Symbol:
Per3
Name:
period circadian regulator 3
RGD ID:
621581
Description:
Predicted to enable enzyme binding activity; transcription cis-regulatory region binding activity; and transcription corepressor binding activity. Predicted to be involved in several processes, including entrainment of circadian clock by photoperiod; protein stabilization; and regulation of gene expression. Predicted to act upstream of or within circadian rhythm. Predicted to be active in cytoplasm and nucleus. Biomarker of alcohol use disorder. Human ortholog(s) of this gene implicated in advanced sleep phase syndrome; advanced sleep phase syndrome 3; and bipolar disorder. Orthologous to human PER3 (period circadian regulator 3); INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
circadian clock protein PERIOD 3; period circadian clock 3; period circadian protein homolog 3; period homolog 3; period homolog 3 (Drosophila); period3; rper3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 166,740,914 - 166,778,243 (-) NCBI GRCr8 mRatBN7.2 5 161,460,228 - 161,495,404 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 161,459,533 - 161,495,607 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 164,177,009 - 164,211,658 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 165,993,418 - 166,028,287 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 165,955,653 - 165,990,302 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 168,088,126 - 168,123,482 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 168,086,998 - 168,123,395 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 171,665,221 - 171,700,529 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 168,152,693 - 168,187,442 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 168,163,026 - 168,197,630 (-) NCBI Celera 5 159,712,426 - 159,747,156 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Per3 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of PER3 mRNA] CTD PMID:31150632 Per3 Rat (1->4)-beta-D-glucan multiple interactions ISO Per3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PER3 mRNA CTD PMID:36331819 Per3 Rat 1,2-dimethylhydrazine decreases expression ISO Per3 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of PER3 mRNA CTD PMID:22206623 Per3 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of PER3 mRNA CTD PMID:30723492 Per3 Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of PER3 mRNA CTD PMID:32145629 Per3 Rat 17beta-estradiol decreases expression ISO Per3 (Mus musculus) 6480464 Estradiol results in decreased expression of PER3 mRNA CTD PMID:39298647 Per3 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Per3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:28433925 Per3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Per3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PER3 mRNA CTD PMID:21570461 and PMID:28922406 Per3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PER3 mRNA CTD PMID:34747641 Per3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Per3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:28433925 Per3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PER3 mRNA CTD PMID:21215274 and PMID:22808131 Per3 Rat 2,4-D multiple interactions ISO Per3 (Mus musculus) 6480464 [lard co-treated with Cholesterol more ... CTD PMID:37567420 Per3 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:23196670 and PMID:32119087 Per3 Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions ISO Per3 (Mus musculus) 6480464 3 more ... CTD PMID:19467301 Per3 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Per3 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of PER3 mRNA CTD PMID:26251327 Per3 Rat 3,4-methylenedioxymethamphetamine increases methylation ISO Per3 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased methylation of PER3 promoter CTD PMID:26251327 Per3 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Per3 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of PER3 mRNA CTD PMID:26251327 Per3 Rat 4,4'-sulfonyldiphenol decreases expression ISO Per3 (Mus musculus) 6480464 bisphenol S results in decreased expression of PER3 mRNA CTD PMID:33297965 and PMID:39298647 Per3 Rat 4-hydroxyphenyl retinamide decreases expression ISO Per3 (Mus musculus) 6480464 Fenretinide results in decreased expression of PER3 mRNA CTD PMID:28973697 Per3 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of PER3 mRNA CTD PMID:24780913 Per3 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of PER3 mRNA CTD PMID:28959563 Per3 Rat acrylamide increases expression ISO Per3 (Mus musculus) 6480464 Acrylamide results in increased expression of PER3 mRNA CTD PMID:30807115 Per3 Rat aflatoxin B1 increases expression ISO Per3 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of PER3 mRNA CTD PMID:19770486 Per3 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of PER3 mRNA CTD PMID:23630614 and PMID:25378103 Per3 Rat aldehydo-D-glucose multiple interactions ISO Per3 (Mus musculus) 6480464 [lard co-treated with Cholesterol more ... CTD PMID:37567420 Per3 Rat all-trans-retinoic acid decreases expression ISO PER3 (Homo sapiens) 6480464 Tretinoin results in decreased expression of PER3 mRNA CTD PMID:33167477 Per3 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of PER3 mRNA CTD PMID:35163327 Per3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PER3 mRNA CTD PMID:16483693 Per3 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of PER3 mRNA CTD PMID:30779732 Per3 Rat antirheumatic drug increases expression ISO PER3 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of PER3 mRNA CTD PMID:24449571 Per3 Rat arsane multiple interactions ISO PER3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PER3 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PER3 mRNA CTD PMID:39836092 Per3 Rat arsenic atom multiple interactions ISO