Symbol:
Pggt1b
Name:
protein geranylgeranyltransferase type I subunit beta
RGD ID:
621754
Description:
Enables heterocyclic compound binding activity. Contributes to CAAX-protein geranylgeranyltransferase activity; peptide binding activity; and zinc ion binding activity. Involved in positive regulation of cell cycle; positive regulation of cell population proliferation; and protein geranylgeranylation. Part of CAAX-protein geranylgeranyltransferase complex. Orthologous to human PGGT1B (protein geranylgeranyltransferase type I subunit beta); INTERACTS WITH (+)-schisandrin B; ammonium chloride; amphetamine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
geranylgeranyl transferase type I subunit beta; geranylgeranyl transferase type-1 subunit beta; geranylgeranyltransferase type 1 beta; geranylgeranyltransferase type I (GGTase-I); GGTase-I-beta; protein geranylgeranyltransferase type 1 subunit beta; protein geranylgeranyltransferase type I, beta subunit; type I protein geranyl-geranyltransferase subunit beta
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PGGT1B (protein geranylgeranyltransferase type I subunit beta) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Pggt1b (protein geranylgeranyltransferase type I, beta subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pggt1b (protein geranylgeranyltransferase type I subunit beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PGGT1B (protein geranylgeranyltransferase type I subunit beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PGGT1B (protein geranylgeranyltransferase type I subunit beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Pggt1b (protein geranylgeranyltransferase type I subunit beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PGGT1B (protein geranylgeranyltransferase type I subunit beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PGGT1B (protein geranylgeranyltransferase type I subunit beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pggt1b (protein geranylgeranyltransferase type I subunit beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
PGGT1B (protein geranylgeranyltransferase type I subunit beta)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Pggt1b (protein geranylgeranyltransferase type I, beta subunit)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
pggt1b (protein geranylgeranyltransferase type I, beta subunit)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
CDC43
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
betaggt-I
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
pggt1b
Alliance
DIOPT (OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 41,138,536 - 41,182,145 (-) NCBI GRCr8 mRatBN7.2 18 38,952,147 - 38,995,656 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 38,952,914 - 38,995,503 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 40,986,574 - 41,028,748 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 41,688,793 - 41,730,969 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 39,481,904 - 39,524,080 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 40,173,236 - 40,218,225 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 40,175,951 - 40,218,225 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 39,826,667 - 39,871,483 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 40,410,055 - 40,452,883 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 18 40,447,595 - 40,490,419 (-) NCBI Celera 18 37,212,291 - 37,254,465 (-) NCBI Celera Cytogenetic Map 18 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pggt1b Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of PGGT1B mRNA] CTD PMID:31150632 Pggt1b Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1332546 6480464 1,2-Dimethylhydrazine results in decreased expression of PGGT1B mRNA CTD PMID:22206623 Pggt1b Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1332546 6480464 Tetrachlorodibenzodioxin results in increased expression of PGGT1B mRNA CTD PMID:19465110 Pggt1b Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1332546 6480464 Tetrachlorodibenzodioxin affects the expression of PGGT1B mRNA CTD PMID:21570461 Pggt1b Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:734288 6480464 Tetrachlorodibenzodioxin results in decreased expression of PGGT1B mRNA CTD PMID:17101203 Pggt1b Rat 2-hydroxypropanoic acid decreases expression ISO