Symbol:
Suclg2
Name:
succinate-Coenzyme A ligase, GDP-forming, beta subunit
RGD ID:
1312780
MGI Page
MGI
Description:
Predicted to enable GDP binding activity; succinate-CoA ligase (GDP-forming) activity; and succinate-semialdehyde dehydrogenase (NAD+) activity. Predicted to be involved in succinate metabolic process; succinyl-CoA metabolic process; and tricarboxylic acid cycle. Located in mitochondrion. Is expressed in several structures, including alimentary system; genitourinary system; nervous system; respiratory system; and sensory organ. Orthologous to human SUCLG2 (succinate-CoA ligase GDP-forming subunit beta).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
AF171077; AW556404; D6Wsu120; D6Wsu120e; G-SCS; GTP-specific succinyl-CoA synthetase beta subunit; GTP-specific succinyl-CoA synthetase subunit beta; GTPSCS; MGC91183; SCS-betaG; succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial; succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial; succinyl-CoA synthetase beta-G chain
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SUCLG2 (succinate-CoA ligase GDP-forming subunit beta) HGNC
Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Suclg2 (succinate-CoA ligase GDP-forming subunit beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Suclg2 (succinate-CoA ligase GDP-forming subunit beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SUCLG2 (succinate-CoA ligase GDP-forming subunit beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SUCLG2 (succinate-CoA ligase GDP-forming subunit beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Suclg2 (succinate-CoA ligase GDP-forming subunit beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SUCLG2 (succinate-CoA ligase GDP-forming subunit beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SUCLG2 (succinate-CoA ligase GDP-forming subunit beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Suclg2 (succinate-CoA ligase GDP-forming subunit beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Suclg2 (succinate-CoA ligase GDP-forming subunit beta)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
SUCLG2 (succinate-CoA ligase GDP-forming subunit beta)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
suclg2 (succinate-CoA ligase, GDP-forming, beta subunit)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
ScsbetaG
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
sucg-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
suclg2
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Related Pseudogenes:
Gm15163
Gm19102
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 95,449,992 - 95,695,799 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 95,449,990 - 95,695,781 (-) Ensembl GRCm39 Ensembl GRCm38 6 95,473,009 - 95,718,858 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 95,473,009 - 95,718,800 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 95,424,128 - 95,668,831 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 95,439,609 - 95,684,251 (-) NCBI MGSCv36 mm8 Celera 6 97,363,804 - 97,602,843 (-) NCBI Celera Cytogenetic Map 6 D2 NCBI cM Map 6 44.63 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Suclg2 Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of SUCLG2 mRNA CTD PMID:36331819 Suclg2 Mouse (R)-adrenaline increases expression ISO Suclg2 (Rattus norvegicus) 6480464 Epinephrine results in increased expression of SUCLG2 protein CTD PMID:19464573 Suclg2 Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SUCLG2 mRNA CTD PMID:22206623 Suclg2 Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of SUCLG2 mRNA CTD PMID:22206623 Suclg2 Mouse 17beta-estradiol multiple interactions ISO Suclg2 (Rattus norvegicus) 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of SUCLG2 mRNA CTD PMID:26496021 Suclg2 Mouse 17beta-estradiol decreases expression ISO Suclg2 (Rattus norvegicus) 6480464 Estradiol results in decreased expression of SUCLG2 mRNA CTD PMID:32145629 Suclg2 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SUCLG2 mRNA CTD PMID:19465110 Suclg2 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of SUCLG2 mRNA CTD PMID:21570461 Suclg2 Mouse 2,4-dinitrotoluene affects expression ISO Suclg2 (Rattus norvegicus) 6480464 2 and 4-dinitrotoluene affects the expression of SUCLG2 mRNA CTD PMID:21346803 Suclg2 Mouse 2,6-dimethoxyphenol multiple interactions ISO SUCLG2 (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in increased expression of SUCLG2 protein CTD PMID:38598786 Suclg2 Mouse 2,6-dinitrotoluene affects expression ISO Suclg2 (Rattus norvegicus) 6480464 2 and 6-dinitrotoluene affects the expression of SUCLG2 mRNA CTD PMID:21346803 Suclg2 Mouse 4,4'-sulfonyldiphenol increases expression ISO SUCLG2 (Homo sapiens) 6480464 bisphenol S results in increased expression of SUCLG2 protein CTD PMID:34186270 Suclg2 Mouse 4-hydroxyphenyl retinamide increases expression EXP 6480464 Fenretinide results in increased expression of SUCLG2 mRNA CTD PMID:28973697 Suclg2 Mouse 