PER3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PER3 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PER3 mRNA CTD PMID:39836092 Per3 Rat arsenite(3-) multiple interactions ISO PER3 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to PER3 mRNA] CTD PMID:32406909 Per3 Rat azoxystrobin multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of PER3 mRNA CTD PMID:33854195 Per3 Rat benzo[a]pyrene multiple interactions ISO Per3 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of PER3 mRNA CTD PMID:27858113 Per3 Rat benzo[a]pyrene decreases methylation ISO Per3 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of PER3 exon and Benzo(a)pyrene results in decreased methylation of PER3 intron CTD PMID:27901495 Per3 Rat benzo[a]pyrene affects methylation ISO PER3 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PER3 5' UTR CTD PMID:27901495 Per3 Rat benzo[b]fluoranthene increases expression ISO Per3 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of PER3 mRNA CTD PMID:26377693 Per3 Rat benzo[b]fluoranthene multiple interactions ISO Per3 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of PER3 mRNA CTD PMID:27858113 Per3 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Per3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:28433925 Per3 Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of PER3 mRNA CTD PMID:33789034 Per3 Rat bis(2-ethylhexyl) phthalate decreases expression ISO PER3 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of PER3 mRNA CTD PMID:31163220 Per3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PER3 mRNA CTD PMID:25181051 more ... Per3 Rat bisphenol A decreases expression ISO Per3 (Mus musculus) 6480464 bisphenol A results in decreased expression of PER3 mRNA CTD PMID:32156529 Per3 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of PER3 gene CTD PMID:28505145 Per3 Rat bisphenol A multiple interactions ISO Per3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:28433925 Per3 Rat bisphenol F decreases expression ISO Per3 (Mus musculus) 6480464 bisphenol F results in decreased expression of PER3 mRNA CTD PMID:38685157 Per3 Rat butanal decreases expression ISO PER3 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of PER3 mRNA CTD PMID:26079696 Per3 Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of PER3 mRNA CTD PMID:19167457 Per3 Rat cadmium dichloride increases expression ISO PER3 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of PER3 mRNA CTD PMID:38568856 Per3 Rat calcium silicate decreases expression ISO Per3 (Mus musculus) 6480464 calcium silicate results in decreased expression of PER3 mRNA CTD PMID:29279043 Per3 Rat cannabidiol decreases expression ISO PER3 (Homo sapiens) 6480464 Cannabidiol results in decreased expression of PER3 mRNA CTD PMID:33244087 Per3 Rat carbon nanotube decreases expression ISO Per3 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Per3 Rat CGP 52608 multiple interactions ISO PER3 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to PER3 gene] CTD PMID:28238834 Per3 Rat chloroprene increases expression EXP 6480464 Chloroprene results in increased expression of PER3 mRNA CTD PMID:23125180 Per3 Rat chlorpyrifos decreases expression ISO Per3 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of PER3 mRNA CTD PMID:32715474 and PMID:37019170 Per3 Rat chlorpyrifos multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of PER3 mRNA CTD PMID:33854195 Per3 Rat choline multiple interactions ISO Per3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of PER3 mRNA CTD PMID:20938992 Per3 Rat chrysene multiple interactions ISO Per3 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of PER3 mRNA CTD PMID:27858113 Per3 Rat cisplatin decreases expression ISO PER3 (Homo sapiens) 6480464 Cisplatin results in decreased expression of PER3 mRNA CTD PMID:27392435 Per3 Rat cisplatin multiple interactions ISO PER3 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of PER3 mRNA CTD PMID:27392435 Per3 Rat cocaine multiple interactions ISO Per3 (Mus musculus) 6480464 Cocaine promotes the reaction [NPAS2 protein binds to PER3 promoter] CTD PMID:23776671 Per3 Rat cocaine increases expression ISO Per3 (Mus musculus) 6480464 Cocaine results in increased expression of PER3 mRNA and Cocaine results in increased expression of PER3 protein CTD PMID:15994025 and PMID:23776671 Per3 Rat cocaine hydrochloride increases expression ISO Per3 (Mus musculus) 405866348 cocaine hydrochloride increases expression of Per3 mRNA in hippocampal formation and caudate-putamen RGD Per3 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of PER3 mRNA CTD PMID:30556269 Per3 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of PER3 mRNA CTD PMID:30556269 Per3 Rat crocidolite asbestos decreases expression ISO Per3 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of PER3 mRNA CTD PMID:29279043 Per3 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of PER3 mRNA CTD PMID:26577399 Per3 Rat cyclosporin A decreases expression ISO PER3 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of PER3 mRNA CTD PMID:20106945 Per3 Rat D-glucose multiple interactions ISO Per3 (Mus musculus) 6480464 [lard co-treated with Cholesterol more ... CTD PMID:37567420 Per3 Rat deoxynivalenol decreases expression ISO Per3 (Mus musculus) 6480464 deoxynivalenol results in decreased expression of PER3 protein CTD PMID:36602574 Per3 Rat deoxynivalenol multiple interactions ISO Per3 (Mus musculus) 6480464 BMAL1 protein promotes the reaction [deoxynivalenol results in decreased expression of PER3 protein] and deoxynivalenol inhibits the reaction [BMAL1 protein results in increased expression of PER3 mRNA] CTD PMID:36602574 Per3 Rat dibenz[a,h]anthracene increases expression ISO Per3 (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Per3 Rat dibutyl phthalate decreases expression ISO Per3 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of