RGD:734288 6480464 Lactic Acid results in decreased expression of PGGT1B mRNA CTD PMID:30851411 Pggt1b Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:734288 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Pggt1b Rat 4,4'-diaminodiphenylmethane decreases expression ISO RGD:1332546 6480464 4,4'-diaminodiphenylmethane results in decreased expression of PGGT1B mRNA CTD PMID:18648102 Pggt1b Rat 4,4'-sulfonyldiphenol multiple interactions ISO RGD:734288 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Pggt1b Rat aflatoxin B1 increases expression ISO RGD:1332546 6480464 Aflatoxin B1 results in increased expression of PGGT1B mRNA CTD PMID:19770486 Pggt1b Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PGGT1B mRNA CTD PMID:16483693 Pggt1b Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of PGGT1B mRNA CTD PMID:30779732 Pggt1b Rat antirheumatic drug decreases expression ISO RGD:734288 6480464 Antirheumatic Agents results in decreased expression of PGGT1B mRNA CTD PMID:24449571 Pggt1b Rat arsenous acid decreases expression ISO RGD:734288 6480464 Arsenic Trioxide results in decreased expression of PGGT1B mRNA CTD PMID:20458559 Pggt1b Rat benzo[a]pyrene decreases expression ISO RGD:1332546 6480464 Benzo(a)pyrene results in decreased expression of PGGT1B mRNA CTD PMID:19770486 Pggt1b Rat benzo[a]pyrene diol epoxide I decreases expression ISO RGD:734288 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of PGGT1B mRNA CTD PMID:20018196 Pggt1b Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:1332546 6480464 Diethylhexyl Phthalate results in increased expression of PGGT1B mRNA CTD PMID:34319233 Pggt1b Rat bisphenol A multiple interactions ISO RGD:734288 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Pggt1b Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PGGT1B mRNA CTD PMID:34947998 Pggt1b Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PGGT1B mRNA CTD PMID:30816183|PMID:32528016 Pggt1b Rat bisphenol F increases expression ISO RGD:1332546 6480464 bisphenol F results in increased expression of PGGT1B mRNA CTD PMID:38685157 Pggt1b Rat cadmium atom multiple interactions ISO RGD:734288 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PGGT1B more ... CTD PMID:35301059 Pggt1b Rat cadmium dichloride multiple interactions ISO RGD:734288 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PGGT1B more ... CTD PMID:35301059 Pggt1b Rat CGP 52608 multiple interactions ISO RGD:734288 6480464 CGP 52608 promotes the reaction [RORA protein binds to PGGT1B gene] CTD PMID:28238834 Pggt1b Rat chlorpyrifos decreases expression ISO RGD:1332546 6480464 Chlorpyrifos results in decreased expression of PGGT1B mRNA CTD PMID:37019170 Pggt1b Rat coumestrol multiple interactions ISO RGD:734288 6480464 [Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of PGGT1B mRNA CTD PMID:19167446 Pggt1b Rat cyclosporin A increases expression ISO RGD:734288 6480464 Cyclosporine results in increased expression of PGGT1B mRNA CTD PMID:25562108 Pggt1b Rat dexamethasone multiple interactions ISO RGD:734288 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Pggt1b Rat diarsenic trioxide decreases expression ISO RGD:734288 6480464 Arsenic Trioxide results in decreased expression of PGGT1B mRNA CTD PMID:20458559 Pggt1b Rat Dibutyl phosphate affects expression ISO RGD:734288 6480464 di-n-butylphosphoric acid affects the expression of PGGT1B mRNA CTD PMID:37042841 Pggt1b Rat dicrotophos decreases expression ISO RGD:734288 6480464 dicrotophos results in decreased expression of PGGT1B mRNA CTD PMID:28302478 Pggt1b Rat doxorubicin decreases expression ISO RGD:734288 6480464 Doxorubicin results in decreased expression of PGGT1B mRNA CTD PMID:29803840 Pggt1b Rat Enterolactone multiple interactions ISO RGD:734288 6480464 [Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of PGGT1B mRNA CTD PMID:19167446 Pggt1b Rat fenthion decreases expression ISO RGD:1332546 6480464 Fenthion results in decreased expression of PGGT1B mRNA CTD PMID:34813904 Pggt1b Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of PGGT1B mRNA CTD PMID:33387578 Pggt1b Rat glyphosate affects methylation EXP 6480464 Glyphosate affects the methylation of PGGT1B gene CTD PMID:35440735 Pggt1b Rat hydrogen peroxide increases expression ISO RGD:734288 6480464 Hydrogen Peroxide results in increased expression of PGGT1B mRNA CTD