478760	Anxrr45	Anxiety related response QTL 45		0.06717	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
6478763	Anxrr46	Anxiety related response QTL 46		0.07428	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
12798519	Anxrr54	Anxiety related response QTL 54	2.54	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	114627026	159627026	Rat
1300116	Hrtrt5	Heart rate QTL 5	3.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	116179486	151161268	Rat
724535	Cm18	Cardiac mass QTL 18	2.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	4	118856416	163856416	Rat
1331802	Srn5	Serum renin concentration QTL 5	3.045		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	4	119428175	157578333	Rat
12798527	Anxrr58	Anxiety related response QTL 58	4.11	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	119463257	147278687	Rat
70201	Gcr1	Gastric cancer resistance QTL 1	2.7		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	4	120260281	147278687	Rat
2293840	Kiddil9	Kidney dilation QTL 9	2.9		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	4	120926564	148090731	Rat
634347	Hcar8	Hepatocarcinoma resistance QTL 8	5.8		liver integrity trait (VT:0010547)	liver tumorous lesion area to total liver area ratio (CMO:0001075)	4	123143783	168143783	Rat
631683	Bp116	Blood pressure QTL 116		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	124303370	169303370	Rat
6478778	Anxrr51	Anxiety related response QTL 51		0.25384	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	124778595	169778595	Rat
7411558	Bw133	Body weight QTL 133	13.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	125590636	170590636	Rat
61451	Ciaa4	CIA Autoantibody QTL 4	3.1		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	4	126395976	167139601	Rat

Markers in Region

D4Mit16

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	128,289,450 - 128,289,560 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	127,777,294 - 127,777,403	NCBI	Rnor6.0
Rnor_5.0	4	192,286,223 - 192,286,332	UniSTS	Rnor5.0
RGSC_v3.4	4	130,228,504 - 130,228,614	RGD	RGSC3.4
RGSC_v3.4	4	130,228,505 - 130,228,614	UniSTS	RGSC3.4
RGSC_v3.1	4	130,473,346 - 130,473,455	RGD
Celera	4	117,183,835 - 117,183,944	UniSTS
RH 3.4 Map	4	773.8	RGD
RH 3.4 Map	4	773.8	UniSTS
RH 2.0 Map	4	857.2	RGD
SHRSP x BN Map	4	56.66	RGD
FHH x ACI Map	4	75.85	RGD
Cytogenetic Map	4	q34	UniSTS

RH142916

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	128,335,667 - 128,335,933 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	127,823,492 - 127,823,757	NCBI	Rnor6.0
Rnor_5.0	4	192,332,421 - 192,332,686	UniSTS	Rnor5.0
RGSC_v3.4	4	130,274,704 - 130,274,969	UniSTS	RGSC3.4
Celera	4	117,230,049 - 117,230,314	UniSTS
RH 3.4 Map	4	775.8	UniSTS
Cytogenetic Map	4	q34	UniSTS

RH136847

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	128,067,126 - 128,067,307 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	127,552,196 - 127,552,376	NCBI	Rnor6.0
Rnor_5.0	4	192,061,296 - 192,061,476	UniSTS	Rnor5.0
RGSC_v3.4	4	129,995,952 - 129,996,132	UniSTS	RGSC3.4
Celera	4	116,962,043 - 116,962,223	UniSTS
RH 3.4 Map	4	770.5	UniSTS
Cytogenetic Map	4	q34	UniSTS

AA850481

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	128,067,126 - 128,067,277 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	127,552,196 - 127,552,346	NCBI	Rnor6.0
Rnor_5.0	4	192,061,296 - 192,061,446	UniSTS	Rnor5.0
RGSC_v3.4	4	129,995,952 - 129,996,102	UniSTS	RGSC3.4
Celera	4	116,962,043 - 116,962,193	UniSTS
RH 3.4 Map	4	768.6	UniSTS
Cytogenetic Map	4	q34	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001100750	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC079367	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC089863	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC099746	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC160886	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473957	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000068274 ⟹ ENSRNOP00000060990