5-methyl-4-oxido-2-pyrazin-4-iumcarboxylic acid decreases expression ISO SUCLG2 (Homo sapiens) 6480464 acipimox results in decreased expression of SUCLG2 mRNA CTD PMID:25352640 Suclg2 Mouse 7H-xanthine multiple interactions ISO Suclg2 (Rattus norvegicus) 6480464 [Xanthine co-treated with XDH protein] results in decreased expression of SUCLG2 protein CTD PMID:19464573 Suclg2 Mouse 9H-xanthine multiple interactions ISO Suclg2 (Rattus norvegicus) 6480464 [Xanthine co-treated with XDH protein] results in decreased expression of SUCLG2 protein CTD PMID:19464573 Suclg2 Mouse acetamide decreases expression ISO Suclg2 (Rattus norvegicus) 6480464 acetamide results in decreased expression of SUCLG2 mRNA CTD PMID:31881176 Suclg2 Mouse acrolein multiple interactions ISO SUCLG2 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of SUCLG2 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of SUCLG2 mRNA CTD PMID:32699268 Suclg2 Mouse acrylamide decreases expression ISO SUCLG2 (Homo sapiens) 6480464 Acrylamide results in decreased expression of SUCLG2 mRNA CTD PMID:32763439 Suclg2 Mouse aflatoxin B1 affects expression ISO SUCLG2 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of SUCLG2 protein CTD PMID:20106945 Suclg2 Mouse aflatoxin B1 decreases methylation ISO SUCLG2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of SUCLG2 gene CTD PMID:27153756 Suclg2 Mouse aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of SUCLG2 mRNA CTD PMID:19770486 Suclg2 Mouse alpha-hexachlorocyclohexane increases expression ISO Suclg2 (Rattus norvegicus) 6480464 alpha-hexachlorocyclohexane results in increased expression of SUCLG2 mRNA CTD PMID:16940010 Suclg2 Mouse alpha-pinene multiple interactions ISO SUCLG2 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of SUCLG2 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of SUCLG2 mRNA CTD PMID:32699268 Suclg2 Mouse aristolochic acid A decreases expression ISO SUCLG2 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of SUCLG2 mRNA CTD PMID:33212167 Suclg2 Mouse arsane multiple interactions ISO SUCLG2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SUCLG2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of SUCLG2 mRNA CTD PMID:39836092 Suclg2 Mouse arsenic atom multiple interactions ISO SUCLG2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SUCLG2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of SUCLG2 mRNA CTD PMID:39836092 Suclg2 Mouse arsenite(3-) multiple interactions ISO SUCLG2 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to SUCLG2 mRNA] CTD PMID:32406909 Suclg2 Mouse arsenous acid decreases expression ISO SUCLG2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of SUCLG2 mRNA CTD PMID:29633893 Suclg2 Mouse arsenous acid increases expression ISO SUCLG2 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of SUCLG2 protein CTD PMID:25419056 Suclg2 Mouse atrazine decreases expression ISO SUCLG2 (Homo sapiens) 6480464 Atrazine results in decreased expression of SUCLG2 mRNA CTD PMID:22378314 Suclg2 Mouse Azoxymethane multiple interactions EXP 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of SUCLG2 mRNA CTD PMID:29950665 Suclg2 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of SUCLG2 mRNA CTD PMID:22228805 Suclg2 Mouse benzo[a]pyrene decreases expression ISO SUCLG2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of SUCLG2 mRNA CTD PMID:21632981 Suclg2 Mouse benzo[a]pyrene diol epoxide I increases expression ISO SUCLG2 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Suclg2 Mouse beta-lapachone decreases expression ISO SUCLG2 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of SUCLG2 mRNA CTD PMID:38218311 Suclg2 Mouse bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SUCLG2 mRNA CTD PMID:39150890 Suclg2 Mouse bisphenol A multiple interactions ISO Suclg2 (Rattus norvegicus) 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of SUCLG2 mRNA CTD PMID:26496021 Suclg2 Mouse bisphenol A increases expression ISO SUCLG2 (Homo sapiens) 6480464 bisphenol A results in increased expression of SUCLG2 protein CTD PMID:37567409 Suclg2 Mouse bisphenol A decreases expression ISO Suclg2 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of SUCLG2 mRNA CTD PMID:34947998 Suclg2 Mouse bisphenol A affects expression ISO SUCLG2 (Homo sapiens) 6480464 bisphenol A affects the expression of SUCLG2 mRNA CTD PMID:30903817 Suclg2 Mouse bisphenol A affects methylation EXP 6480464 bisphenol A affects the methylation of SUCLG2 promoter CTD PMID:27334623 Suclg2 Mouse bisphenol A increases expression ISO Suclg2 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of SUCLG2 mRNA CTD PMID:25181051 Suclg2 Mouse bisphenol AF increases expression ISO SUCLG2 (Homo sapiens) 6480464 bisphenol AF results in increased expression of SUCLG2 protein CTD PMID:34186270 Suclg2 Mouse Bisphenol B increases expression ISO SUCLG2 (Homo sapiens) 6480464 bisphenol B results in increased expression of SUCLG2 protein CTD PMID:34186270 Suclg2 Mouse bisphenol F increases expression ISO SUCLG2 (Homo