PMID:12414654 Pggt1b Rat indometacin multiple interactions ISO RGD:734288 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Pggt1b Rat lipopolysaccharide multiple interactions ISO RGD:734288 6480464 PGGT1B inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of MAPK1 protein]; PGGT1B inhibits the more ... CTD PMID:18625914 Pggt1b Rat menadione increases expression ISO RGD:734288 6480464 Vitamin K 3 results in increased expression of PGGT1B mRNA CTD PMID:12414654 Pggt1b Rat methidathion decreases expression ISO RGD:1332546 6480464 methidathion results in decreased expression of PGGT1B mRNA CTD PMID:34813904 Pggt1b Rat methylmercury chloride decreases expression ISO RGD:734288 6480464 methylmercuric chloride results in decreased expression of PGGT1B mRNA CTD PMID:28001369 Pggt1b Rat miconazole decreases expression ISO RGD:1332546 6480464 Miconazole results in decreased expression of PGGT1B mRNA CTD PMID:27462272 Pggt1b Rat ochratoxin A decreases expression ISO RGD:734288 6480464 ochratoxin A results in decreased expression of PGGT1B mRNA CTD PMID:30559759 Pggt1b Rat phenobarbital increases expression ISO RGD:1332546 6480464 Phenobarbital results in increased expression of PGGT1B mRNA CTD PMID:19270015 Pggt1b Rat phenobarbital decreases expression ISO RGD:1332546 6480464 Phenobarbital results in decreased expression of PGGT1B mRNA CTD PMID:23091169 Pggt1b Rat potassium dichromate decreases expression ISO RGD:1332546 6480464 Potassium Dichromate results in decreased expression of PGGT1B mRNA CTD PMID:23608068 Pggt1b Rat rac-lactic acid decreases expression ISO RGD:734288 6480464 Lactic Acid results in decreased expression of PGGT1B mRNA CTD PMID:30851411 Pggt1b Rat resveratrol multiple interactions ISO RGD:734288 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of PGGT1B mRNA CTD PMID:23557933 Pggt1b Rat silver atom decreases expression ISO RGD:1332546 6480464 Silver results in decreased expression of PGGT1B mRNA CTD PMID:27131904 Pggt1b Rat silver(0) decreases expression ISO RGD:1332546 6480464 Silver results in decreased expression of PGGT1B mRNA CTD PMID:27131904 Pggt1b Rat sodium arsenate increases expression ISO RGD:1332546 6480464 sodium arsenate results in increased expression of PGGT1B mRNA CTD PMID:21795629 Pggt1b Rat sodium arsenite increases expression ISO RGD:734288 6480464 sodium arsenite results in increased expression of PGGT1B mRNA CTD PMID:38568856 Pggt1b Rat succimer multiple interactions ISO RGD:1332546 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in decreased expression of PGGT1B mRNA CTD PMID:26378955 Pggt1b Rat tamoxifen increases expression ISO RGD:734288 6480464 Tamoxifen results in increased expression of PGGT1B mRNA CTD PMID:15604281 Pggt1b Rat tert-butyl hydroperoxide increases expression ISO RGD:734288 6480464 tert-Butylhydroperoxide results in increased expression of PGGT1B mRNA CTD PMID:12414654 Pggt1b Rat tetrachloromethane affects expression ISO RGD:1332546 6480464 Carbon Tetrachloride affects the expression of PGGT1B mRNA CTD PMID:17484886 Pggt1b Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of PGGT1B mRNA] CTD PMID:31150632 Pggt1b Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of PGGT1B mRNA CTD PMID:31150632 Pggt1b Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PGGT1B mRNA CTD PMID:34492290 Pggt1b Rat titanium dioxide decreases methylation ISO RGD:1332546 6480464 titanium dioxide results in decreased methylation of PGGT1B gene; titanium dioxide results in decreased methylation more ... CTD PMID:35295148 Pggt1b Rat trichostatin A affects expression ISO RGD:734288 6480464 trichostatin A affects the expression of PGGT1B mRNA CTD PMID:28542535 Pggt1b Rat triphenyl phosphate affects expression ISO RGD:734288 6480464 triphenyl phosphate affects the expression of PGGT1B mRNA CTD PMID:37042841 Pggt1b Rat troglitazone decreases expression ISO RGD:1332546 6480464 troglitazone results in decreased expression of PGGT1B mRNA CTD PMID:28973697 Pggt1b Rat urethane decreases expression ISO RGD:734288 6480464 Urethane results in decreased expression of PGGT1B mRNA CTD PMID:28818685 Pggt1b Rat valproic acid decreases expression ISO RGD:734288 6480464 Valproic Acid results in decreased expression of PGGT1B mRNA CTD PMID:23179753|PMID:27188386 Pggt1b Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of PGGT1B mRNA CTD PMID:23555832
1.
