Advanced Search (OLGA)

Gene: Khdrbs2 (KH RNA binding domain containing, signal transduction associated 2) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Khdrbs2

Name:

KH RNA binding domain containing, signal transduction associated 2

RGD ID:

621738

Description:

Predicted to enable RNA binding activity and protein domain specific binding activity. Predicted to be involved in regulation of alternative mRNA splicing, via spliceosome. Predicted to be active in nucleus. Orthologous to human KHDRBS2 (KH RNA binding domain containing, signal transduction associated 2); INTERACTS WITH 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

KH domain containing, RNA binding, signal transduction associated 2; KH domain-containing, RNA-binding, signal transduction-associated protein 2; rSLM-1; Sam68-like mammalian protein 1; SLM-1; Slm1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	41,943,029 - 42,449,687 (+)	NCBI		GRCr8
mRatBN7.2	9	34,447,023 - 34,953,684 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	34,447,056 - 34,915,530 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	42,939,773 - 43,410,674 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	48,075,177 - 48,543,663 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	46,357,022 - 46,825,573 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	39,501,431 - 40,008,707 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	39,539,530 - 40,008,680 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	39,171,658 - 39,679,421 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	30,918,047 - 31,404,074 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	30,919,460 - 31,405,485 (+)	NCBI
Celera	9	32,245,972 - 32,715,211 (+)	NCBI		Celera
Cytogenetic Map	9	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Khdrbs2	Rat	melanoma		ISO	KHDRBS2 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:21499247