sapiens) 6480464 bisphenol F results in increased expression of SUCLG2 protein CTD PMID:34186270 Suclg2 Mouse Butylbenzyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SUCLG2 mRNA CTD PMID:39150890 Suclg2 Mouse cadmium atom increases expression EXP 6480464 Cadmium results in increased expression of SUCLG2 mRNA CTD PMID:26187450 Suclg2 Mouse cadmium atom multiple interactions ISO SUCLG2 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of SUCLG2 mRNA CTD PMID:35301059 Suclg2 Mouse cadmium dichloride increases expression ISO SUCLG2 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of SUCLG2 protein CTD PMID:24527689 Suclg2 Mouse cadmium dichloride multiple interactions ISO SUCLG2 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of SUCLG2 mRNA CTD PMID:35301059 Suclg2 Mouse cadmium dichloride decreases expression ISO SUCLG2 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of SUCLG2 mRNA CTD PMID:38568856 Suclg2 Mouse choline multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of SUCLG2 mRNA CTD PMID:20938992 Suclg2 Mouse chromium trinitrate decreases expression EXP 6480464 chromium nitrate results in decreased expression of SUCLG2 protein CTD PMID:22144121 Suclg2 Mouse cisplatin multiple interactions EXP 6480464 [Cisplatin co-treated with RELB mutant form] results in decreased expression of SUCLG2 mRNA CTD PMID:23625948 Suclg2 Mouse clofibrate increases expression ISO Suclg2 (Rattus norvegicus) 6480464 Clofibrate results in increased expression of SUCLG2 protein CTD PMID:16470657 Suclg2 Mouse clofibric acid multiple interactions ISO Suclg2 (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of SUCLG2 mRNA CTD PMID:17602206 Suclg2 Mouse cobalt dichloride decreases expression ISO SUCLG2 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of SUCLG2 mRNA CTD PMID:19376846 Suclg2 Mouse crocidolite asbestos affects expression EXP 6480464 Asbestos and Crocidolite affects the expression of SUCLG2 mRNA CTD PMID:19446018 Suclg2 Mouse cyclosporin A decreases expression ISO SUCLG2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of SUCLG2 mRNA CTD PMID:20106945 Suclg2 Mouse dexamethasone increases expression ISO SUCLG2 (Homo sapiens) 6480464 Dexamethasone results in increased expression of SUCLG2 mRNA CTD PMID:25047013 Suclg2 Mouse dextran sulfate multiple interactions EXP 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of SUCLG2 mRNA CTD PMID:29950665 Suclg2 Mouse diarsenic trioxide increases expression ISO SUCLG2 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of SUCLG2 protein CTD PMID:25419056 Suclg2 Mouse diarsenic trioxide decreases expression ISO SUCLG2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of SUCLG2 mRNA CTD PMID:29633893 Suclg2 Mouse dibutyl phthalate decreases expression ISO Suclg2 (Rattus norvegicus) 6480464 Dibutyl Phthalate results in decreased expression of SUCLG2 mRNA CTD PMID:21266533 Suclg2 Mouse dibutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SUCLG2 mRNA CTD PMID:39150890 Suclg2 Mouse dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of SUCLG2 mRNA CTD PMID:17361019 and PMID:21266533 Suclg2 Mouse diethyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SUCLG2 mRNA CTD PMID:39150890 Suclg2 Mouse diisobutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SUCLG2 mRNA CTD PMID:39150890 Suclg2 Mouse diisononyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SUCLG2 mRNA CTD PMID:39150890 Suclg2 Mouse dorsomorphin multiple interactions ISO SUCLG2 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Suclg2 Mouse doxorubicin multiple interactions EXP 6480464 sodium nitrate inhibits the reaction [Doxorubicin results in decreased expression of SUCLG2 protein] CTD PMID:21251210 Suclg2 Mouse doxorubicin decreases expression ISO SUCLG2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of SUCLG2 mRNA CTD PMID:29803840 Suclg2 Mouse doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of SUCLG2 mRNA and Doxorubicin results in decreased expression of SUCLG2 protein CTD PMID:21251210 and PMID:26873546 Suclg2 Mouse ethanol increases expression EXP 6480464 Ethanol results in increased expression of SUCLG2 mRNA CTD PMID:30319688 Suclg2 Mouse ethyl methanesulfonate decreases expression ISO SUCLG2 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of SUCLG2 mRNA CTD PMID:23649840 Suclg2 Mouse folic acid multiple interactions EXP 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Suclg2 Mouse formaldehyde decreases expression ISO SUCLG2 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of SUCLG2 mRNA CTD PMID:23649840 Suclg2 Mouse fumonisin B1 decreases expression EXP 6480464 fumonisin B1 results in decreased expression of SUCLG2 mRNA CTD PMID:16221962 Suclg2 Mouse furfural multiple interactions ISO SUCLG2 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of SUCLG2 protein CTD PMID:38598786 Suclg2 Mouse gentamycin increases expression ISO Suclg2 (Rattus norvegicus) 6480464 Gentamicins results in increased expression of SUCLG2 mRNA and Gentamicins