PER3 mRNA CTD PMID:17361019 and PMID:21266533 Per3 Rat dichloroacetic acid increases expression ISO Per3 (Mus musculus) 6480464 Dichloroacetic Acid results in increased expression of PER3 mRNA CTD PMID:28962523 Per3 Rat dichloromethane increases expression ISO Per3 (Mus musculus) 6480464 Methylene Chloride results in increased expression of PER3 mRNA CTD PMID:28392392 Per3 Rat dicrotophos increases expression ISO PER3 (Homo sapiens) 6480464 dicrotophos results in increased expression of PER3 mRNA CTD PMID:28302478 Per3 Rat diethyl maleate decreases expression EXP 6480464 diethyl maleate results in decreased expression of PER3 mRNA CTD PMID:21161181 Per3 Rat diethylstilbestrol decreases expression EXP 6480464 Diethylstilbestrol results in decreased expression of PER3 mRNA CTD PMID:37077353 Per3 Rat dioxygen multiple interactions ISO Per3 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of PER3 mRNA CTD PMID:30529165 Per3 Rat dioxygen multiple interactions EXP 6480464 [dan-shen root extract co-treated with Andrographis paniculata extract] inhibits the reaction [[Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in decreased expression of PER3 mRNA] and [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in decreased expression of PER3 mRNA CTD PMID:33729688 Per3 Rat disodium selenite decreases expression ISO PER3 (Homo sapiens) 6480464 Sodium Selenite results in decreased expression of PER3 mRNA CTD PMID:18175754 Per3 Rat dorsomorphin multiple interactions ISO PER3 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Per3 Rat doxorubicin decreases expression ISO PER3 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PER3 mRNA CTD PMID:29803840 Per3 Rat elemental selenium decreases expression ISO PER3 (Homo sapiens) 6480464 Selenium results in decreased expression of PER3 mRNA CTD PMID:19244175 Per3 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of PER3 mRNA CTD PMID:29391264 Per3 Rat epoxiconazole affects expression ISO Per3 (Mus musculus) 6480464 epoxiconazole affects the expression of PER3 mRNA CTD PMID:35436446 Per3 Rat Erionite decreases expression ISO Per3 (Mus musculus) 6480464 erionite results in decreased expression of PER3 mRNA CTD PMID:29279043 Per3 Rat ethanol affects expression ISO Per3 (Mus musculus) 6480464 Ethanol affects the expression of PER3 mRNA CTD PMID:30319688 Per3 Rat folic acid multiple interactions ISO Per3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of PER3 mRNA CTD PMID:20938992 Per3 Rat FR900359 increases phosphorylation ISO PER3 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of PER3 protein CTD PMID:37730182 Per3 Rat fructose multiple interactions ISO Per3 (Mus musculus) 6480464 [lard co-treated with Cholesterol more ... CTD PMID:37567420 Per3 Rat furan increases expression EXP 6480464 furan results in increased expression of PER3 mRNA CTD PMID:25539665 Per3 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of PER3 mRNA CTD PMID:33387578 Per3 Rat glucose multiple interactions ISO Per3 (Mus musculus) 6480464 [lard co-treated with Cholesterol more ... CTD PMID:37567420 Per3 Rat glyphosate multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of PER3 mRNA CTD PMID:33854195 Per3 Rat glyphosate decreases expression ISO Per3 (Mus musculus) 6480464 Glyphosate results in decreased expression of PER3 mRNA CTD PMID:36572786 Per3 Rat gold atom multiple interactions ISO Per3 (Mus musculus) 6480464 [Gold co-treated with Polyethylene Glycols] results in decreased expression of PER3 mRNA CTD PMID:19695318 Per3 Rat gold(0) multiple interactions ISO Per3 (Mus musculus) 6480464 [Gold co-treated with Polyethylene Glycols] results in decreased expression of PER3 mRNA CTD PMID:19695318 Per3 Rat imidacloprid multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of PER3 mRNA CTD PMID:33854195 Per3 Rat iron dichloride increases expression ISO PER3 (Homo sapiens) 6480464 ferrous chloride results in increased expression of PER3 mRNA CTD PMID:35984750 Per3 Rat isoprenaline decreases expression ISO Per3 (Mus musculus) 6480464 Isoproterenol results in decreased expression of PER3 mRNA CTD PMID:20003209 Per3 Rat ketoconazole decreases expression EXP 6480464 Ketoconazole results in decreased expression of PER3 mRNA CTD PMID:37077353 Per3 Rat L-methionine multiple interactions ISO Per3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of PER3 mRNA CTD PMID:20938992 Per3 Rat lead(0) decreases expression ISO PER3 (Homo sapiens) 6480464 Lead results in decreased expression of PER3 mRNA CTD PMID:19921347 Per3 Rat manganese atom multiple interactions ISO PER3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PER3 mRNA CTD PMID:39836092 Per3 Rat manganese(0) multiple interactions ISO PER3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PER3 mRNA CTD PMID:39836092 Per3 Rat manganese(II) chloride multiple interactions ISO PER3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PER3 mRNA CTD PMID:39836092 Per3 Rat metacetamol decreases expression ISO Per3 (Mus musculus) 6480464 3-hydroxyacetanilide results in decreased expression of PER3 mRNA CTD PMID:18544908 Per3 Rat methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of PER3 mRNA CTD PMID:35863504 Per3 Rat methotrexate increases expression ISO PER3 (Homo sapiens) 6480464 Methotrexate results in increased expression of PER3 mRNA CTD PMID:24449571 Per3 Rat methylmercury chloride decreases expression ISO PER3 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of PER3 mRNA CTD PMID:28001369 Per3 Rat mono(2-ethylhexyl) phthalate increases expression ISO Per3 (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of PER3 mRNA CTD PMID:22401849 Per3 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of PER3 gene CTD PMID:33148267 Per3 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of PER3 mRNA CTD PMID:20360939 Per3 Rat nickel atom decreases expression