Symbol:
Nkg7
Name:
natural killer cell granule protein 7
RGD ID:
621523
Description:
Predicted to be involved in several processes, including CD4-positive, alpha-beta T cell activation; defense response to other organism; and granzyme-mediated programmed cell death signaling pathway. Predicted to be located in cytolytic granule membrane and plasma membrane. Orthologous to human NKG7 (natural killer cell granule protein 7); INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 17beta-estradiol 3-benzoate.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
natural killer cell group 7 sequence
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NKG7 (natural killer cell granule protein 7) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Nkg7 (natural killer cell group 7 sequence) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Nkg7 (natural killer cell granule protein 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NKG7 (natural killer cell granule protein 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NKG7 (natural killer cell granule protein 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Nkg7 (natural killer cell granule protein 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NKG7 (natural killer cell granule protein 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NKG7 (natural killer cell granule protein 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Nkg7 (natural killer cell granule protein 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
CRK (CRK proto-oncogene, adaptor protein) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Nkg7 (natural killer cell group 7 sequence)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
NKG7 (natural killer cell granule protein 7)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 102,981,497 - 102,982,564 (+) NCBI GRCr8 mRatBN7.2 1 93,844,748 - 93,845,975 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 93,844,902 - 93,845,983 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 99,230,257 - 99,231,324 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 107,702,931 - 107,703,998 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 100,995,511 - 100,996,578 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 98,492,873 - 98,493,940 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 98,492,828 - 98,493,978 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 99,569,678 - 99,570,745 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 93,813,123 - 93,814,190 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 93,891,233 - 93,892,299 (+) NCBI Celera 1 88,122,019 - 88,123,086 (+) NCBI Celera Cytogenetic Map 1 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nkg7 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of NKG7 mRNA] CTD PMID:31150632 Nkg7 Rat 1,2-dichloroethane decreases expression ISO Nkg7 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of NKG7 mRNA CTD PMID:28960355 Nkg7 Rat 1,2-dimethylhydrazine decreases expression ISO Nkg7 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of NKG7 mRNA CTD PMID:22206623 Nkg7 Rat 1,2-dimethylhydrazine multiple interactions ISO Nkg7 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of NKG7 mRNA] CTD PMID:22206623 Nkg7 Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of NKG7 mRNA CTD PMID:32741896 Nkg7 Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of NKG7 mRNA CTD PMID:32741896 Nkg7 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Nkg7 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of NKG7 mRNA CTD PMID:26290441 Nkg7 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of NKG7 mRNA CTD PMID:34747641 Nkg7 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of NKG7 mRNA CTD PMID:32109520 Nkg7 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Nkg7 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Nkg7 Rat 2-butoxyethanol decreases expression ISO Nkg7 (Mus musculus) 6480464 n-butoxyethanol results in decreased expression of NKG7 mRNA CTD PMID:19812364 Nkg7 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Nkg7 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of NKG7 mRNA CTD PMID:20188158 Nkg7 Rat 4-(ethoxymethylene)-2-phenyloxazol-5-one