results in increased expression of SUCLG2 protein CTD PMID:22061828 Suclg2 Mouse glyphosate decreases expression ISO Suclg2 (Rattus norvegicus) 6480464 Glyphosate results in decreased expression of SUCLG2 mRNA CTD PMID:26302742 Suclg2 Mouse inulin multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of SUCLG2 mRNA CTD PMID:36331819 Suclg2 Mouse ivermectin decreases expression ISO SUCLG2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of SUCLG2 protein CTD PMID:32959892 Suclg2 Mouse L-ascorbic acid affects expression EXP 6480464 Ascorbic Acid affects the expression of SUCLG2 protein CTD PMID:19224539 Suclg2 Mouse L-methionine multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of SUCLG2 mRNA CTD PMID:20938992 Suclg2 Mouse manganese atom multiple interactions ISO SUCLG2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SUCLG2 mRNA CTD PMID:39836092 Suclg2 Mouse manganese(0) multiple interactions ISO SUCLG2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SUCLG2 mRNA CTD PMID:39836092 Suclg2 Mouse manganese(II) chloride multiple interactions ISO SUCLG2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SUCLG2 mRNA CTD PMID:39836092 Suclg2 Mouse methapyrilene decreases expression ISO Suclg2 (Rattus norvegicus) 6480464 Methapyrilene results in decreased expression of SUCLG2 protein CTD PMID:30467583 Suclg2 Mouse methotrexate affects response to substance ISO SUCLG2 (Homo sapiens) 6480464 SUCLG2 protein affects the susceptibility to Methotrexate CTD PMID:16217747 Suclg2 Mouse methyl methanesulfonate decreases expression ISO SUCLG2 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of SUCLG2 mRNA CTD PMID:23649840 Suclg2 Mouse microcystin-LR decreases expression EXP 6480464 cyanoginosin LR results in decreased expression of SUCLG2 mRNA CTD PMID:17383702 Suclg2 Mouse N-nitrosodiethylamine multiple interactions ISO Suclg2 (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of SUCLG2 mRNA CTD PMID:17602206 Suclg2 Mouse N-nitrosomorpholine affects expression ISO Suclg2 (Rattus norvegicus) 6480464 N-nitrosomorpholine affects the expression of SUCLG2 protein CTD PMID:19716841 Suclg2 Mouse okadaic acid decreases expression EXP 6480464 Okadaic Acid results in decreased expression of SUCLG2 mRNA CTD PMID:25270620 Suclg2 Mouse ozone multiple interactions ISO SUCLG2 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of SUCLG2 mRNA more ... CTD PMID:32699268 Suclg2 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of SUCLG2 mRNA CTD PMID:17562736 Suclg2 Mouse paracetamol decreases expression ISO Suclg2 (Rattus norvegicus) 6480464 Acetaminophen results in decreased expression of SUCLG2 mRNA CTD PMID:33387578 Suclg2 Mouse paracetamol decreases expression ISO SUCLG2 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of SUCLG2 mRNA CTD PMID:25704631 and PMID:29067470 Suclg2 Mouse perfluorododecanoic acid increases expression ISO Suclg2 (Rattus norvegicus) 6480464 perfluorododecanoic acid results in increased expression of SUCLG2 protein CTD PMID:26168851 Suclg2 Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of SUCLG2 mRNA more ... CTD PMID:36331819 Suclg2 Mouse phenethyl isothiocyanate affects binding ISO SUCLG2 (Homo sapiens) 6480464 SUCLG2 protein binds to phenethyl isothiocyanate CTD PMID:21838287 Suclg2 Mouse phenylmercury acetate decreases expression ISO SUCLG2 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of SUCLG2 mRNA CTD PMID:26272509 Suclg2 Mouse phenylmercury acetate multiple interactions ISO SUCLG2 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of SUCLG2 mRNA CTD PMID:27188386 Suclg2 Mouse phlorizin decreases expression EXP 6480464 Phlorhizin results in decreased expression of SUCLG2 mRNA CTD PMID:22538082 Suclg2 Mouse pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of SUCLG2 mRNA CTD PMID:18301758 and PMID:23811191 Suclg2 Mouse potassium chromate decreases expression EXP 6480464 potassium chromate(VI) results in decreased expression of SUCLG2 protein CTD PMID:22144121 Suclg2 Mouse quercetin decreases expression ISO SUCLG2 (Homo sapiens) 6480464 Quercetin results in decreased expression of SUCLG2 mRNA CTD PMID:21632981 Suclg2 Mouse resveratrol increases expression EXP 6480464 resveratrol results in increased expression of SUCLG2 protein CTD PMID:25505154 Suclg2 Mouse SB 431542 multiple interactions ISO SUCLG2 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Suclg2 Mouse senecionine increases expression EXP 6480464 senecionine results in increased expression of SUCLG2 protein CTD PMID:35357534 Suclg2 Mouse sodium arsenite decreases expression ISO SUCLG2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of SUCLG2 mRNA CTD PMID:38568856 Suclg2 Mouse sodium arsenite multiple interactions ISO SUCLG2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SUCLG2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of SUCLG2 mRNA CTD PMID:39836092 Suclg2 Mouse sodium chloride multiple interactions ISO SUCLG2 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of SUCLG2 protein more ... CTD PMID:38598786 Suclg2 Mouse sodium nitrate multiple interactions EXP 6480464 sodium nitrate inhibits the reaction [Doxorubicin results in decreased expression of SUCLG2 protein] CTD PMID:21251210 Suclg2 Mouse sunitinib decreases expression ISO SUCLG2 (Homo sapiens) 6480464 Sunitinib results in decreased expression of SUCLG2 mRNA CTD PMID:31533062 Suclg2 Mouse temozolomide decreases expression ISO SUCLG2 (Homo sapiens) 6480464 Temozolomide results in decreased expression of SUCLG2 mRNA CTD PMID:31758290 Suclg2 Mouse Tesaglitazar increases expression ISO Suclg2 (Rattus norvegicus) 6480464 tesaglitazar results in increased expression of SUCLG2 mRNA CTD PMID:21515302 Suclg2 Mouse testosterone multiple interactions EXP 6480464 1 more ... CTD PMID:33848595 Suclg2 Mouse testosterone increases expression EXP 6480464 Testosterone deficiency results in increased expression of SUCLG2 mRNA CTD PMID:33848595 Suclg2 Mouse tetrachloromethane decreases expression ISO Suclg2 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in decreased expression of SUCLG2 mRNA CTD PMID:31150632 Suclg2 Mouse tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of SUCLG2 mRNA CTD PMID:31919559 Suclg2 Mouse thioacetamide decreases expression ISO Suclg2 (Rattus norvegicus) 6480464 Thioacetamide results in decreased expression of SUCLG2 mRNA CTD PMID:34492290 Suclg2 Mouse thiram decreases expression ISO SUCLG2 (Homo sapiens) 6480464 Thiram results in decreased expression of SUCLG2 mRNA CTD PMID:38568856 Suclg2 Mouse titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of SUCLG2 mRNA CTD PMID:29128614 and PMID:29264374 Suclg2 Mouse titanium dioxide multiple interactions EXP 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of SUCLG2 mRNA CTD PMID:29950665 Suclg2 Mouse triphenyl phosphate affects expression ISO SUCLG2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of SUCLG2 mRNA CTD PMID:37042841 Suclg2 Mouse urethane decreases expression ISO SUCLG2 (Homo sapiens) 6480464 Urethane results in decreased expression of SUCLG2 mRNA CTD PMID:28818685 Suclg2 Mouse valproic acid affects expression ISO SUCLG2 (Homo sapiens) 6480464 Valproic Acid affects the expression of SUCLG2 mRNA CTD PMID:25979313 Suclg2 Mouse valproic acid multiple interactions ISO SUCLG2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of SUCLG2 mRNA CTD PMID:27188386 Suclg2 Mouse valproic acid decreases expression ISO SUCLG2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of SUCLG2 mRNA CTD PMID:23179753 more ... Suclg2 Mouse valproic acid decreases methylation ISO SUCLG2 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of SUCLG2 gene CTD PMID:29501571 Suclg2 Mouse vinclozolin increases methylation ISO Suclg2 (Rattus norvegicus) 6480464 vinclozolin results in increased methylation of SUCLG2 gene CTD PMID:31079544
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (EXP) (R)-adrenaline (ISO) 1,2-dimethylhydrazine (EXP) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4-dinitrotoluene (ISO) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (EXP) 5-methyl-4-oxido-2-pyrazin-4-iumcarboxylic acid (ISO) 7H-xanthine (ISO) 9H-xanthine (ISO) acetamide (ISO) acrolein (ISO) acrylamide (ISO) aflatoxin B1 (EXP,ISO) alpha-hexachlorocyclohexane (ISO) alpha-pinene (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (ISO) Azoxymethane (EXP) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) Butylbenzyl phthalate (EXP) cadmium atom (EXP,ISO) cadmium dichloride (ISO) choline (EXP) chromium trinitrate (EXP) cisplatin (EXP) clofibrate (ISO) clofibric acid (ISO) cobalt dichloride (ISO) crocidolite asbestos (EXP) cyclosporin A (ISO) dexamethasone (ISO) dextran sulfate (EXP) diarsenic trioxide (ISO) dibutyl phthalate (EXP,ISO) diethyl phthalate (EXP) diisobutyl phthalate (EXP) diisononyl phthalate (EXP) dorsomorphin (ISO) doxorubicin (EXP,ISO) ethanol (EXP) ethyl methanesulfonate (ISO) folic acid (EXP) formaldehyde (ISO) fumonisin B1 (EXP) furfural (ISO) gentamycin (ISO) glyphosate (ISO) inulin (EXP) ivermectin (ISO) L-ascorbic acid (EXP) L-methionine (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methapyrilene (ISO) methotrexate (ISO) methyl methanesulfonate (ISO) microcystin-LR (EXP) N-nitrosodiethylamine (ISO) N-nitrosomorpholine (ISO) okadaic acid (EXP) ozone (ISO) paracetamol (EXP,ISO) perfluorododecanoic acid (ISO) perfluorooctane-1-sulfonic acid (EXP) phenethyl isothiocyanate (ISO) phenylmercury acetate (ISO) phlorizin (EXP) pirinixic acid (EXP) potassium chromate (EXP) quercetin (ISO) resveratrol (EXP) SB 431542 (ISO) senecionine (EXP) sodium arsenite (ISO) sodium chloride (ISO) sodium nitrate (EXP) sunitinib (ISO) temozolomide (ISO) Tesaglitazar (ISO) testosterone (EXP) tetrachloromethane (EXP,ISO) thioacetamide (ISO) thiram (ISO) titanium dioxide (EXP) triphenyl phosphate (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (ISO)
1.
Mitochondrial GTP regulates glucose-stimulated insulin secretion.
Kibbey RG, etal., Cell Metab. 2007 Apr;5(4):253-64.
2.