ISO PER3 (Homo sapiens) 6480464 Nickel results in decreased expression of PER3 mRNA CTD PMID:25583101 Per3 Rat ochratoxin A increases expression ISO PER3 (Homo sapiens) 6480464 ochratoxin A results in increased expression of PER3 mRNA CTD PMID:30559759 Per3 Rat paracetamol decreases expression ISO Per3 (Mus musculus) 6480464 Acetaminophen results in decreased expression of PER3 mRNA CTD PMID:18544908 Per3 Rat paracetamol increases expression ISO PER3 (Homo sapiens) 6480464 Acetaminophen results in increased expression of PER3 mRNA CTD PMID:21420995 Per3 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of PER3 mRNA CTD PMID:32680482 Per3 Rat parathion increases expression ISO Per3 (Mus musculus) 6480464 Parathion results in increased expression of PER3 mRNA CTD PMID:34813904 Per3 Rat pentanal decreases expression ISO PER3 (Homo sapiens) 6480464 pentanal results in decreased expression of PER3 mRNA CTD PMID:26079696 Per3 Rat perfluorohexanesulfonic acid increases expression ISO PER3 (Homo sapiens) 6480464 perfluorohexanesulfonic acid results in increased expression of PER3 mRNA CTD PMID:25812627 Per3 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Per3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PER3 mRNA CTD PMID:36331819 Per3 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of PER3 mRNA CTD PMID:35163327 Per3 Rat perfluorooctanoic acid increases expression ISO PER3 (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of PER3 mRNA CTD PMID:25812627 Per3 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of PER3 gene CTD PMID:33148267 Per3 Rat permethrin increases expression ISO PER3 (Homo sapiens) 6480464 Permethrin results in increased expression of PER3 mRNA CTD PMID:37047231 Per3 Rat phenethyl caffeate multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of PER3 mRNA CTD PMID:20360939 Per3 Rat phenethyl isothiocyanate decreases expression ISO PER3 (Homo sapiens) 6480464 phenethyl isothiocyanate results in decreased expression of PER3 mRNA CTD PMID:26678675 Per3 Rat phenobarbital increases expression ISO PER3 (Homo sapiens) 6480464 Phenobarbital results in increased expression of PER3 mRNA CTD PMID:19084549 Per3 Rat phenobarbital affects expression ISO Per3 (Mus musculus) 6480464 Phenobarbital affects the expression of PER3 mRNA CTD PMID:23091169 Per3 Rat phenylmercury acetate decreases expression ISO PER3 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of PER3 mRNA CTD PMID:26272509 Per3 Rat phenylmercury acetate multiple interactions ISO PER3 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PER3 mRNA CTD PMID:27188386 Per3 Rat pirinixic acid increases expression ISO Per3 (Mus musculus) 6480464 pirinixic acid results in increased expression of PER3 mRNA CTD PMID:17426115 Per3 Rat potassium chromate decreases expression ISO PER3 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of PER3 mRNA CTD PMID:22714537 Per3 Rat pregnenolone 16alpha-carbonitrile decreases expression ISO Per3 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in decreased expression of PER3 mRNA CTD PMID:28903501 Per3 Rat progesterone decreases expression ISO PER3 (Homo sapiens) 6480464 Progesterone results in decreased expression of PER3 mRNA CTD PMID:21795739 Per3 Rat propanal decreases expression ISO PER3 (Homo sapiens) 6480464 propionaldehyde results in decreased expression of PER3 mRNA CTD PMID:26079696 Per3 Rat ritodrine increases expression ISO Per3 (Mus musculus) 6480464 Ritodrine results in increased expression of PER3 mRNA CTD PMID:23370008 Per3 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of PER3 mRNA CTD PMID:28374803 Per3 Rat SB 431542 multiple interactions ISO PER3 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Per3 Rat Se-methyl-L-selenocysteine increases expression EXP 6480464 selenomethylselenocysteine results in increased expression of PER3 mRNA CTD PMID:19122877 Per3 Rat Se-methylselenocysteine increases expression EXP 6480464 selenomethylselenocysteine results in increased expression of PER3 mRNA CTD PMID:19122877 Per3 Rat selenium atom decreases expression ISO PER3 (Homo sapiens) 6480464 Selenium results in decreased expression of PER3 mRNA CTD PMID:19244175 Per3 Rat senecionine decreases expression ISO Per3 (Mus musculus) 6480464 senecionine results in decreased expression of PER3 protein CTD PMID:35357534 Per3 Rat silicon dioxide increases expression ISO PER3 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of PER3 mRNA CTD PMID:25895662 Per3 Rat silicon dioxide decreases expression EXP 6480464 Silicon Dioxide results in decreased expression of PER3 mRNA CTD PMID:32721576 Per3 Rat silver atom increases expression ISO Per3 (Mus musculus) 6480464 Silver results in increased expression of PER3 mRNA CTD PMID:27131904 Per3 Rat silver(0) increases expression ISO Per3 (Mus musculus) 6480464 Silver results in increased expression of PER3 mRNA CTD PMID:27131904 Per3 Rat sodium arsenate increases expression ISO Per3 (Mus musculus) 6480464 sodium arsenate results in increased expression of PER3 mRNA CTD PMID:21795629 Per3 Rat sodium arsenite increases expression ISO PER3 (Homo sapiens) 6480464 sodium arsenite results in increased expression of PER3 mRNA CTD PMID:38568856 Per3 Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of PER3 mRNA CTD PMID:35314868 Per3 Rat sodium arsenite multiple interactions ISO PER3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PER3 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PER3 mRNA CTD PMID:39836092 Per3 Rat styrene increases expression ISO Per3 (Mus musculus) 6480464 Styrene results in increased expression of PER3 mRNA CTD PMID:28951217 Per3 Rat temozolomide decreases expression ISO PER3 (Homo sapiens) 6480464 Temozolomide results in decreased expression of PER3 mRNA CTD PMID:31758290 Per3 Rat testosterone decreases expression ISO Per3 (Mus musculus) 6480464 