Inhibition of protein geranylgeranylation causes a superinduction of nitric-oxide synthase-2 by interleukin-1beta in vascular smooth muscle cells.
Finder JD, etal., J Biol Chem. 1997 May 23;272(21):13484-8.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
5.
Combination of the novel farnesyltransferase inhibitor RPR130401 and the geranylgeranyltransferase-1 inhibitor GGTI-298 disrupts MAP kinase activation and G(1)-S transition in Ki-Ras-overexpressing transformed adrenocortical cells.
Mazet JL, etal., FEBS Lett. 1999 Oct 29;460(2):235-40.
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.
Crystallographic analysis reveals that anticancer clinical candidate L-778,123 inhibits protein farnesyltransferase and geranylgeranyltransferase-I by different binding modes.
Reid TS, etal., Biochemistry. 2004 Jul 20;43(28):9000-8.
9.
Crystallographic analysis of CaaX prenyltransferases complexed with substrates defines rules of protein substrate selectivity.
Reid TS, etal., J Mol Biol. 2004 Oct 15;343(2):417-33.
10.
GOA pipeline
RGD automated data pipeline
11.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
13.
Role of the carboxyterminal residue in peptide binding to protein farnesyltransferase and protein geranylgeranyltransferase.
Roskoski R Jr and Ritchie P, Arch Biochem Biophys. 1998 Aug 15;356(2):167-76.
14.
Structure of mammalian protein geranylgeranyltransferase type-I.
Taylor JS, etal., EMBO J. 2003 Nov 17;22(22):5963-74.
15.
cDNA cloning and expression of rat and human protein geranylgeranyltransferase type-I.
Zhang FL, etal., J Biol Chem 1994 Feb 4;269(5):3175-80.
16.
Properties and kinetic mechanism of recombinant mammalian protein geranylgeranyltransferase type I.
Zhang FL, etal., J Biol Chem. 1994 Sep 23;269(38):23465-70.
17.
TrkB-mediated activation of geranylgeranyltransferase I promotes dendritic morphogenesis.
Zhou XP, etal., Proc Natl Acad Sci U S A. 2008 Nov 4;105(44):17181-6. Epub 2008 Oct 28.