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Khdrbs2	Rat	1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine	increases expression	EXP		6480464	chlorcyclizine results in increased expression of KHDRBS2 mRNA	CTD	PMID:21058326
Khdrbs2	Rat	17beta-estradiol	multiple interactions	EXP		6480464	[bisphenol A co-treated with Estradiol] results in increased expression of KHDRBS2 mRNA and [Testosterone co-treated with Estradiol] results in increased expression of KHDRBS2 mRNA	CTD	PMID:26496021 and PMID:32741896
Khdrbs2	Rat	17beta-estradiol	multiple interactions	ISO	KHDRBS2 (Homo sapiens)	6480464	Estradiol promotes the reaction [KHDRBS2 protein binds to ESR1 protein]	CTD	PMID:27156127
Khdrbs2	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Khdrbs2 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of KHDRBS2 mRNA	CTD	PMID:24680724
Khdrbs2	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of KHDRBS2 mRNA	CTD	PMID:32109520
Khdrbs2	Rat	2,3,7,8-Tetrachlorodibenzofuran	decreases expression	EXP		6480464	2 more ...	CTD	PMID:32109520
Khdrbs2	Rat	4,4'-sulfonyldiphenol	affects methylation	ISO	Khdrbs2 (Mus musculus)	6480464	bisphenol S affects the methylation of KHDRBS2 gene	CTD	PMID:31683443
Khdrbs2	Rat	aflatoxin B1	decreases methylation	ISO	KHDRBS2 (Homo sapiens)	6480464	Aflatoxin B1 results in decreased methylation of KHDRBS2 gene	CTD	PMID:27153756
Khdrbs2	Rat	Aflatoxin B2 alpha	increases methylation	ISO	KHDRBS2 (Homo sapiens)	6480464	aflatoxin B2 results in increased methylation of KHDRBS2 intron	CTD	PMID:30157460
Khdrbs2	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of KHDRBS2 mRNA	CTD	PMID:16483693
Khdrbs2	Rat	atrazine	affects methylation	EXP		6480464	Atrazine affects the methylation of KHDRBS2 gene	CTD	PMID:28931070
Khdrbs2	Rat	benzo[a]pyrene	increases methylation	ISO	KHDRBS2 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of KHDRBS2 exon and Benzo(a)pyrene results in increased methylation of KHDRBS2 promoter	CTD	PMID:27901495
Khdrbs2	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	KHDRBS2 (Homo sapiens)	6480464	Diethylhexyl Phthalate results in decreased expression of KHDRBS2 mRNA	CTD	PMID:31163220
Khdrbs2	Rat	bis(2-ethylhexyl) phthalate	multiple interactions	EXP		6480464	[Genistein co-treated with Diethylhexyl Phthalate] results in decreased expression of KHDRBS2 mRNA	CTD	PMID:36674726
Khdrbs2	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with Estradiol] results in increased expression of KHDRBS2 mRNA	CTD	PMID:26496021
Khdrbs2	Rat	bisphenol A	decreases expression	ISO	Khdrbs2 (Mus musculus)	6480464	bisphenol A results in decreased expression of KHDRBS2 mRNA	CTD	PMID:32156529
Khdrbs2	Rat	bisphenol A	increases methylation	ISO	KHDRBS2 (Homo sapiens)	6480464	bisphenol A results in increased methylation of KHDRBS2 gene	CTD	PMID:31601247
Khdrbs2	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of KHDRBS2 gene	CTD	PMID:28505145
Khdrbs2	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of KHDRBS2 mRNA	CTD	PMID:25181051 more ...
Khdrbs2	Rat	chlorpyrifos	decreases expression	EXP		6480464	Chlorpyrifos results in decreased expression of KHDRBS2 mRNA	CTD	PMID:18668222
Khdrbs2	Rat	ethanol	increases expression	ISO	Khdrbs2 (Mus musculus)	6480464	Ethanol results in increased expression of KHDRBS2 mRNA	CTD	PMID:30319688
Khdrbs2	Rat	fonofos	increases methylation	ISO	KHDRBS2 (Homo sapiens)	6480464	Fonofos results in increased methylation of KHDRBS2 promoter	CTD	PMID:22847954
Khdrbs2	Rat	genistein	multiple interactions	ISO	KHDRBS2 (Homo sapiens)	6480464	Genistein promotes the reaction [KHDRBS2 protein binds to ESR1 protein]	CTD	PMID:27156127
Khdrbs2	Rat	genistein	multiple interactions	EXP		6480464	[Genistein co-treated with Diethylhexyl Phthalate] results in decreased expression of KHDRBS2 mRNA	CTD	PMID:36674726
Khdrbs2	Rat	genistein	decreases expression	ISO	Khdrbs2 (Mus musculus)	6480464	Genistein results in decreased expression of KHDRBS2 mRNA	CTD	PMID:32186404
Khdrbs2	Rat	levetiracetam	increases expression	EXP		6480464	Levetiracetam results in increased expression of KHDRBS2 mRNA	CTD	PMID:20345932
Khdrbs2	Rat	linsidomine	increases oxidation	EXP		6480464	linsidomine results in increased oxidation of KHDRBS2 protein	CTD	PMID:28086193
Khdrbs2	Rat	maneb	multiple interactions	ISO	Khdrbs2 (Mus musculus)	6480464	[Maneb co-treated with Paraquat] results in decreased expression of KHDRBS2 mRNA	CTD	PMID:36117858
Khdrbs2	Rat	paracetamol	increases expression	ISO	KHDRBS2 (Homo sapiens)	6480464	Acetaminophen results in increased expression of KHDRBS2 mRNA	CTD	PMID:26690555
Khdrbs2	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of KHDRBS2 mRNA	CTD	PMID:33387578
Khdrbs2	Rat	paraquat	multiple interactions	ISO	Khdrbs2 (Mus musculus)	6480464	[Maneb co-treated with Paraquat] results in decreased expression of KHDRBS2 mRNA	CTD	PMID:36117858
Khdrbs2	Rat	parathion	increases methylation	ISO	KHDRBS2 (Homo sapiens)	6480464	Parathion results in increased methylation of KHDRBS2 promoter	CTD	PMID:22847954
Khdrbs2	Rat	phenytoin	increases expression	EXP		6480464	Phenytoin results in increased expression of KHDRBS2 mRNA	CTD	PMID:20345932
Khdrbs2	Rat	rotenone	increases expression	ISO	KHDRBS2 (Homo sapiens)	6480464	Rotenone results in increased expression of KHDRBS2 mRNA	CTD	PMID:29955902
Khdrbs2	Rat	terbufos	increases methylation	ISO	KHDRBS2 (Homo sapiens)	6480464	terbufos results in increased methylation of KHDRBS2 promoter	CTD	PMID:22847954
Khdrbs2	Rat	testosterone	multiple interactions	EXP		6480464	[Testosterone co-treated with Estradiol] results in increased expression of KHDRBS2 mRNA	CTD	PMID:32741896
Khdrbs2	Rat	titanium dioxide	decreases methylation	ISO	Khdrbs2 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of KHDRBS2 promoter	CTD	PMID:35295148
Khdrbs2	Rat	trichloroethene	decreases expression	EXP		6480464	Trichloroethylene results in decreased expression of KHDRBS2 mRNA	CTD	PMID:33387578
Khdrbs2	Rat	valproic acid	decreases expression	ISO	KHDRBS2 (Homo sapiens)	6480464	Valproic Acid results in decreased expression of KHDRBS2 mRNA	CTD	PMID:23179753
Khdrbs2	Rat	valproic acid	decreases methylation	ISO	KHDRBS2 (Homo sapiens)	6480464	Valproic Acid results in decreased methylation of KHDRBS2 gene	CTD	PMID:29154799
Khdrbs2	Rat	vinclozolin	increases methylation	EXP		6480464	vinclozolin results in increased methylation of KHDRBS2 gene	CTD	PMID:31682807