Testosterone results in decreased expression of PER3 mRNA CTD PMID:20403060 Per3 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of PER3 mRNA] CTD PMID:31150632 Per3 Rat tetrachloromethane decreases expression ISO Per3 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of PER3 mRNA CTD PMID:31919559 Per3 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of PER3 mRNA CTD PMID:31150632 Per3 Rat tetraphene increases expression ISO Per3 (Mus musculus) 6480464 benz(a)anthracene results in increased expression of PER3 mRNA CTD PMID:26377693 Per3 Rat tetraphene multiple interactions ISO Per3 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of PER3 mRNA CTD PMID:27858113 Per3 Rat thiabendazole multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of PER3 mRNA CTD PMID:33854195 Per3 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PER3 mRNA CTD PMID:23411599 Per3 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of PER3 mRNA CTD PMID:34492290 Per3 Rat titanium dioxide affects expression EXP 6480464 titanium dioxide affects the expression of PER3 mRNA CTD PMID:30012374 Per3 Rat tremolite asbestos decreases expression ISO Per3 (Mus musculus) 6480464 tremolite results in decreased expression of PER3 mRNA CTD PMID:29279043 Per3 Rat tributylstannane increases expression ISO Per3 (Mus musculus) 6480464 tributyltin results in increased expression of PER3 mRNA CTD PMID:31939706 Per3 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of PER3 gene CTD PMID:27618143 Per3 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of PER3 mRNA CTD PMID:33387578 Per3 Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of PER3 mRNA CTD PMID:30589522 Per3 Rat triphenyl phosphate affects expression ISO PER3 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PER3 mRNA CTD PMID:37042841 Per3 Rat troglitazone decreases expression ISO Per3 (Mus musculus) 6480464 troglitazone results in decreased expression of PER3 mRNA CTD PMID:28973697 Per3 Rat tunicamycin increases expression ISO PER3 (Homo sapiens) 6480464 Tunicamycin results in increased expression of PER3 mRNA CTD PMID:22378314 Per3 Rat urethane decreases expression ISO PER3 (Homo sapiens) 6480464 Urethane results in decreased expression of PER3 mRNA CTD PMID:28818685 Per3 Rat valproic acid affects expression ISO Per3 (Mus musculus) 6480464 Valproic Acid affects the expression of PER3 mRNA CTD PMID:17963808 Per3 Rat valproic acid multiple interactions ISO PER3 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PER3 mRNA CTD PMID:27188386 Per3 Rat valproic acid decreases expression ISO PER3 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of PER3 mRNA CTD PMID:23179753 more ... Per3 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of PER3 mRNA CTD PMID:23034163 Per3 Rat vitamin E decreases expression ISO PER3 (Homo sapiens) 6480464 Vitamin E results in decreased expression of PER3 mRNA CTD PMID:19244175 Per3 Rat vorinostat multiple interactions ISO PER3 (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PER3 mRNA CTD PMID:27188386 Per3 Rat vorinostat decreases expression ISO PER3 (Homo sapiens) 6480464 vorinostat results in decreased expression of PER3 mRNA CTD PMID:27188386 Per3 Rat zinc atom decreases expression ISO PER3 (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of PER3 mRNA CTD PMID:18356318 Per3 Rat zinc(0) decreases expression ISO PER3 (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of PER3 mRNA CTD PMID:18356318
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 17beta-estradiol (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-D (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,3',4,4'-tetrachlorobiphenyl (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (EXP,ISO) aflatoxin B1 (EXP,ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) ammonium chloride (EXP) amphetamine (EXP) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) azoxystrobin (EXP) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) butanal (ISO) C60 fullerene (EXP) cadmium dichloride (ISO) calcium silicate (ISO) cannabidiol (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chloroprene (EXP) chlorpyrifos (EXP,ISO) choline (ISO) chrysene (ISO) cisplatin (ISO) cocaine (ISO) cocaine hydrochloride (ISO) copper atom (EXP) copper(0) (EXP) crocidolite asbestos (ISO) Cuprizon (EXP) cyclosporin A (ISO) D-glucose (ISO) deoxynivalenol (ISO) dibenz[a,h]anthracene (ISO) dibutyl phthalate (ISO) dichloroacetic acid (ISO) dichloromethane (ISO) dicrotophos (ISO) diethyl maleate (EXP) diethylstilbestrol (EXP) dioxygen (EXP,ISO) disodium selenite (ISO) dorsomorphin (ISO) doxorubicin (ISO) elemental selenium (ISO) endosulfan (EXP) epoxiconazole (ISO) Erionite (ISO) ethanol (ISO) folic acid (ISO) FR900359 (ISO) fructose (ISO) furan (EXP) gentamycin (EXP) glucose (ISO) glyphosate (EXP,ISO) gold atom (ISO) gold(0) (ISO) imidacloprid (EXP) iron dichloride (ISO) isoprenaline (ISO) ketoconazole (EXP) L-methionine (ISO) lead(0) (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) metacetamol (ISO) methamphetamine (EXP) methotrexate (ISO) methylmercury chloride (ISO) mono(2-ethylhexyl) phthalate (ISO) N,N-diethyl-m-toluamide (EXP) N-nitrosodiethylamine (EXP) nickel atom (ISO) ochratoxin A (ISO) paracetamol (ISO) paraquat (EXP) parathion (ISO) pentanal (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP,ISO) permethrin (EXP,ISO) phenethyl caffeate (EXP) phenethyl isothiocyanate (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) pirinixic acid (ISO) potassium chromate (ISO) pregnenolone 16alpha-carbonitrile (ISO) progesterone (ISO) propanal (ISO) ritodrine (ISO) rotenone (EXP) SB 431542 (ISO) Se-methyl-L-selenocysteine (EXP) Se-methylselenocysteine (EXP) selenium atom (ISO) senecionine (ISO) silicon dioxide (EXP,ISO) silver atom (ISO) silver(0) (ISO) sodium arsenate (ISO) sodium arsenite (EXP,ISO) styrene (ISO) temozolomide (ISO) testosterone (ISO) tetrachloromethane (EXP,ISO) tetraphene (ISO) thiabendazole (EXP) thioacetamide (EXP) titanium dioxide (EXP) tremolite asbestos (ISO) tributylstannane (ISO) trichloroethene (EXP) triphenyl phosphate (EXP,ISO) troglitazone (ISO) tunicamycin (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (EXP) vitamin E (ISO) vorinostat (ISO) zinc atom (ISO) zinc(0) (ISO)