Genome-wide mapping of unselected transcripts from extraembryonic tissue of 7.5-day mouse embryos reveals enrichment in the t-complex and under-representation on the X chromosome.
Ko MS, etal., Hum Mol Genet 1998 Nov;7(12):1967-78.
3.
MGDs mouse GO annotations
MGD data from the GO Consortium
4.
Integrated analysis of protein composition, tissue diversity, and gene regulation in mouse mitochondria.
Mootha VK, etal., Cell 2003 Nov 26;115(5):629-40.
5.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
6.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
7.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
8.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Suclg2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 95,449,992 - 95,695,799 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 95,449,990 - 95,695,781 (-) Ensembl GRCm39 Ensembl GRCm38 6 95,473,009 - 95,718,858 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 95,473,009 - 95,718,800 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 95,424,128 - 95,668,831 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 95,439,609 - 95,684,251 (-) NCBI MGSCv36 mm8 Celera 6 97,363,804 - 97,602,843 (-) NCBI Celera Cytogenetic Map 6 D2 NCBI cM Map 6 44.63 NCBI
SUCLG2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 67,360,460 - 67,654,612 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 67,360,460 - 67,654,612 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 67,410,884 - 67,705,036 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 67,507,833 - 67,787,728 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 67,507,835 - 67,787,698 NCBI Celera 3 67,353,993 - 67,645,444 (-) NCBI Celera Cytogenetic Map 3 p14.1 NCBI HuRef 3 67,427,311 - 67,718,351 (-) NCBI HuRef CHM1_1 3 67,362,353 - 67,656,266 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 67,405,452 - 67,699,926 (-) NCBI T2T-CHM13v2.0
Suclg2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 129,623,833 - 129,893,937 (-) NCBI GRCr8 mRatBN7.2 4 128,067,031 - 128,337,146 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 128,067,033 - 128,337,170 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 133,537,045 - 133,796,153 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 129,311,467 - 129,570,570 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 127,936,011 - 128,195,129 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 127,552,100 - 127,824,970 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 127,552,101 - 127,824,970 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 192,061,200 - 192,333,899 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 129,995,856 - 130,276,182 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 130,240,697 - 130,521,016 (-) NCBI Celera 4 116,961,947 - 117,231,527 (-) NCBI Celera Cytogenetic Map 4 q34 NCBI
Suclg2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955421 20,089,237 - 20,350,843 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955421 20,089,471 - 20,350,334 (+) NCBI ChiLan1.0 ChiLan1.0
SUCLG2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 67,297,278 - 67,583,115 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 67,302,066 - 67,587,910 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 67,277,348 - 67,563,181 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 68,646,711 - 68,931,961 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 68,647,738 - 68,931,891 (-) Ensembl panpan1.1 panPan2
SUCLG2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 23,915,149 - 24,167,740 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 23,895,802 - 24,182,869 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 23,886,104 - 24,138,714 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 23,942,402 - 24,194,878 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 23,923,303 - 24,210,054 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 23,639,932 - 23,892,783 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 23,985,458 - 24,238,734 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 24,045,666 - 24,298,090 (+) NCBI UU_Cfam_GSD_1.0
Suclg2
SUCLG2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 48,823,733 - 49,090,468 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 48,650,851 - 49,090,521 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 53,872,520 - 54,030,696 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SUCLG2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 28,382,612 - 28,677,749 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 28,381,787 - 28,677,742 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 138,141,609 - 138,419,603 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Suclg2