Pggt1b Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 41,138,536 - 41,182,145 (-) NCBI GRCr8 mRatBN7.2 18 38,952,147 - 38,995,656 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 38,952,914 - 38,995,503 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 40,986,574 - 41,028,748 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 41,688,793 - 41,730,969 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 39,481,904 - 39,524,080 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 40,173,236 - 40,218,225 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 40,175,951 - 40,218,225 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 39,826,667 - 39,871,483 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 40,410,055 - 40,452,883 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 18 40,447,595 - 40,490,419 (-) NCBI Celera 18 37,212,291 - 37,254,465 (-) NCBI Celera Cytogenetic Map 18 q11 NCBI
PGGT1B Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 115,204,012 - 115,262,877 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 115,204,012 - 115,262,877 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 114,539,709 - 114,598,574 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 114,575,476 - 114,626,449 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 114,575,475 - 114,626,449 NCBI Celera 5 110,494,046 - 110,546,088 (-) NCBI Celera Cytogenetic Map 5 q22.3 NCBI HuRef 5 109,728,848 - 109,780,942 (-) NCBI HuRef CHM1_1 5 113,979,258 - 114,031,277 (-) NCBI CHM1_1 T2T-CHM13v2.0 5 115,713,562 - 115,776,201 (-) NCBI T2T-CHM13v2.0
Pggt1b Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 18 46,368,411 - 46,414,173 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 18 46,368,418 - 46,414,060 (-) Ensembl GRCm39 Ensembl GRCm38 18 46,235,344 - 46,281,089 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 18 46,235,351 - 46,280,993 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 18 46,399,603 - 46,440,504 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 18 46,365,280 - 46,406,181 (-) NCBI MGSCv36 mm8 Celera 18 47,599,910 - 47,646,046 (-) NCBI Celera Cytogenetic Map 18 C NCBI cM Map 18 24.45 NCBI
Pggt1b Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955408 34,994,545 - 35,049,037 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955408 34,994,545 - 35,049,037 (-) NCBI ChiLan1.0 ChiLan1.0
PGGT1B Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 110,459,853 - 110,511,951 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 108,613,523 - 108,665,713 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 110,558,684 - 110,622,175 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 116,360,149 - 116,419,069 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 116,366,984 - 116,419,069 (-) Ensembl panpan1.1 panPan2
PGGT1B Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 11 4,967,504 - 5,020,491 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 11 4,880,404 - 5,020,473 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 11 5,099,400 - 5,171,320 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 11 4,940,644 - 5,012,576 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 11 4,953,486 - 5,012,560 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 11 4,896,291 - 4,968,192 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 11 4,977,938 - 5,037,052 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 11 5,218,691 - 5,290,606 (-) NCBI UU_Cfam_GSD_1.0
Pggt1b
PGGT1B Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 119,383,387 - 119,440,322 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 119,386,692 - 119,440,834 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 124,200,641 - 124,235,373 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PGGT1B Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 23 18,462,750 - 18,517,193 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 23 18,464,827 - 18,517,176 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666034 59,882,912 - 59,945,051 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pggt1b
.
Predicted Target Of