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	128,067,033 - 128,337,165 (-)	Ensembl
Rnor_6.0 Ensembl	4	127,552,101 - 127,824,970 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000096122 ⟹ ENSRNOP00000092654

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	128,093,089 - 128,337,170 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000113931 ⟹ ENSRNOP00000082540

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	128,088,138 - 128,337,170 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000116675 ⟹ ENSRNOP00000092604

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	128,091,181 - 128,337,170 (-)	Ensembl

RefSeq Acc Id:

NM_001100750 ⟹ NP_001094220

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	129,623,833 - 129,893,937 (-)	NCBI
mRatBN7.2	4	128,067,031 - 128,337,146 (-)	NCBI
Rnor_6.0	4	127,552,100 - 127,824,970 (-)	NCBI
Rnor_5.0	4	192,061,200 - 192,333,899 (-)	NCBI
RGSC_v3.4	4	129,995,856 - 130,276,182 (-)	RGD
Celera	4	116,961,947 - 117,231,527 (-)	RGD

Sequence:

show sequence

AGATGGCGTCCGCGGTGGCCATCGCGGCCCAGGCCGGGAAGCTTCTGCGAGAGCGATCGCTGCG
GCCCCGACTCTTGGCGGTCAGGTCCCAGGCAGGTCACTTAACCCCCAGGAGATGGCTGAACCTG
CAGGAATACCAGAGCAAGAAGCTCATGTCAGAGCACGGAGTGAGAGTGCAGAGGTTCTTTGTCG
CCAGCACTGCTAAGGAGGCTCAGGAAGCAGCCAAGCGACTGAATGCAAAGGAAATTGTTTTAAA
AGCCCAGATCTTAGCTGGAGGAAGAGGAAAAGGTGTCTTCGATAGCGGTTTGAAAGGAGGTGTT
CATTTAACAAAAGACCCTAAAGTGGTGGGACAGCTGGCTCAGCAGATGATTGGTTATAATCTAG
CAACAAAACAAACTCCAAAAGAAGGTGTGAAAGTTAACAAGGTGATGGTTGCTGAAGCCCTGGA
TATTTCTAGAGAAACGTACTTGGCCATTCTGATGGACCGGTCCCATAATGGCCCTGTGTTAGTA
GGCAGTCCCCAGGGGGGCGTCGATATTGAAGAAGTGGCAGCTTCCAGTCCAGAACTCATCTTTA
AGGAGCAGATTGACATCTTTGAAGGGATAAAGGATAGCCAGGCCCAGCGCATGGCGGAAAATCT
GGGCTTCCTCGGGTCTTTGAAAAACCAGGCTGCAGATCAGATTAAAAAGCTGTACCATCTCTTC
CTGAAGATTGACGCCACTCAGGTAGAAGTGAACCCCTTCGGTGAAACTCCAGAAGGCCAAGTTG
TCTGTTTTGATGCCAAGATAAACTTTGATGACAATGCTGAATTCCGACAAAAGGACATATTTGC
TATGGACGACAAGTCAGAGAATGAACCCATTGAAAATGAAGCTGCCAGATATGATCTCAAATAT
ATAGGTCTAGACGGGAACATCGCCTGCTTTGTGAATGGTGCTGGATTGGCCATGGCTACTTGTG
ACATCATTTTCCTGAATGGAGGGAAGCCAGCTAACTTCTTGGACCTCGGAGGTGGTGTAAAGGA
GTCCCAAGTCTATCAAGCATTCAAACTGCTCACATCTGATCCCAAGGTGGAAGCCATTCTTGTC
AATATCTTTGGTGGGATCGTCAACTGTGCCATCATTGCCAACGGAATCACCAAAGCCTGCCAGG
AGCTAGAGCTCAAGGTGCCACTGGTAGTCCGTCTTGAAGGAACTAATGTCCAGGAGGCTCAGAA
CATCCTCAAAAGCAGCGGACTCCCCATTACGTCAGCTGTGGACCTGGAGGATGCAGCCAAGAAA
GCTGTTGCCAGTGTGGCCAAGAAGTGATGGCTGCCCCTGGCTCCCATGAGGAAGGGCACATCCC
TCACCACTCTGAGAGCTATTGTTTCCTCACTGGGAAGAGGGCACACACAAGGATCATCACATGA
AAAAATATGAAGTCTGAGCTTTCTCCACTATGCTGTCCAGAGTGCCTAACGCTGATTTTATACT
GTAGTCATTGTTTAAAAAAAAATCACTCCTGACAATTTCACACCTTCTCTTGCCCAGTCAGTAG
CAGGGTCTACCAGCTGTGGCCACAGTCATTGTGGCCAAACAGCGTGCATAGGTACAGGATTTGA
AGCCAGATCTAAGTTCATCCTTAAGAACTTTGTGGACATTTTTTCTACAGTAGACAATTTTATA
GGACTCACAAGTTCAGACAGGATTATATTTAACATAGTAACTTCCAGAAGGTTATAGCGAAGAC
ACCTGAGCTTCTGTGAACAGTGGTCTCCACTGTCTCCTAATCCAGTGCATTTAGAAAGACCACA
ACCATTCCAAAGTGTGGCTTATATTGGGCATCCCACGTTAATACATGTACATTGCACACACTTT
ACCCTTTGCCTTAATGTTGAATCTACTGCCTGCCTCACACTGAGTTACAGCCAGAAGCCTTAAT
CACAGGTTTGAAGTGGAAGGTTTCATTTTTTGTCAGAGTTGCTGAATGCTGATTTTTATCAAAC
TGTGCCATTAAGCCATTTCATGAAGAGGAGATCAAGCTGTTGGTGGTGGTCAGGATTTCCCTCT
TGTCCCTTCCACCTCACATCTACCAGTTTGTCACAGAAAGATGAGATGTCATTGGAGAGAATGT
GGCCTTCCTAATGATGTCCTTTTTTGTGACGGGAATTTTCTTAAACTTGATTTCTTTGTTTAAT
TTTAATAAATTTATAGTCATATTTATTTTAAATAAAATTGTTTTTCAGTGCTAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001094220	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79367	(Get FASTA)	NCBI Sequence Viewer
	AAH89863	(Get FASTA)	NCBI Sequence Viewer
	AAH99746	(Get FASTA)	NCBI Sequence Viewer
	AAI60886	(Get FASTA)	NCBI Sequence Viewer
	EDL91414	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000060990
	ENSRNOP00000060990.3
	ENSRNOP00000082540.1
	ENSRNOP00000092604.1
	ENSRNOP00000092654.1