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Khdrbs2	Rat	mRNA processing	involved_in	IEA	UniProtKB-KW:KW-0507	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Khdrbs2	Rat	regulation of alternative mRNA splicing, via spliceosome	involved_in	IBA	FB:FBgn0022984 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Khdrbs2	Rat	regulation of mRNA splicing, via spliceosome	involved_in	ISO	Khdrbs2 (Mus musculus)	1624291	PMID:22196734	RGD	PMID:22196734
Khdrbs2	Rat	regulation of mRNA splicing, via spliceosome	involved_in	IEA	ARBA:ARBA00028577	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Khdrbs2	Rat	regulation of mRNA splicing, via spliceosome	involved_in	IEA	UniProtKB:Q9WU01 and ensembl:ENSMUSP00000027226	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Khdrbs2	Rat	nucleus	is_active_in	IBA	FB:FBgn0022984 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Khdrbs2	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Khdrbs2	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Khdrbs2	Rat	mRNA binding	enables	IBA	FB:FBgn0264491 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Khdrbs2	Rat	nucleic acid binding	enables	IEA	InterPro:IPR004087	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Khdrbs2	Rat	poly(A) binding	enables	IBA	MGI:2159649 and PANTHER:PTN002598470	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Khdrbs2	Rat	poly(A) binding	enables	IEA	UniProtKB:Q9WU01 and ensembl:ENSMUSP00000027226	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Khdrbs2	Rat	poly(A) binding	enables	ISO	Khdrbs2 (Mus musculus)	1624291	PMID:10077576	RGD	PMID:10077576
Khdrbs2	Rat	poly(U) RNA binding	enables	IEA	UniProtKB:Q9WU01 and ensembl:ENSMUSP00000027226	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Khdrbs2	Rat	poly(U) RNA binding	enables	ISO	Khdrbs2 (Mus musculus)	1624291	PMID:10077576	RGD	PMID:10077576
Khdrbs2	Rat	protein binding		IPI	Rbmx (Rattus norvegicus)	2316827		RGD
Khdrbs2	Rat	protein binding	enables	ISO	Khdrbs2 (Mus musculus)	1624291	UniProtKB:P06241 more ...	RGD	PMID:10077576
Khdrbs2	Rat	protein binding	enables	ISO	KHDRBS2 (Homo sapiens)	1624291	UniProtKB:A0A0S2Z5X4 more ...	RGD	PMID:16189514 more ...
Khdrbs2	Rat	RNA binding	enables	IEA	InterPro:IPR036612	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Khdrbs2	Rat	RNA binding	enables	IEA	UniProtKB-KW:KW-0694	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Khdrbs2	Rat	SH2 domain binding	enables	ISO	Khdrbs2 (Mus musculus)	1624291	PMID:10077576	RGD	PMID:10077576
Khdrbs2	Rat	SH2 domain binding	enables	IEA	UniProtKB:Q9WU01 and ensembl:ENSMUSP00000027226	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Khdrbs2	Rat	SH3 domain binding	enables	ISO	Khdrbs2 (Mus musculus)	1624291	PMID:10077576	RGD	PMID:10077576
Khdrbs2	Rat	SH3 domain binding	enables	IEA	UniProtKB-KW:KW-0729	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Khdrbs2	Rat	SH3 domain binding	enables	IEA	UniProtKB:Q9WU01 and ensembl:ENSMUSP00000027226	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