1.
Clock genes polymorphisms in male bipolar patients with comorbid alcohol abuse.
Banach E, etal., J Affect Disord. 2018 Dec 1;241:142-146. doi: 10.1016/j.jad.2018.07.080. Epub 2018 Jul 31.
2.
Chronic ethanol consumption impairs the circadian rhythm of pro-opiomelanocortin and period genes mRNA expression in the hypothalamus of the male rat.
Chen CP, etal., J Neurochem. 2004 Mar;88(6):1547-54. doi: 10.1046/j.1471-4159.2003.02300.x.
3.
Prenatal ethanol exposure alters the expression of period genes governing the circadian function of beta-endorphin neurons in the hypothalamus.
Chen CP, etal., J Neurochem. 2006 May;97(4):1026-33. doi: 10.1111/j.1471-4159.2006.03839.x.
4.
Association of structural polymorphisms in the human period3 gene with delayed sleep phase syndrome.
Ebisawa T, etal., EMBO Rep 2001 Apr;2(4):342-6.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Implications of circadian gene expression in kidney, liver and the effects of fasting on pharmacogenomic studies.
Kita Y, etal., Pharmacogenetics 2002 Jan;12(1):55-65.
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.
GOA pipeline
RGD automated data pipeline
10.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
Effect of fluoxetine and cocaine on the expression of clock genes in the mouse hippocampus and striatum.
Uz T, etal., Neuroscience. 2005;134(4):1309-16. doi: 10.1016/j.neuroscience.2005.05.003.
Per3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 166,740,914 - 166,778,243 (-) NCBI GRCr8 mRatBN7.2 5 161,460,228 - 161,495,404 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 161,459,533 - 161,495,607 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 164,177,009 - 164,211,658 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 165,993,418 - 166,028,287 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 165,955,653 - 165,990,302 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 168,088,126 - 168,123,482 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 168,086,998 - 168,123,395 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 171,665,221 - 171,700,529 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 168,152,693 - 168,187,442 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 168,163,026 - 168,197,630 (-) NCBI Celera 5 159,712,426 - 159,747,156 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
PER3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 7,784,291 - 7,845,177 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 7,784,291 - 7,845,177 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 7,844,351 - 7,905,237 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 7,767,350 - 7,827,824 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 7,779,028 - 7,839,503 NCBI Celera 1 6,952,489 - 7,012,918 (+) NCBI Celera Cytogenetic Map 1 p36.23 NCBI HuRef 1 6,993,003 - 7,053,532 (+) NCBI HuRef CHM1_1 1 7,832,500 - 7,892,974 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 7,315,337 - 7,376,224 (+) NCBI T2T-CHM13v2.0
Per3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 151,081,475 - 151,129,167 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 151,088,109 - 151,129,122 (-) Ensembl GRCm39 Ensembl GRCm38 4 150,997,018 - 151,044,707 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 151,003,652 - 151,044,665 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 150,377,764 - 150,418,731 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 149,848,512 - 149,888,389 (-) NCBI MGSCv36 mm8 Celera 4 153,279,480 - 153,320,397 (-) NCBI Celera Cytogenetic Map 4 E2 NCBI cM Map 4 81.53 NCBI
Per3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955486 5,059,773 - 5,101,637 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955486 5,058,602 - 5,101,480 (-) NCBI ChiLan1.0 ChiLan1.0
PER3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 220,381,214 - 220,442,021 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 219,022,337 - 219,083,038 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 6,547,667 - 6,607,905 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 7,795,549 - 7,855,922 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 7,795,552 - 7,855,922 (+) Ensembl panpan1.1 panPan2
PER3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 61,445,580 - 61,499,393 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 61,445,461 - 61,498,499 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 61,454,281 - 61,508,079 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 61,662,394 - 61,716,172 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 61,662,356 - 61,716,152 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 61,661,665 - 61,715,387 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 61,526,094 - 61,579,868 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 61,929,781 - 61,983,527 (+) NCBI UU_Cfam_GSD_1.0
Per3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 31,805,406 - 31,853,491 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936623 2,290,614 - 2,336,634 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936623 2,291,211 - 2,362,693 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PER3
PER3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 123,912,773 - 123,970,440 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 123,912,208 - 123,970,549 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666054 27,947,725 - 28,005,720 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Per3
.