increases expression EXP 6480464 Oxazolone results in increased expression of NKG7 mRNA CTD PMID:21893156 Nkg7 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of NKG7 mRNA CTD PMID:24780913 Nkg7 Rat 7,12-dimethyltetraphene increases expression EXP 6480464 9 more ... CTD PMID:19480007 Nkg7 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of NKG7 mRNA CTD PMID:31881176 Nkg7 Rat acetylsalicylic acid decreases expression ISO NKG7 (Homo sapiens) 6480464 Aspirin results in decreased expression of NKG7 mRNA CTD PMID:15928584 Nkg7 Rat aldehydo-D-glucose multiple interactions ISO Nkg7 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of NKG7 mRNA CTD PMID:37567420 Nkg7 Rat all-trans-retinoic acid increases expression ISO NKG7 (Homo sapiens) 6480464 Tretinoin results in increased expression of NKG7 mRNA CTD PMID:15498508 and PMID:33167477 Nkg7 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of NKG7 mRNA CTD PMID:16483693 Nkg7 Rat antirheumatic drug decreases expression ISO NKG7 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of NKG7 mRNA CTD PMID:24449571 Nkg7 Rat benzo[a]pyrene decreases expression ISO Nkg7 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of NKG7 mRNA CTD PMID:21569818 Nkg7 Rat benzo[a]pyrene affects methylation ISO NKG7 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of NKG7 promoter CTD PMID:27901495 Nkg7 Rat benzo[a]pyrene decreases methylation ISO NKG7 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of NKG7 3' UTR and Benzo(a)pyrene results in decreased methylation of NKG7 5' UTR CTD PMID:27901495 Nkg7 Rat benzo[a]pyrene increases expression ISO Nkg7 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of NKG7 mRNA CTD PMID:22228805 and PMID:32417428 Nkg7 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NKG7 mRNA CTD PMID:25181051 and PMID:32145629 Nkg7 Rat carbon nanotube decreases expression ISO Nkg7 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Nkg7 Rat chloroprene decreases expression ISO Nkg7 (Mus musculus) 6480464 Chloroprene results in decreased expression of NKG7 mRNA CTD PMID:23125180 Nkg7 Rat chromium(6+) affects expression ISO Nkg7 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of NKG7 mRNA CTD PMID:28472532 Nkg7 Rat cisplatin increases expression ISO NKG7 (Homo sapiens) 6480464 Cisplatin results in increased expression of NKG7 mRNA CTD PMID:27594783 Nkg7 Rat D-glucose multiple interactions ISO Nkg7 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of NKG7 mRNA CTD PMID:37567420 Nkg7 Rat D-mannitol increases expression ISO Nkg7 (Mus musculus) 6480464 Mannitol results in increased expression of NKG7 mRNA CTD PMID:25270620 Nkg7 Rat diazinon decreases methylation ISO NKG7 (Homo sapiens) 6480464 Diazinon results in decreased methylation of NKG7 gene CTD PMID:22964155 Nkg7 Rat Dibutyl phosphate affects expression ISO NKG7 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of NKG7 mRNA CTD PMID:37042841 Nkg7 Rat dioxygen multiple interactions ISO Nkg7 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of NKG7 mRNA CTD PMID:30529165 Nkg7 Rat diuron decreases expression ISO NKG7 (Homo sapiens) 6480464 Diuron results in decreased expression of NKG7 mRNA CTD PMID:35967413 Nkg7 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of NKG7 mRNA CTD PMID:18035473 Nkg7 Rat folic acid multiple interactions ISO Nkg7 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of NKG7 mRNA] CTD PMID:22206623 Nkg7 Rat fructose multiple interactions ISO Nkg7 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of NKG7 mRNA CTD PMID:37567420 Nkg7 Rat genistein decreases expression ISO Nkg7 (Mus musculus) 6480464 Genistein results in decreased expression of NKG7 mRNA CTD PMID:32186404 Nkg7 Rat glucose multiple interactions ISO Nkg7 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of NKG7 mRNA CTD PMID:37567420 Nkg7 Rat glycidol increases expression EXP 6480464 glycidol results in increased expression of NKG7 mRNA CTD PMID:24915197 Nkg7 Rat glyphosate multiple interactions ISO Nkg7 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of NKG7 mRNA CTD PMID:37567420 Nkg7 Rat ionomycin multiple interactions ISO NKG7 (Homo sapiens) 6480464 [Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in