#	Reference Title	Reference Citation
1.	Characterization of Sam68-like mammalian proteins SLM-1 and SLM-2: SLM-1 is a Src substrate during mitosis.	Di Fruscio M, etal., Proc Natl Acad Sci U S A 1999 Mar 16;96(6):2710-5.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Heterogeneous nuclear ribonucleoprotein G regulates splice site selection by binding to CC(A/C)-rich regions in pre-mRNA.	Heinrich B, etal., J Biol Chem. 2009 May 22;284(21):14303-15. Epub 2009 Mar 12.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	GOA pipeline	RGD automated data pipeline
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	p59(fyn)-mediated phosphorylation regulates the activity of the tissue-specific splicing factor rSLM-1.	Stoss O, etal., Mol Cell Neurosci 2004 Sep;27(1):8-21.

PMID:21516116	PMID:22196734	PMID:25416956

Khdrbs2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	41,943,029 - 42,449,687 (+)	NCBI		GRCr8
mRatBN7.2	9	34,447,023 - 34,953,684 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	34,447,056 - 34,915,530 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	42,939,773 - 43,410,674 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	48,075,177 - 48,543,663 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	46,357,022 - 46,825,573 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	39,501,431 - 40,008,707 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	39,539,530 - 40,008,680 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	39,171,658 - 39,679,421 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	30,918,047 - 31,404,074 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	30,919,460 - 31,405,485 (+)	NCBI
Celera	9	32,245,972 - 32,715,211 (+)	NCBI		Celera
Cytogenetic Map	9	q21	NCBI

KHDRBS2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	61,542,670 - 62,286,225 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	61,630,234 - 62,286,225 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	62,252,575 - 62,996,130 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	62,447,824 - 63,054,091 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	62,447,823 - 63,054,091	NCBI
Celera	6	60,547,513 - 61,153,711 (-)	NCBI		Celera
Cytogenetic Map	6	q11.1	NCBI
HuRef	6	59,556,167 - 60,162,759 (-)	NCBI		HuRef
CHM1_1	6	62,556,127 - 63,162,398 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	62,687,495 - 63,431,119 (-)	NCBI		T2T-CHM13v2.0

Khdrbs2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	32,211,683 - 32,744,305 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	32,211,795 - 32,697,649 (+)	Ensembl		GRCm39 Ensembl
GRCm38	1	32,172,602 - 32,705,224 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	32,172,714 - 32,658,568 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	32,229,651 - 32,714,583 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	32,117,352 - 32,602,284 (+)	NCBI		MGSCv36	mm8
Celera	1	31,966,556 - 32,446,126 (+)	NCBI		Celera
Cytogenetic Map	1	B	NCBI
cM Map	1	11.86	NCBI

Khdrbs2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955502	1,509,237 - 1,943,297 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955502	1,486,799 - 1,944,298 (+)	NCBI	ChiLan1.0	ChiLan1.0