Predicted Target Of
Count of predictions: 157 Count of miRNA genes: 128 Interacting mature miRNAs: 139 Transcripts: ENSRNOT00000024932 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 631272 Lanf1 Left ventricular atrial natriuretic factor QTL 1 12 heart left ventricle natriuretic peptide A amount (VT:0010596) heart left ventricle natriuretic peptide A level (CMO:0002165) 5 151113452 166875058 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 631562 Apr2 Acute phase response QTL 2 3.7 blood murinoglobulin 1 amount (VT:0010597) plasma murinoglobulin 1 level (CMO:0001931) 5 135927956 166875058 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 61444 Strs2 Sensitivity to stroke QTL 2 4.7 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 5 135929696 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1549904 Neuinf1 Neuroinflammation QTL 1 3 0 nervous system integrity trait (VT:0010566) blood T lymphocyte count (CMO:0000110) 5 154828214 166875058 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 1354631 Swd2 Spike wave discharge measurement QTL 2 3.64 0.0002 brain electrophysiology trait (VT:0010557) brain total spike-and-wave discharge duration (CMO:0001740) 5 151113452 164465185 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 1331721 Bp210 Blood pressure QTL 210 3.413 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 143069996 166846814 Rat
D5Mco10
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 5 166,764,253 - 166,764,498 (+) Marker Load Pipeline mRatBN7.2 5 161,481,433 - 161,481,680 (+) MAPPER mRatBN7.2 Rnor_6.0 5 168,109,415 - 168,109,659 NCBI Rnor6.0 Rnor_5.0 5 171,686,510 - 171,686,754 UniSTS Rnor5.0 RGSC_v3.4 5 168,173,895 - 168,174,140 RGD RGSC3.4 RGSC_v3.4 5 168,173,896 - 168,174,140 UniSTS RGSC3.4 RGSC_v3.1 5 168,184,083 - 168,184,328 RGD Celera 5 159,733,610 - 159,733,854 UniSTS Cytogenetic Map 5 q36 UniSTS
BF419445
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 161,476,220 - 161,476,346 (+) MAPPER mRatBN7.2 Rnor_6.0 5 168,104,117 - 168,104,242 NCBI Rnor6.0 Rnor_5.0 5 171,681,212 - 171,681,337 UniSTS Rnor5.0 RGSC_v3.4 5 168,168,684 - 168,168,809 UniSTS RGSC3.4 Celera 5 159,728,417 - 159,728,542 UniSTS RH 3.4 Map 5 1128.4 UniSTS Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000024932 ⟹ ENSRNOP00000024932
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 161,460,228 - 161,495,607 (-) Ensembl Rnor_6.0 Ensembl 5 168,086,998 - 168,123,395 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000092747 ⟹ ENSRNOP00000076026
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 161,460,374 - 161,495,607 (-) Ensembl Rnor_6.0 Ensembl 5 168,088,272 - 168,123,030 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000092840
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 5 168,119,561 - 168,123,030 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000092912
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 5 168,109,659 - 168,110,285 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000092923
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 5 168,121,316 - 168,123,021 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000093063 ⟹ ENSRNOP00000075932
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 5 168,112,376 - 168,120,179 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000093100
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 5 168,121,998 - 168,122,977 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000093114
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 5 168,121,329 - 168,121,640 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000108999 ⟹ ENSRNOP00000094435
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 161,459,533 - 161,495,295 (-) Ensembl
RefSeq Acc Id:
NM_023978 ⟹ NP_076468
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,743,050 - 166,777,800 (-) NCBI mRatBN7.2 5 161,460,228 - 161,494,982 (-) NCBI Rnor_6.0 5 168,088,126 - 168,123,030 (-) NCBI Rnor_5.0 5 171,665,221 - 171,700,529 (-) NCBI RGSC_v3.4 5 168,152,693 - 168,187,442 (-) RGD Celera 5 159,712,426 - 159,747,156 (-) RGD
Sequence:
ATGGATCCCTGTGGAAACCCGGCAGTGCCTGGTGGCGACTGTCCCCAAACTAGGGGACCGGGGCTCCAAGGGTCGTCTGGCCAGGAGGGTCCTCTGCAGGGCATTTGCGTGGACAGCAGCCACAGTGA
hide sequence
RefSeq Acc Id:
XM_006239504 ⟹ XP_006239566