Count of predictions: 244 Count of miRNA genes: 171 Interacting mature miRNAs: 199 Transcripts: ENSRNOT00000004723 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331733 Bp233 Blood pressure QTL 233 3.97196 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 24796977 79788953 Rat 1358358 Sradr6 Stress Responsive Adrenal Weight QTL 6 2.49 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 18 11944299 59330563 Rat 1331798 Bp224 Blood pressure QTL 224 3.53873 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359408 59796643 Rat 2301413 Bp318 Blood pressure QTL 318 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 26548082 46969551 Rat 61383 Bp47 Blood pressure QTL 47 17.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 31271681 60377755 Rat 1331741 Bp232 Blood pressure QTL 232 3.59112 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 21372893 83213037 Rat 1331742 Bp228 Blood pressure QTL 228 3.88752 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359408 59796643 Rat 1331776 Bp225 Blood pressure QTL 225 2.829 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 31359408 59796643 Rat 6903359 Bp355 Blood pressure QTL 355 3.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 11944544 59796478 Rat 631518 Bw11 Body weight QTL 11 2.8 body mass (VT:0001259) body weight (CMO:0000012) 18 35870723 80870723 Rat 12904668 Bw188 Body weight QTL 188 0.03 body mass (VT:0001259) body weight (CMO:0000012) 18 26548082 46969551 Rat 2313082 Bss85 Bone structure and strength QTL 85 0.8 0.0001 long bone metaphysis morphology trait (VT:0000133) tibia midshaft total cross-sectional area (CMO:0001715) 18 14951337 59951337 Rat 12904669 Cm125 Cardiac mass QTL 125 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 18 26548082 46969551 Rat 1641923 Colcr8 Colorectal carcinoma resistance QTL 8 3.1 0.0014 intestine integrity trait (VT:0010554) poorly differentiated malignant colorectal tumor number (CMO:0002076) 18 22066242 52293055 Rat 12904670 Cm126 Cardiac mass QTL 126 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 18 26548082 46969551 Rat 6903347 Bp350 Blood pressure QTL 350 4.4 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359530 59796478 Rat 2312568 Glom21 Glomerulus QTL 21 2 0.005 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 18 5185858 40503530 Rat 1331727 Bp237 Blood pressure QTL 237 3.053 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359408 61698465 Rat 2300157 Bmd66 Bone mineral density QTL 66 13.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 18 28964853 73964853 Rat 738005 Anxrr11 Anxiety related response QTL 11 3.4 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 18 30039813 75039813 Rat 12904677 Kidm72 Kidney mass QTL 72 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 18 26548082 46969551 Rat 631274 Sprol1 Serum protein level QTL 1 5.3 blood total protein amount (VT:0005567) serum total protein level (CMO:0000661) 18 31393320 77209694 Rat 1358193 Emca2 Estrogen-induced mammary cancer QTL 2 1.6 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 18 18007599 63571040 Rat 12904673 Cm127 Cardiac mass QTL 127 0.005 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 18 26548082 46969551 Rat 12904675 Am19 Aortic mass QTL 19 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 18 26548082 46969551 Rat 2293704 Bss35 Bone structure and strength QTL 35 4.59 0.0002 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 18 28964853 73964853 Rat 9589816 Gluco68 Glucose level QTL 68 7.25 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 18 29792965 74792965 Rat 1331774 Bp226 Blood pressure QTL 226 4.41065 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359408 59796643 Rat 2325839 Bp348 Blood pressure QTL 348 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 25570985 70570985 Rat 1600373 Mamtr6 Mammary tumor resistance QTL 6 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 18 19278901 83218561 Rat 2293708 Bss46 Bone structure and strength QTL 46 8.8 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 18 11791518 63636873 Rat 8694378 Bw157 Body weight QTL 157 3.59 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 18 29792965 74792965 Rat 2300177 Bmd65 Bone mineral density QTL 65 19.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 18 28964853 73964853 Rat 9589153 Insul31 Insulin level QTL 31 7.15 0.05 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 18 1 42547119 Rat 1578667 Bss21 Bone structure and strength QTL 21 3.5 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 18 11791518 83218561 Rat 2303120 Mamtr8 Mammary tumor resistance QTL 8 0.001 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 18 31359408 83218561 Rat 61429 Cia17 Collagen induced arthritis QTL 17 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 18 31359408 70263868 Rat 61367 Iddm4 Insulin dependent diabetes mellitus QTL 4 2.33 0.0074 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 18 38192455 83192455 Rat 2299160 Iddm35 Insulin dependent