KHDRBS2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	76,335,683 - 77,131,007 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	70,997,531 - 71,791,120 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	59,161,367 - 59,954,702 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	64,550,407 - 65,228,125 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	64,624,694 - 65,227,850 (-)	Ensembl	panpan1.1		panPan2

KHDRBS2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	25,544,069 - 26,142,284 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	25,585,694 - 26,142,337 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	25,455,103 - 26,052,270 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	26,081,733 - 26,679,733 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	26,105,536 - 26,679,783 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	25,626,421 - 26,181,127 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	25,664,086 - 26,261,662 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	25,795,120 - 26,364,939 (-)	NCBI		UU_Cfam_GSD_1.0

Khdrbs2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	60,940,318 - 61,490,805 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936476	2,469,349 - 3,000,993 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936476	2,469,396 - 3,001,997 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

KHDRBS2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	27,390,918 - 27,895,597 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	27,348,614 - 27,895,572 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	31,958,286 - 32,322,254 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

KHDRBS2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	12,522,386 - 13,150,784 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	12,522,531 - 12,898,201 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666058	18,836,350 - 19,478,329 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Khdrbs2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624753	20,209,485 - 20,757,679 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624753	20,174,101 - 20,757,402 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Khdrbs2
3670 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	262
Count of miRNA genes:	174
Interacting mature miRNAs:	201
Transcripts:	ENSRNOT00000016578
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7411571	Bw138	Body weight QTL 138	14.3	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	9	32535505	77535505	Rat
1300180	Bw14	Body weight QTL 14	3.776		body mass (VT:0001259)	body weight (CMO:0000012)	9	23754024	61381613	Rat
631680	Cm11	Cardiac mass QTL 11	3.1	0.00089	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	9	20430519	65430519	Rat
70218	Cm28	Cardiac mass QTL 28	8.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	9	25268044	79271759	Rat
724544	Uae9	Urinary albumin excretion QTL 9	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	9	25268044	114175309	Rat
1354650	Despr5	Despair related QTL 5	4.01	0.0017	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	9	1254084	46254084	Rat
1300124	Cm4	Cardiac mass QTL 4	3.55		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	9	1	40594091	Rat
7207805	Bmd88	Bone mineral density QTL 88	4		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	9	23754024	58157242	Rat
631643	Bp120	Blood pressure QTL 120	3	0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	22071200	67071200	Rat
731164	Uae25	Urinary albumin excretion QTL 25	3.5	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	25661188	100929786	Rat
9589133	Insul26	Insulin level QTL 26	17.96	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	9	8952560	53952560	Rat
631211	Bw4	Body weight QTL4	5.31		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	9	5109826	50109826	Rat
2303559	Gluco54	Glucose level QTL 54	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	9	1254084	46254084	Rat
7411609	Foco16	Food consumption QTL 16	25.6	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	8952560	53952560	Rat
70186	Niddm26	Non-insulin dependent diabetes mellitus QTL 26	3.87		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	9	22071169	86369743	Rat
7207814	Bmd91	Bone mineral density QTL 91	3.5		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	9	23754144	83851531	Rat
9589055	Scfw5	Subcutaneous fat weight QTL 5	5.55	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	9	1	37999212	Rat
1641911	Alcrsp13	Alcohol response QTL 13			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	9	1	43718459	Rat
61425	Cia15	Collagen induced arthritis QTL 15	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	9	5109826	42921101	Rat
9589158	Gluco65	Glucose level QTL 65	6.82	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	9	1	37999212	Rat
10054125	Srcrt7	Stress Responsive Cort QTL 7	3.33	0.0011	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	9	1	87073594	Rat
724543	Cm20	Cardiac mass QTL 20	3.9		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	9	16961398	40594091	Rat
1600365	Mcs20	Mammary carcinoma susceptibility QTL 20	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	9	13533770	42791750	Rat
11353947	Bp392	Blood pressure QTL 392			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	7283252	52283252	Rat
7411592	Foco8	Food consumption QTL 8	7.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	1	37999212	Rat
1331757	Cdexp1	CD45RC expression in CD8 T cells QTL 1	4.3		CD8-positive T cell quantity (VT:0008077)	blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990)	9	1024537	67509080	Rat
7411656	Foco26	Food consumption QTL 26	9.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	32535505	77535505	Rat
1298088	Edpm11	Estrogen-dependent pituitary mass QTL 11	2.5		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	9	1	43718459	Rat
1598823	Memor16	Memory QTL 16	1.9		exploratory behavior trait (VT:0010471)	difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678)	9	22133322	49968732	Rat
1641894	Alcrsp12	Alcohol response QTL 12			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	9	27468639	72468639	Rat