decreased expression of NKG7 mRNA and pyrrolidine dithiocarbamic acid inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in decreased expression of NKG7 mRNA] CTD PMID:15477007 Nkg7 Rat nickel atom increases expression ISO NKG7 (Homo sapiens) 6480464 Nickel results in increased expression of NKG7 mRNA CTD PMID:24768652 and PMID:25583101 Nkg7 Rat ozone multiple interactions ISO Nkg7 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of NKG7 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of NKG7 mRNA CTD PMID:34911549 Nkg7 Rat ozone decreases expression ISO Nkg7 (Mus musculus) 6480464 Ozone results in decreased expression of NKG7 mRNA CTD PMID:33026818 Nkg7 Rat paracetamol affects expression ISO Nkg7 (Mus musculus) 6480464 Acetaminophen affects the expression of NKG7 mRNA CTD PMID:17562736 Nkg7 Rat paracetamol increases expression ISO NKG7 (Homo sapiens) 6480464 Acetaminophen results in increased expression of NKG7 mRNA CTD PMID:26690555 Nkg7 Rat PhIP increases expression ISO NKG7 (Homo sapiens) 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased expression of NKG7 mRNA CTD PMID:20816883 Nkg7 Rat phorbol 13-acetate 12-myristate multiple interactions ISO NKG7 (Homo sapiens) 6480464 [Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in decreased expression of NKG7 mRNA and pyrrolidine dithiocarbamic acid inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in decreased expression of NKG7 mRNA] CTD PMID:15477007 Nkg7 Rat pirinixic acid decreases expression ISO Nkg7 (Mus musculus) 6480464 pirinixic acid results in decreased expression of NKG7 mRNA CTD PMID:17426115 Nkg7 Rat progesterone increases expression ISO NKG7 (Homo sapiens) 6480464 Progesterone results in increased expression of NKG7 mRNA CTD PMID:18070364 Nkg7 Rat pyrrolidine dithiocarbamate multiple interactions ISO NKG7 (Homo sapiens) 6480464 pyrrolidine dithiocarbamic acid inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in decreased expression of NKG7 mRNA] CTD PMID:15477007 Nkg7 Rat silicon dioxide increases expression ISO Nkg7 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of NKG7 mRNA CTD PMID:29341224 Nkg7 Rat tamibarotene increases expression ISO NKG7 (Homo sapiens) 6480464 tamibarotene results in increased expression of NKG7 mRNA CTD PMID:15498508 Nkg7 Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of NKG7 mRNA CTD PMID:32741896 Nkg7 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of NKG7 mRNA CTD PMID:31150632 Nkg7 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of NKG7 mRNA] CTD PMID:31150632 Nkg7 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of NKG7 mRNA CTD PMID:23411599 Nkg7 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of NKG7 mRNA CTD PMID:34492290 Nkg7 Rat titanium dioxide increases expression ISO Nkg7 (Mus musculus) 6480464 titanium dioxide results in increased expression of NKG7 mRNA CTD PMID:23557971 Nkg7 Rat titanium dioxide decreases expression ISO Nkg7 (Mus musculus) 6480464 titanium dioxide results in decreased expression of NKG7 mRNA CTD PMID:27760801 Nkg7 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of NKG7 gene CTD PMID:27618143 Nkg7 Rat valproic acid increases methylation ISO NKG7 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of NKG7 gene CTD PMID:29154799
(+)-schisandrin B (EXP) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP) 17beta-estradiol 3-benzoate (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-butoxyethanol (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4-(ethoxymethylene)-2-phenyloxazol-5-one (EXP) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (EXP) acetamide (EXP) acetylsalicylic acid (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) antirheumatic drug (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP) carbon nanotube (ISO) chloroprene (ISO) chromium(6+) (ISO) cisplatin (ISO) D-glucose (ISO) D-mannitol (ISO) diazinon (ISO) Dibutyl phosphate (ISO) dioxygen (ISO) diuron (ISO) flavonoids (EXP) folic acid (ISO) fructose (ISO) genistein (ISO) glucose (ISO) glycidol (EXP) glyphosate (ISO) ionomycin (ISO) nickel atom (ISO) ozone (ISO) paracetamol (ISO) PhIP (ISO) phorbol 13-acetate 12-myristate (ISO) pirinixic acid (ISO) progesterone (ISO) pyrrolidine dithiocarbamate (ISO) silicon dioxide (ISO) tamibarotene (ISO) testosterone (EXP) tetrachloromethane (EXP) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (EXP) valproic acid (ISO)