.
Predicted Target Of
Count of predictions: 333 Count of miRNA genes: 260 Interacting mature miRNAs: 292 Transcripts: ENSMUST00000079847 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
4142271 Egq8_m early growth QTL 8 (mouse) Not determined 4503823 96633110 Mouse 11532719 Sluc45_m susceptibility to lung cancer 45 (mouse) 6 92584287 98235894 Mouse 10043864 T2dm4sa_m type 2 diabetes mellitus 4 in SMXA RI mice (mouse) Not determined 6 83690851 146954059 Mouse 1301521 Pas1c_m pulmonary adenoma susceptibility 1c (mouse) Not determined 6 71958006 105958152 Mouse 10412119 Stv_m striatal volumne (mouse) Not determined 6 60026991 100026967 Mouse 1300954 Fcsa1_m femoral cross-sectional area 1 (mouse) Not determined 6 71958006 105958152 Mouse 13824985 Alh1_m amplitude of lateral head displacement 1 (mouse) 6 77976983 96976961 Mouse 4142259 Tabw2_m tally ho associated body weight 2 (mouse) Not determined 46912919 136400690 Mouse 25314319 Histh6_m histamine hypersensitivity 6 (mouse) 6 48696934 125336963 Mouse 12792979 Fbmd2_m femoral bone mineral density 2, females only (mouse) 6 75026989 115026943 Mouse 4142126 W3q3_m weight 3 weeks QTL 3 (mouse) Not determined 4503823 96633110 Mouse 25314320 Histh5_m histamine hypersensitivity 5 (mouse) 6 48696934 148351498 Mouse 1300869 Stheal5_m soft tissue heal 5 (mouse) Not determined 6 71552042 105552160 Mouse 1301962 Eila2_m ethanol induced locomotor activity 2 (mouse) Not determined 6 48703490 125333748 Mouse 1301320 Ots1_m ovarian teratoma susceptibility 1 (mouse) Not determined 6 75424566 104480516 Mouse 1301262 Gasa3_m gastritis type A susceptibility locus 3 (mouse) Not determined 6 88982366 122982564 Mouse 11353842 Bmiq4_m body mass index QTL 4 (mouse) 6 92584287 146330736 Mouse 10412157 Fl1n_m fatty liver 1 in NSY (mouse) Not determined 6 45290993 128811995 Mouse 11251720 Ewc4_m ethanol withdrawal and consumption 4 (mouse) 6 84099474 118099474 Mouse 1301744 Hdlq11_m HDL QTL 11 (mouse) Not determined 6 87480321 121480516 Mouse 25440480 Moaq2_m modifier of alien QTL 2 (mouse) 6 3050001 117476961 Mouse 26884414 Bzwq12_m bi-zygomatic width QTL 12, 16 week (mouse) 6 3400000 139076998 Mouse 10043901 Pfat5_m predicted fat percentage 5 (mouse) Not determined 6 75584287 109584431 Mouse 1301687 Mnic2_m macronutrient intake (mouse) Not determined 6 86783787 113521563 Mouse 4142361 W10q11_m weight 10 weeks QTL 11 (mouse) Not determined 4503823 96633110 Mouse 1301813 Skl3_m skeletal size (tail length) 3 (mouse) Not determined 6 70402880 104403016 Mouse 4142232 W6q4_m weight 6 weeks QTL 4 (mouse) Not determined 4503823 96633110 Mouse 1357683 Igf1sl1_m IGF-1 serum levels 1 (mouse) Not determined 6 52138693 116132228 Mouse 1301876 Bits2_m bitterness sensitivity 2 (mouse) Not determined 6 70402880 104403016 Mouse 1357875 Pfat2_m predicted fat percentage 2 (mouse) Not determined 6 76440930 110441074 Mouse 1301369 Im4_m immunoregulatory 4 (mouse) Not determined 6 63461721 97461888 Mouse 10412208 Cypr4_m cytokine production 4 (mouse) Not determined 6 75693484 109693678 Mouse 1301244 Ichs_m immediate cutaneous hypersensitivity QTL (mouse) Not determined 6 90772571 124772807 Mouse 4141578 Obrq1_m obesity resistance QTL 1 (mouse) Not determined 92584287 111981699 Mouse 1300650 Bw18_m body weight QTL 18 (mouse) Not determined 6 66690851 100691013 Mouse 1301034 Egrm2_m early growth rate (mouse) Not determined 6 70402880 104403016 Mouse 14696731 Pairq1_m P. aeruginosa infection resistance QTL 1 (mouse) 6 81476981 102176961 Mouse 13506930 Recrq9_m recombination rate in male meiosis QTL 9 (mouse) 6 73476983 134676963 Mouse 4141376 Dbm1_m diabetes modifier 1 (mouse) Not determined 6 78606487 121092347 Mouse 1301292 Cfbw2_m cystic fibrosis body weight 2 (mouse) Not determined 6 94981612 128981699 Mouse
AW556404
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 6 95,473,064 - 95,473,163 UniSTS GRCm38 MGSCv37 6 95,423,058 - 95,423,157 UniSTS GRCm37 Celera 6 97,362,734 - 97,362,833 UniSTS Cytogenetic Map 6 D3 UniSTS cM Map 6 41.0 UniSTS Whitehead/MRC_RH 6 980.23 UniSTS
RH124559
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 6 95,474,264 - 95,474,491 UniSTS GRCm38 GRCm38 X 157,015,446 - 157,015,673 UniSTS GRCm38 MGSCv37 6 95,424,258 - 95,424,485 UniSTS GRCm37 MGSCv37 X 153,449,989 - 153,450,216 UniSTS GRCm37 Celera X 140,275,602 - 140,275,829 UniSTS Celera 6 97,363,934 - 97,364,161 UniSTS Cytogenetic Map 6 D3 UniSTS Cytogenetic Map X F4 UniSTS cM Map 6 41.0 UniSTS
Suclg2