AU047600

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	9	42,255,665 - 42,255,831 (+)	Marker Load Pipeline
mRatBN7.2	9	34,759,659 - 34,759,825 (-)	MAPPER	mRatBN7.2
Rnor_6.0	9	39,696,010 - 39,696,175	NCBI	Rnor6.0
Rnor_5.0	9	39,366,544 - 39,366,709	UniSTS	Rnor5.0
RGSC_v3.4	9	31,246,578 - 31,246,743	UniSTS	RGSC3.4
Celera	9	32,559,074 - 32,559,239	UniSTS
Cytogenetic Map	9	q21	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
7	6	30	110	37	26	13	5	13	3	120	50	93	44	60	13


RefSeq Transcripts	NM_133318	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039082989	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_001839640	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005488844	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005488845	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005488846	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010054563	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010054564	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF305618	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473965	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000016578 ⟹ ENSRNOP00000016579

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	34,447,056 - 34,915,530 (+)	Ensembl
Rnor_6.0 Ensembl	9	39,539,530 - 40,008,680 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107830 ⟹ ENSRNOP00000095124

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	34,447,056 - 34,570,970 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000113927 ⟹ ENSRNOP00000076472

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	34,447,056 - 34,518,418 (+)	Ensembl

RefSeq Acc Id:

NM_133318 ⟹ NP_579852

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	41,943,070 - 42,411,545 (+)	NCBI
mRatBN7.2	9	34,447,056 - 34,915,540 (+)	NCBI
Rnor_6.0	9	39,539,520 - 40,008,680 (-)	NCBI
Rnor_5.0	9	39,171,658 - 39,679,421 (-)	NCBI
RGSC_v3.4	9	30,918,047 - 31,404,074 (+)	RGD
Celera	9	32,245,972 - 32,715,211 (+)	RGD

Sequence:

show sequence

AGGCGGGAGAGGCAGGTACCAGCGCGGTCTGCGCAGCCCGAGGCGCTAGAGCTGCGCTCACCGCAGGAAGGACGGTTCCTGGGGGAACCAGGGACCGAGGCGTCCGAGCAGGCGGGATTTGCGCCTGG
CCGGCCACGGTCCGAAGTCCGCGCTATGGGAGAAGAGAAATACTTGCCTGAGCTGATGGCAGAGAAGGATAGCCTTGATCCATCTTTTGTGCACGCGTCGCGCCTTCTGGCGGAAGAAATTGAGAAAT
TCCAAGGCTCGGATGGAAGAAAAGAAGATGAGGAAAAGAAGTATCTCGATGTCATCAGCAACAAAAACATAAAGCTCTCGGAAAGGGTATTGATCCCCGTGAAACAGTATCCAAAGTTCAATTTTGTG
GGGAAATTGCTTGGACCAAGAGGAAACTCCTTGAAGAGGCTACAAGAAGAAACGGGTGCTAAAATGTCTATCCTGGGCAAAGGATCGATGCGTGACAAGGCAAAGGAAGAAGAGCTGAGGAAGAGTGG
GGAGGCCAAGTATGCCCACCTGAGTGACGAACTGCACGTATTAATTGAAGTGTTTGCTCCACCCGGGGAAGCTTACTCACGGATGAGTCATGCTTTGGAAGAGATTAAAAAATTCCTGGTTCCTGACT
ACAATGATGAAATTCGTCAAGAGCAACTCCGGGAGTTGTCTTACTTGAATGGCTCAGAAGAGTCTGGCCGGGGCCGAGGTATTAGAGGCAGAGGGATCAGAATAACTCCCACAGCTCCTTCAAGGGGC
CGTGGGGGTGCTGTTCCACCACCACCACCACCTGGACGAGGTGTTCTTACCCCTCGGGGAACCACTGTGACCCGCGGAGCTCTCCCAGTACCCCCAGTAGCAAGAGGTGTCCCAACACCTCGAGCCCG
GGGAACAGCAGCGGTCCCAGGATACAGAGCGCCCCCACCTCCAGCTCCTGAGGCTTATGAAGAGTATGGGTACGATGATGGCTATGGGGGTGAATATGATGACCAGACCTATGAGGCTTATGATAATA
GCTACGTGACCCCGACACAAAGTGTGCCTGAATACTATGACTATGGTCATGGAGTAAATGAGGATGCCTATGACAGCTACGCACCAGAAGAATGGACCACAACCCGCTCCAGCCTGAAGGCACCACCA
CCAAGGTCAGCCAGAGGGGGATACAGGGAACACCCCTATGGTAGATATTGAAGGTCCTCTTCACCTGGTGACCTCCTCAAAGACAATTCATAGCCTGTGCTCTTCACATTAAACAGCAACAAGACAAG
TAATAGTCTTTTTTGTTTGTTTTGTTTTTTCTATCCTAGGGGGATAACTGCTCATAATTACTCCCACCCTATTCTTGTATTCTCTTAATACTGGTTAACGTTGACATGGACATTAGTATTATTTTATA
AAACAGACTGGAAAAAAAAGAGACTGGCAAGCATAGTTTATAAACCATTCTGTAGGTTGATATTCTCTTGATTGTTTTTTTTTTTAATTGTTGTGTGTAAACCGCCAACCCCTTCCCTTTCCTTTTCG
GTTTCCTTTCTCCTTTTTCTTTTGTAGAAAAAAAAAGAGCATGAACCTGTTAGATTTTGAGTCTCAACCAACTAGCCGAACCTTTGTTTAGGGTTGTTAAAAGACTGTAATATGATTTTGAACTAGCT
GATAACACAGTTGTAGATAAGATGTTTTAACCTGTCTTTTAATATCTGTTAGTCAGATGGAGATGTTCAATATTAAGTTGTAAATTTAATTTTTAAATGCTGTTTTAATGGGGTGGAAAACAAGCAGC
TACTGTATGTATGTAGCTAACTGAATTTGTTCAGTGTTTTAACCTGTATTTGTTAAAAAAAGAAAAAAGAAAAAAACACACATGAAGTTCCATGTGTAAGCTTCTCTAAATAGGAACCACAATTTGTC
AAATATGTTTGCCATAATTTGTCAATAAAGCTGAAGGCTTTTGTAAAAACTAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039082989 ⟹ XP_038938917

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	41,943,029 - 42,411,818 (+)	NCBI
mRatBN7.2	9	34,447,024 - 34,915,815 (+)	NCBI

RefSeq Acc Id:

XR_005488844

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	41,943,029 - 42,449,560 (+)	NCBI
mRatBN7.2	9	34,447,024 - 34,953,684 (+)	NCBI

RefSeq Acc Id:

XR_005488845

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	41,943,029 - 42,449,687 (+)	NCBI
mRatBN7.2	9	34,447,023 - 34,953,684 (+)	NCBI

RefSeq Acc Id:

XR_005488846

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	41,943,029 - 42,449,687 (+)	NCBI
mRatBN7.2	9	34,447,023 - 34,953,684 (+)	NCBI

RefSeq Acc Id:

XR_010054563

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	41,943,029 - 42,449,687 (+)	NCBI

RefSeq Acc Id:

XR_010054564

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	41,943,029 - 42,449,687 (+)	NCBI