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,740,914 - 166,778,243 (-) NCBI mRatBN7.2 5 161,460,244 - 161,495,402 (-) NCBI Rnor_6.0 5 168,088,190 - 168,123,482 (-) NCBI Rnor_5.0 5 171,665,221 - 171,700,529 (-) NCBI
Sequence:
CTCTGCACGCGGCTGGCCTCGAGACTCGGCTGCCCGCGGGTGGGCGAGGCTCGGCGGGGCGGCG
hide sequence
RefSeq Acc Id:
XM_006239505 ⟹ XP_006239567
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,740,914 - 166,778,243 (-) NCBI mRatBN7.2 5 161,460,244 - 161,495,402 (-) NCBI Rnor_6.0 5 168,088,190 - 168,123,482 (-) NCBI Rnor_5.0 5 171,665,221 - 171,700,529 (-) NCBI
Sequence:
CTCTGCACGCGGCTGGCCTCGAGACTCGGCTGCCCGCGGGTGGGCGAGGCTCGGCGGGGCGGCGGCGAGTGCTCGGCTGGCGGGACGCCTGCGAGCCCGCACGGCCCGGCGCTGCTGCCCCTGCCTTC
hide sequence
RefSeq Acc Id:
XM_063288459 ⟹ XP_063144529
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,740,914 - 166,774,204 (-) NCBI
RefSeq Acc Id:
NP_076468 ⟸ NM_023978
- UniProtKB:
G3V8D9 (UniProtKB/TrEMBL), A6IUE8 (UniProtKB/TrEMBL)
- Sequence:
MDPCGNPAVPGGDCPQTRGPGLQGSSGQEGPLQGICVDSSHSEHEDRNRMSEELIMVVQEMKKYFPAERHTKPSTLDALNYALRCVHSVQANSEFFQSLSPRGARQAEATVYNLEELTSLASEHTSKN
hide sequence
RefSeq Acc Id:
XP_006239567 ⟸ XM_006239505
- Peptide Label:
isoform X2
- UniProtKB:
G3V8D9 (UniProtKB/TrEMBL)
- Sequence:
MDPCGNPAVPGGDCPQTRGPGLQGSSGQEGPLQGICVDSSHSEHEDRNRMSEELIMVVQEMKKYFPAERHTKPSTLDALNYALRCVHSVQANSEFFQSLSPRGARQAEATVYNLEELTSLASEHTSKN
hide sequence
RefSeq Acc Id:
XP_006239566 ⟸ XM_006239504
- Peptide Label:
isoform X1
- UniProtKB:
G3V8D9 (UniProtKB/TrEMBL)
- Sequence:
MDPCGNPAVPGGDCPQTRGPGLQGSSGQEGPLQGICVDSSHSEHEDRNRMSEELIMVVQEMKKYFPAERHTKPSTLDALNYALRCVHSVQANSEFFQSLSPRGARQAEATVYNLEELTSLASEHTSKN
hide sequence
Ensembl Acc Id:
ENSRNOP00000076026 ⟸ ENSRNOT00000092747
Ensembl Acc Id:
ENSRNOP00000024932 ⟸ ENSRNOT00000024932
Ensembl Acc Id:
ENSRNOP00000075932 ⟸ ENSRNOT00000093063
Ensembl Acc Id:
ENSRNOP00000094435 ⟸ ENSRNOT00000108999
RefSeq Acc Id:
XP_063144529 ⟸ XM_063288459
- Peptide Label:
isoform X3
RGD ID: 13694287 Promoter ID: EPDNEW_R4812 Type: initiation region Name: Per3_1 Description: period circadian regulator 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 168,123,419 - 168,123,479 EPDNEW
BioCyc Gene G2FUF-39044 BioCyc
Ensembl Genes ENSRNOG00000018413 Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript ENSRNOT00000024932 ENTREZGENE
ENSRNOT00000024932.6 UniProtKB/TrEMBL
ENSRNOT00000092747.2 UniProtKB/TrEMBL
ENSRNOT00000108999.1 UniProtKB/TrEMBL
Gene3D-CATH PAS domain UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro PAS UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PAS-like_dom_sf UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PAS_fold_3 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Per1-3_PAS-A UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Period_circadian-like_C UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Period_circadian_regulator UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report rno:78962 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene 78962 ENTREZGENE
PANTHER PERIOD CIRCADIAN PROTEIN UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PTHR11269:SF13 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam PAS_3 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Per3-like_PAS-A UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Period_C UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen Per3 PhenoGen
PROSITE PAS UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx ENSRNOG00000018413 RatGTEx
SMART PAS UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP SSF55785 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt A0A1B0GWU7_RAT UniProtKB/TrEMBL
A0A8I6AN92_RAT UniProtKB/TrEMBL
A6IUE8 ENTREZGENE, UniProtKB/TrEMBL
A6IUF0_RAT UniProtKB/TrEMBL
G3V8D9 ENTREZGENE, UniProtKB/TrEMBL
PER3_RAT UniProtKB/Swiss-Prot, ENTREZGENE
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-10-09
Per3
period circadian regulator 3
Per3
period circadian clock 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-01-02
Per3
period circadian clock 3
Per3
period homolog 3 (Drosophila)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Per3
period homolog 3 (Drosophila)
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Per3
period homolog 3 (Drosophila)
Symbol and Name status set to provisional
70820 PROVISIONAL