Nkg7 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 102,981,497 - 102,982,564 (+) NCBI GRCr8 mRatBN7.2 1 93,844,748 - 93,845,975 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 93,844,902 - 93,845,983 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 99,230,257 - 99,231,324 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 107,702,931 - 107,703,998 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 100,995,511 - 100,996,578 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 98,492,873 - 98,493,940 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 98,492,828 - 98,493,978 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 99,569,678 - 99,570,745 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 93,813,123 - 93,814,190 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 93,891,233 - 93,892,299 (+) NCBI Celera 1 88,122,019 - 88,123,086 (+) NCBI Celera Cytogenetic Map 1 q22 NCBI
NKG7 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 51,371,620 - 51,372,654 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 51,371,606 - 51,372,701 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 51,874,874 - 51,875,908 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 56,566,686 - 56,567,772 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 56,566,685 - 56,567,772 NCBI Celera 19 48,925,955 - 48,927,041 (-) NCBI Celera Cytogenetic Map 19 q13.41 NCBI HuRef 19 48,206,847 - 48,207,933 (-) NCBI HuRef CHM1_1 19 51,876,835 - 51,877,921 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 54,460,261 - 54,461,295 (-) NCBI T2T-CHM13v2.0
Nkg7 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 43,086,562 - 43,087,670 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 43,086,497 - 43,087,673 (+) Ensembl GRCm39 Ensembl GRCm38 7 43,437,138 - 43,438,246 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 43,437,073 - 43,438,249 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 50,692,508 - 50,693,616 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 43,305,058 - 43,306,166 (+) NCBI MGSCv36 mm8 Celera 7 38,903,800 - 38,904,909 (+) NCBI Celera Cytogenetic Map 7 B3 NCBI cM Map 7 28.25 NCBI
Nkg7 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955558 1,028,425 - 1,029,161 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955558 1,027,682 - 1,029,338 (+) NCBI ChiLan1.0 ChiLan1.0
NKG7 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 57,408,922 - 57,409,958 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 59,330,407 - 59,331,538 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 48,306,714 - 48,307,961 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 57,192,778 - 57,193,882 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 57,192,788 - 57,193,882 (-) Ensembl panpan1.1 panPan2
NKG7 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 105,607,558 - 105,608,870 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 105,180,162 - 105,181,513 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 106,117,006 - 106,118,357 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 106,117,043 - 106,119,057 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 105,788,654 - 105,790,005 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 105,429,503 - 105,430,854 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 106,225,044 - 106,226,395 (+) NCBI UU_Cfam_GSD_1.0
Nkg7
NKG7 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 58,496,089 - 58,497,827 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 58,496,089 - 58,497,827 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 51,692,516 - 51,694,254 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NKG7 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 44,291,219 - 44,292,338 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 44,291,134 - 44,292,310 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666073 24,340,409 - 24,341,501 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Nkg7
.