Protein RefSeqs	NP_579852	(Get FASTA)	NCBI Sequence Viewer
	XP_038938917	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAL09360	(Get FASTA)	NCBI Sequence Viewer
	EDL99324	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000016579
	ENSRNOP00000016579.3
	ENSRNOP00000100781
GenBank Protein	Q920F3	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_579852 ⟸ NM_133318

- UniProtKB:

Q920F3 (UniProtKB/Swiss-Prot), A6IN86 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGEEKYLPELMAEKDSLDPSFVHASRLLAEEIEKFQGSDGRKEDEEKKYLDVISNKNIKLSERVLIPVKQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKAKEEELRKSGEAKYAHLS
DELHVLIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNGSEESGRGRGIRGRGIRITPTAPSRGRGGAVPPPPPPGRGVLTPRGTTVTRGALPVPPVARGVPTPRARGTAAVPGY
RAPPPPAPEAYEEYGYDDGYGGEYDDQTYEAYDNSYVTPTQSVPEYYDYGHGVNEDAYDSYAPEEWTTTRSSLKAPPPRSARGGYREHPYGRY

hide sequence

Ensembl Acc Id:

ENSRNOP00000016579 ⟸ ENSRNOT00000016578

RefSeq Acc Id:	XP_038938917 ⟸ XM_039082989
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000076472 ⟸ ENSRNOT00000113927

Ensembl Acc Id:

ENSRNOP00000095124 ⟸ ENSRNOT00000107830

Protein Domains

K Homology KH KHDRBS Qua1

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q920F3-F1-model_v2	AlphaFold	Q920F3	1-349	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-27887	BioCyc
Ensembl Genes	ENSRNOG00000012284	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000016578	ENTREZGENE
	ENSRNOT00000016578.6	UniProtKB/Swiss-Prot
	ENSRNOT00000154861	ENTREZGENE
Gene3D-CATH	3.30.1370.10	UniProtKB/Swiss-Prot
InterPro	BBP-like	UniProtKB/Swiss-Prot
	KH_dom	UniProtKB/Swiss-Prot
	KH_dom_type_1	UniProtKB/Swiss-Prot
	KH_dom_type_1_sf	UniProtKB/Swiss-Prot
	Qua1_dom	UniProtKB/Swiss-Prot
	Sam68-YY	UniProtKB/Swiss-Prot
KEGG Report	rno:170843	UniProtKB/Swiss-Prot
NCBI Gene	170843	ENTREZGENE
PANTHER	KH DOMAIN-CONTAINING, RNA-BINDING, SIGNAL TRANSDUCTION-ASSOCIATED PROTEIN 2	UniProtKB/Swiss-Prot
	PTHR11208	UniProtKB/Swiss-Prot
Pfam	KH_1	UniProtKB/Swiss-Prot
	Qua1	UniProtKB/Swiss-Prot
	Sam68-YY	UniProtKB/Swiss-Prot
PhenoGen	Khdrbs2	PhenoGen
PROSITE	KH_TYPE_1	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000012284	RatGTEx
SMART	SM00322	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF54791	UniProtKB/Swiss-Prot
UniProt	A0A8I5Y5X2_RAT	UniProtKB/TrEMBL
	A0A8I6AM17_RAT	UniProtKB/TrEMBL
	A6IN86	ENTREZGENE, UniProtKB/TrEMBL
	KHDR2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-06-01	Khdrbs2	KH RNA binding domain containing, signal transduction associated 2	Khdrbs2	KH domain containing, RNA binding, signal transduction associated 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Khdrbs2	KH domain containing, RNA binding, signal transduction associated 2	Slm1	Sam68-like mammalian protein 1	Symbol and Name updated	1299863	APPROVED
2002-08-07	Slm1	Sam68-like mammalian protein 1			Symbol and Name status set to provisional	70820	PROVISIONAL

Note Type	Note	Reference
gene_expression	expressed primarily in brain and to a lesser degree in testis	1358238

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - CTD