RefSeq Acc Id:

NP_001094220 ⟸ NM_001100750

- UniProtKB:

B1H270 (UniProtKB/TrEMBL), Q68FT4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MASAVAIAAQAGKLLRERSLRPRLLAVRSQAGHLTPRRWLNLQEYQSKKLMSEHGVRVQRFFVA
STAKEAQEAAKRLNAKEIVLKAQILAGGRGKGVFDSGLKGGVHLTKDPKVVGQLAQQMIGYNLA
TKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSHNGPVLVGSPQGGVDIEEVAASSPELIFK
EQIDIFEGIKDSQAQRMAENLGFLGSLKNQAADQIKKLYHLFLKIDATQVEVNPFGETPEGQVV
CFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAARYDLKYIGLDGNIACFVNGAGLAMATCD
IIFLNGGKPANFLDLGGGVKESQVYQAFKLLTSDPKVEAILVNIFGGIVNCAIIANGITKACQE
LELKVPLVVRLEGTNVQEAQNILKSSGLPITSAVDLEDAAKKAVASVAKK

hide sequence

RefSeq Acc Id:

ENSRNOP00000060990 ⟸ ENSRNOT00000068274

RefSeq Acc Id:

ENSRNOP00000092654 ⟸ ENSRNOT00000096122

RefSeq Acc Id:

ENSRNOP00000092604 ⟸ ENSRNOT00000116675

RefSeq Acc Id:

ENSRNOP00000082540 ⟸ ENSRNOT00000113931

Protein Domains

ATP-grasp

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1LPV8-F1-model_v2	AlphaFold	F1LPV8	1-431	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693263