Predicted Target Of
Count of predictions: 99 Count of miRNA genes: 80 Interacting mature miRNAs: 84 Transcripts: ENSRNOT00000023942 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1578649 Bmd8 Bone mineral density QTL 8 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 49393172 94393172 Rat 1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 78479925 123479925 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 2300324 Fetw1 Fetal weight QTL 1 12.1 0.005 fetal growth trait (VT:0004201) fetal body weight (CMO:0002080) 1 85424647 100358001 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 1302788 Scl19 Serum cholesterol QTL 19 4.6 0.001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 90532338 123479925 Rat 1549903 Bp267 Blood pressure QTL 267 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 77876254 106047988 Rat 2313083 Bmd74 Bone mineral density QTL 74 4 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 82174743 118944897 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 4889494 Scort2 Serum corticosterone level QTL 2 4.2 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 80592172 125592172 Rat 724567 Tcas6 Tongue tumor susceptibility QTL 6 6.85 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 1 92948896 144267916 Rat 61342 Bp27 Blood pressure QTL 27 3.4 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 56732668 98773277 Rat 61344 Bp29 Blood pressure QTL 29 7.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 78350581 123350581 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 2300164 Bmd44 Bone mineral density QTL 44 5.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 1 56949932 101949932 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 1300153 Bp171 Blood pressure QTL 171 3.37 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 90664883 143200202 Rat 738022 Anxrr13 Anxiety related response QTL 13 4.6 0.00039 locomotor behavior trait (VT:0001392) number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514) 1 83547917 128547917 Rat 152025249 Scl82 Serum cholesterol level QTL 82 4.77 blood cholesterol amount (VT:0000180) 1 50343510 99980958 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 77857876 122857876 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 78430536 123430536 Rat 2293142 Bp314 Blood pressure QTL 314 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 92184926 137184926 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat 724529 Cm16 Cardiac mass QTL 16 2.7 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 1 87580395 150700247 Rat
AI071161
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 1 102,982,166 - 102,982,459 (+) Marker Load Pipeline mRatBN7.2 1 93,845,577 - 93,845,870 (-) MAPPER mRatBN7.2 Rnor_6.0 1 98,492,978 - 98,493,270 NCBI Rnor6.0 Rnor_5.0 1 99,569,783 - 99,570,075 UniSTS Rnor5.0 RGSC_v3.4 1 93,813,793 - 93,814,085 UniSTS RGSC3.4 Celera 1 88,122,689 - 88,122,981 UniSTS RH 3.4 Map 1 905.49 UniSTS Cytogenetic Map 1 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
39
60
91
90
59
25
59
6
206
87
40
43
57
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000023942 ⟹ ENSRNOP00000023942
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 93,844,902 - 93,845,973 (+) Ensembl Rnor_6.0 Ensembl 1 98,492,828 - 98,493,978 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000103268 ⟹ ENSRNOP00000090553
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 93,844,902 - 93,845,983 (+) Ensembl
RefSeq Acc Id:
NM_133540 ⟹ NP_598224
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 102,981,497 - 102,982,564 (+) NCBI mRatBN7.2 1 93,844,908 - 93,845,975 (+) NCBI Rnor_6.0 1 98,492,873 - 98,493,940 (-) NCBI Rnor_5.0 1 99,569,678 - 99,570,745 (-) NCBI RGSC_v3.4 1 93,813,123 - 93,814,190 (+) RGD Celera 1 88,122,019 - 88,123,086 (+) RGD
Sequence:
TGACAAAGTCACTGCTTGCTGGCTGTTTCTCTGGCTCAGTGGACTAGAAGTCCAGGTGCATGGCCTTTTCCTTTTTCTAAGAGCCAACACTCTGGGTCATCTGTGTCTTTGTCCCCTAAGAAGTGGAA
hide sequence
RefSeq Acc Id:
NP_598224 ⟸ NM_133540
- UniProtKB:
Q9WVL9 (UniProtKB/TrEMBL), A6JAH6 (UniProtKB/TrEMBL), A0A8I6AE16 (UniProtKB/TrEMBL), F7FAL5 (UniProtKB/TrEMBL)
- Sequence:
MEPYRSLALLAGCLGLIFSLIALSTDFWIVATGPNFSAHSGLWPTSPGTQVAGYIHVTQVCCILAALWGLVSVSFLVLSCIPSLSAPGRGPMVSTVLSFAAALSIIVAMAVYTSERWSQPPSPQVQTF
hide sequence
Ensembl Acc Id:
ENSRNOP00000023942 ⟸ ENSRNOT00000023942
Ensembl Acc Id:
ENSRNOP00000090553 ⟸ ENSRNOT00000103268
RGD ID: 13689984 Promoter ID: EPDNEW_R509 Type: initiation region Name: Nkg7_1 Description: natural killer cell granule protein 7 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 98,493,953 - 98,494,013 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2014-03-12
Nkg7
natural killer cell granule protein 7
Nkg7
natural killer cell group 7 sequence
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Nkg7
natural killer cell group 7 sequence
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Nkg7
natural killer cell group 7 sequence
Symbol and Name status set to provisional
70820 PROVISIONAL