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 X 157,015,622 - 157,016,583 UniSTS GRCm38 MGSCv37 X 153,450,165 - 153,451,126 UniSTS GRCm37 Celera X 140,275,778 - 140,276,739 UniSTS Cytogenetic Map X F4 UniSTS Cytogenetic Map 6 D3 UniSTS cM Map 6 41.0 UniSTS
UniSTS:235506
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 6 95,561,725 - 95,562,065 UniSTS GRCm38 MGSCv37 6 95,511,719 - 95,512,059 UniSTS GRCm37 Celera 6 97,452,495 - 97,452,835 UniSTS Cytogenetic Map 6 D3 UniSTS cM Map 6 41.0 UniSTS
D6Wsu120e
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 6 95,474,239 - 95,474,488 UniSTS GRCm38 GRCm38 X 157,015,421 - 157,015,670 UniSTS GRCm38 MGSCv37 X 153,449,964 - 153,450,213 UniSTS GRCm37 MGSCv37 6 95,424,233 - 95,424,482 UniSTS GRCm37 Celera X 140,275,577 - 140,275,826 UniSTS Celera 6 97,363,909 - 97,364,158 UniSTS Cytogenetic Map 6 D3 UniSTS Cytogenetic Map X F4 UniSTS cM Map 6 41.0 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000079847 ⟹ ENSMUSP00000078774
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 6 95,451,123 - 95,669,863 (-) Ensembl GRCm38.p6 Ensembl 6 95,474,142 - 95,692,882 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000203071
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 6 95,543,466 - 95,620,990 (-) Ensembl GRCm38.p6 Ensembl 6 95,566,485 - 95,644,009 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000203109
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 6 95,631,732 - 95,695,781 (-) Ensembl GRCm38.p6 Ensembl 6 95,654,751 - 95,718,800 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000204224 ⟹ ENSMUSP00000144827
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 6 95,449,990 - 95,695,781 (-) Ensembl GRCm38.p6 Ensembl 6 95,473,009 - 95,718,800 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000204567 ⟹ ENSMUSP00000145471
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 6 95,571,664 - 95,634,449 (-) Ensembl GRCm38.p6 Ensembl 6 95,594,683 - 95,657,468 (-) Ensembl
RefSeq Acc Id:
NM_001326558 ⟹ NP_001313487
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 95,449,992 - 95,669,693 (-) NCBI GRCm38 6 95,473,009 - 95,692,882 (-) NCBI
Sequence:
AGGATGTGTGTATGGGGAGTGGAGAGAGGGAGGGAGGACTGATAAACACCGATTGGCTCACTCTAACCTCCTGCCTTACCCTCTCAAGCACTGCGATTGCTGACATGAGCCTCTGGTTTGGTTTCTTC
hide sequence
RefSeq Acc Id:
NM_001410411 ⟹ NP_001397340
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 95,449,992 - 95,695,799 (-) NCBI
RefSeq Acc Id:
NM_011507 ⟹ NP_035637
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 95,449,992 - 95,695,799 (-) NCBI GRCm38 6 95,473,009 - 95,718,846 (-) NCBI MGSCv37 6 95,424,128 - 95,668,831 (-) RGD Celera 6 97,362,679 - 97,602,851 (-) NCBI cM Map 6 ENTREZGENE
Sequence:
TGGGCCCGGGCGGGCTCCCTCCTCCGCCCCCTCCCTCCCCCTCGCCGCCTCTCTTCAGGTTCCTGGTTAAGATGGCGTCCCCGGTGGCCATCGCGGCGCAGGCTGGGAAGCTTCTGCGAGAGCGAGCG
hide sequence
RefSeq Acc Id:
NR_177067
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 95,449,992 - 95,695,799 (-) NCBI
RefSeq Acc Id:
NR_177068
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 95,449,992 - 95,695,799 (-) NCBI
RefSeq Acc Id:
NR_177069
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 95,449,992 - 95,695,799 (-) NCBI
RefSeq Acc Id:
NP_035637 ⟸ NM_011507
- Peptide Label:
isoform 1 precursor
- UniProtKB:
Q80VV1 (UniProtKB/Swiss-Prot), Q7TMY3 (UniProtKB/Swiss-Prot), Q66JT3 (UniProtKB/Swiss-Prot), Q3TK63 (UniProtKB/Swiss-Prot), Q3TJQ5 (UniProtKB/Swiss-Prot), Q3T9B8 (UniProtKB/Swiss-Prot), Q8K2K9 (UniProtKB/Swiss-Prot), Q9Z2I8 (UniProtKB/Swiss-Prot), C6EQH3 (UniProtKB/TrEMBL)
- Sequence:
MASPVAIAAQAGKLLRERALRPLLAVRSQAGHLTPRRWLNLQEYQSKKLMSEHGVRVQRFFVANTAKEALEAAKRLNAKEIVLKAQILAGGRGKGVFNSGLKGGVHLTKDPKVVGELAQQMIGYNLAT
hide sequence
RefSeq Acc Id:
NP_001313487 ⟸ NM_001326558
- Peptide Label:
isoform 2
- UniProtKB:
C6EQH3 (UniProtKB/TrEMBL)
- Sequence:
MSEHGVRVQRFFVANTAKEALEAAKRLNAKEIVLKAQILAGGRGKGVFNSGLKGGVHLTKDPKV
hide sequence
Ensembl Acc Id:
ENSMUSP00000144827 ⟸ ENSMUST00000204224
Ensembl Acc Id:
ENSMUSP00000078774 ⟸ ENSMUST00000079847
Ensembl Acc Id:
ENSMUSP00000145471 ⟸ ENSMUST00000204567
RefSeq Acc Id:
NP_001397340 ⟸ NM_001410411
- Peptide Label:
isoform 3
RGD ID: 6840037 Promoter ID: MM_KWN:46988 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, ES_Cell, Liver, Lung, MEF_B6 Transcripts: NM_011507, UC009DAC.1, UC009DAD.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 6 95,668,326 - 95,668,826 (-) MPROMDB
RGD ID: 6890504 Promoter ID: EPDNEW_M8703 Type: multiple initiation site Name: Suclg2_1 Description: Mus musculus succinate-Coenzyme A ligase, GDP-forming, beta subunit, transcript variant 1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 6 95,718,789 - 95,718,849 EPDNEW