diabetes mellitus QTL 35 2.79 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 18 4207941 60377792 Rat 9590318 Scort22 Serum corticosterone level QTL 22 7.64 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 18 29792965 74792965 Rat 1578661 Bss20 Bone structure and strength QTL 20 3.7 femur morphology trait (VT:0000559) femoral neck cross-sectional area (CMO:0001697) 18 11791518 83218561 Rat 1331753 Bp231 Blood pressure QTL 231 3.643 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 11944299 52293055 Rat 1331754 Bp230 Blood pressure QTL 230 4.61609 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 29792965 74792965 Rat 61375 Bp41 Blood pressure QTL 41 2.4 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 18 11944299 41122201 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000004723 ⟹ ENSRNOP00000004723
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 38,952,917 - 38,995,503 (-) Ensembl Rnor_6.0 Ensembl 18 40,175,951 - 40,218,225 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000097524 ⟹ ENSRNOP00000087553
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 38,952,917 - 38,995,503 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000103699 ⟹ ENSRNOP00000095779
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 38,952,914 - 38,995,491 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000116864 ⟹ ENSRNOP00000087099
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 38,952,917 - 38,995,281 (-) Ensembl
RefSeq Acc Id:
NM_031082 ⟹ NP_112344
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 41,139,965 - 41,182,139 (-) NCBI mRatBN7.2 18 38,953,329 - 38,995,507 (-) NCBI Rnor_6.0 18 40,175,951 - 40,218,225 (-) NCBI Rnor_5.0 18 39,826,667 - 39,871,483 (-) NCBI RGSC_v3.4 18 40,410,055 - 40,452,883 (-) RGD Celera 18 37,212,291 - 37,254,465 (-) RGD
Sequence:
GGACAGCGCATGGCGGCCACAGAGGATGACAGACTGGCGGGGAGCGGAGAAGGAGAACGGCTGGATTTCCTGCGGGACCGACACGTGCGGTTCTTCCAGCGCTGCCTCCAGGTCTTGCCGGAGCGGTA
hide sequence
RefSeq Acc Id:
XM_008772177 ⟹ XP_008770399
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 41,138,536 - 41,182,046 (-) NCBI mRatBN7.2 18 38,953,360 - 38,995,498 (-) NCBI Rnor_6.0 18 40,173,236 - 40,218,167 (-) NCBI
Sequence:
CTGGATTTCCTGCGGGACCGACACGTGCGGTTCTTCCAGCGCTGCCTCCAGGTCTTGCCGGAGC
hide sequence
RefSeq Acc Id:
XM_039097140 ⟹ XP_038953068
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 41,138,536 - 41,177,311 (-) NCBI mRatBN7.2 18 38,952,147 - 38,995,520 (-) NCBI
RefSeq Acc Id:
XM_039097141 ⟹ XP_038953069
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 41,147,688 - 41,182,145 (-) NCBI mRatBN7.2 18 38,961,058 - 38,995,656 (-) NCBI
RefSeq Acc Id:
NP_112344 ⟸ NM_031082
- UniProtKB:
P53610 (UniProtKB/Swiss-Prot), A6IWV1 (UniProtKB/TrEMBL), A0A8I6A578 (UniProtKB/TrEMBL)
- Sequence:
MAATEDDRLAGSGEGERLDFLRDRHVRFFQRCLQVLPERYSSLETSRLTIAFFALSGLDMLDSLDVVNKDDIIEWIYSLQVLPTEDRSNLDRCGFRGSSYLGIPFNPSKNPGTAHPYDSGHIAMTYTG
hide sequence
RefSeq Acc Id:
XP_008770399 ⟸ XM_008772177
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6A578 (UniProtKB/TrEMBL)
- Sequence:
MLDSLDVVNKDDIIEWIYSLQVLPTEDRSNLDRCGFRGSSYLGIPFNPSKNPGTAHPYDSGHIAMTYTGLSCLIILGDDLSRVDKEACLAGLRALQLEDGSFCAVPEGSENDMRFVYCASCICYMLNN
hide sequence
Ensembl Acc Id:
ENSRNOP00000004723 ⟸ ENSRNOT00000004723
RefSeq Acc Id:
XP_038953068 ⟸ XM_039097140
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038953069 ⟸ XM_039097141
- Peptide Label:
isoform X3
Ensembl Acc Id:
ENSRNOP00000095779 ⟸ ENSRNOT00000103699
Ensembl Acc Id:
ENSRNOP00000087099 ⟸ ENSRNOT00000116864
Ensembl Acc Id:
ENSRNOP00000087553 ⟸ ENSRNOT00000097524
RGD ID: 13700760 Promoter ID: EPDNEW_R11284 Type: multiple initiation site Name: Pggt1b_1 Description: protein geranylgeranyltransferase type 1 subunit beta SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 18 40,218,228 - 40,218,288 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-08-08
Pggt1b
protein geranylgeranyltransferase type I subunit beta
Pggt1b
protein geranylgeranyltransferase type 1 subunit beta
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-02-03
Pggt1b
protein geranylgeranyltransferase type 1 subunit beta
Pggt1b
protein geranylgeranyltransferase type I, beta subunit
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Pggt1b
protein geranylgeranyltransferase type I, beta subunit
geranylgeranyltransferase type I (GGTase-I)
Name updated
1299863 APPROVED
2002-08-07
Pggt1b
geranylgeranyltransferase type I (GGTase-I)
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_product
beta subunit of geranylgeranyltransferase type I
729447