Promoter ID:

EPDNEW_R3788

Type:

multiple initiation site

Name:

Suclg2_1

Description:

succinate-CoA ligase, GDP-forming, beta subunit

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	127,824,982 - 127,825,042	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305008	AgrOrtholog
BioCyc Gene	G2FUF-43626	BioCyc
Ensembl Genes	ENSRNOG00000005686	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000068274	ENTREZGENE
	ENSRNOT00000068274.3	UniProtKB/TrEMBL
	ENSRNOT00000096122.1	UniProtKB/TrEMBL
	ENSRNOT00000113931.1	UniProtKB/TrEMBL
	ENSRNOT00000116675.1	UniProtKB/TrEMBL
Gene3D-CATH	3.30.1490.20	UniProtKB/TrEMBL
	3.40.50.261	UniProtKB/TrEMBL
	ATP-grasp fold, B domain	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:5598387	IMAGE-MGC_LOAD
	IMAGE:7109535	IMAGE-MGC_LOAD
	IMAGE:7127932	IMAGE-MGC_LOAD
	IMAGE:7385389	IMAGE-MGC_LOAD
InterPro	ATP-grasp	UniProtKB/TrEMBL
	ATP-grasp_succ-CoA_synth-type	UniProtKB/TrEMBL
	ATP_grasp_subdomain_1	UniProtKB/TrEMBL
	CoA_ligase	UniProtKB/TrEMBL
	Succ-CoA_synthase_bsu_CS	UniProtKB/TrEMBL
	Succ_CoA_betaG_euk	UniProtKB/TrEMBL
	Succ_CoA_synthase_bsu	UniProtKB/TrEMBL
	Succinyl-CoA_synth-like	UniProtKB/TrEMBL
KEGG Report	rno:362404	UniProtKB/TrEMBL
MGC_CLONE	MGC:108961	IMAGE-MGC_LOAD
	MGC:124752	IMAGE-MGC_LOAD
	MGC:188299	IMAGE-MGC_LOAD
	MGC:94850	IMAGE-MGC_LOAD
NCBI Gene	362404	ENTREZGENE
PANTHER	CoA_lig_beta	UniProtKB/TrEMBL
	SUCCINATE--COA LIGASE [GDP-FORMING] SUBUNIT BETA, MITOCHONDRIAL	UniProtKB/TrEMBL
Pfam	ATP-grasp_2	UniProtKB/TrEMBL
	Ligase_CoA	UniProtKB/TrEMBL
PhenoGen	Suclg2	PhenoGen
PIRSF	SucCS_beta	UniProtKB/TrEMBL
PROSITE	ATP_GRASP	UniProtKB/TrEMBL
	SUCCINYL_COA_LIG_3	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000005686	RatGTEx
Superfamily-SCOP	CoA_ligase	UniProtKB/TrEMBL
	Glutathione synthetase ATP-binding domain-like	UniProtKB/TrEMBL
UniProt	A0A8I5ZV34_RAT	UniProtKB/TrEMBL
	A0A8I6AHY6_RAT	UniProtKB/TrEMBL
	A0A8I6AIH6_RAT	UniProtKB/TrEMBL
	B1H270	ENTREZGENE, UniProtKB/TrEMBL
	F1LPV8_RAT	UniProtKB/TrEMBL
	Q499V7_RAT	UniProtKB/TrEMBL
	Q5EBA9_RAT	UniProtKB/TrEMBL
	Q68FT4	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-12-06	Suclg2	succinate-CoA ligase GDP-forming subunit beta	Suclg2	succinate-CoA ligase, GDP-forming, beta subunit	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-10-23	Suclg2	succinate-CoA ligase, GDP-forming, beta subunit	Suclg2	succinate-Coenzyme A ligase, GDP-forming, beta subunit	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Suclg2	succinate-Coenzyme A ligase, GDP-forming, beta subunit	Suclg2_predicted	succinate-Coenzyme A ligase, GDP-forming, beta subunit (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Suclg2_predicted	succinate-Coenzyme A ligase, GDP-forming, beta subunit (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)