Symbol:
Mchr1
Name:
melanin-concentrating hormone receptor 1
RGD ID:
619841
Description:
Enables hormone binding activity and melanin-concentrating hormone receptor activity. Involved in cell surface receptor signaling pathway; positive regulation of calcium ion transport; and positive regulation of cytosolic calcium ion concentration. Predicted to be located in ciliary membrane and non-motile cilium. Predicted to be active in neuron projection and plasma membrane. Biomarker of obesity. Human ortholog(s) of this gene implicated in morbid obesity. Orthologous to human MCHR1 (melanin concentrating hormone receptor 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; alpha-Zearalanol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
G protein-coupled receptor 24; G-protein coupled receptor 24; Gpr24; MCH receptor 1; Mch-1r; MCH-R1; MCH1R; MCHR; MCHR-1; SLC-1; Slc1; somatostatin receptor-like protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 114,641,721 - 114,644,913 (+) NCBI GRCr8 mRatBN7.2 7 112,761,554 - 112,764,746 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 112,761,554 - 112,764,032 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 114,524,098 - 114,526,580 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 116,747,649 - 116,750,131 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 116,717,002 - 116,719,482 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 122,456,846 - 122,459,324 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 122,456,799 - 122,459,960 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 122,432,538 - 122,435,016 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 119,557,141 - 119,559,619 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 119,591,370 - 119,593,849 (+) NCBI Celera 7 109,080,262 - 109,082,740 (+) NCBI Celera Cytogenetic Map 7 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
1.
MIZIP, a highly conserved, vertebrate specific melanin-concentrating hormone receptor 1 interacting zinc-finger protein.
Bachner D, etal., FEBS Lett 2002 Aug 28;526(1-3):124-8.
2.
Association of melanin-concentrating hormone receptor 1 5' polymorphism with early-onset extreme obesity.
Bell CG, etal., Diabetes. 2005 Oct;54(10):3049-55.
3.
Increases in melanin-concentrating hormone and MCH receptor levels in the hypothalamus of dietary-obese rats.
Elliott JC, etal., Brain Res Mol Brain Res. 2004 Sep 28;128(2):150-9.
4.
Interaction of neurochondrin with the melanin-concentrating hormone receptor 1 interferes with G protein-coupled signal transduction but not agonist-mediated internalization.
Francke F, etal., J Biol Chem. 2006 Oct 27;281(43):32496-507. Epub 2006 Aug 31.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
7.
Cloning of the rat brain cDNA encoding for the SLC-1 G protein-coupled receptor reveals the presence of an intron in the gene.
Lakaye B, etal., Biochim Biophys Acta 1998 Feb 4;1401(2):216-20.
8.
The receptor for the orexigenic peptide melanin-concentrating hormone is a G-protein-coupled receptor.
Lembo PM, etal., Nat Cell Biol. 1999 Sep;1(5):267-71.
9.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
10.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.
Online Mendelian Inheritance in Man, OMIM (TM).
Online Mendelian Inheritance in Man, OMIM (TM).
12.
GOA pipeline
RGD automated data pipeline
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
14.
Functional role of N-linked glycosylation on the rat melanin-concentrating hormone receptor 1.
Saito Y, etal., FEBS Lett 2003 Jan 2;533(1-3):29-34.
15.
The basic residues in the membrane-proximal C-terminal tail of the rat melanin-concentrating hormone receptor 1 are required for receptor function.
Tetsuka M, etal., Endocrinology. 2004 Aug;145(8):3712-23. Epub 2004 Apr 29.
Mchr1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 114,641,721 - 114,644,913 (+) NCBI GRCr8 mRatBN7.2 7 112,761,554 - 112,764,746 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 112,761,554 - 112,764,032 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 114,524,098 - 114,526,580 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 116,747,649 - 116,750,131 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 116,717,002 - 116,719,482 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 122,456,846 - 122,459,324 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 122,456,799 - 122,459,960 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 122,432,538 - 122,435,016 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 119,557,141 - 119,559,619 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 119,591,370 - 119,593,849 (+) NCBI Celera 7 109,080,262 - 109,082,740 (+) NCBI Celera Cytogenetic Map 7 q34 NCBI
MCHR1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 22 40,679,484 - 40,682,812 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 22 40,679,273 - 40,682,812 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 22 41,075,488 - 41,078,816 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 22 39,405,128 - 39,408,764 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 22 39,399,736 - 39,403,318 NCBI Celera 22 24,878,864 - 24,882,500 (+) NCBI Celera Cytogenetic Map 22 q13.2 NCBI HuRef 22 24,037,016 - 24,040,650 (+) NCBI HuRef CHM1_1 22 41,035,201 - 41,038,835 (+) NCBI CHM1_1 T2T-CHM13v2.0 22 41,151,449 - 41,154,777 (+) NCBI T2T-CHM13v2.0
Mchr1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 81,119,700 - 81,123,165 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 81,119,700 - 81,123,165 (+) Ensembl GRCm39 Ensembl GRCm38 15 81,235,499 - 81,238,964 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 81,235,499 - 81,238,964 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 81,065,929 - 81,069,394 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 81,063,029 - 81,065,367 (+) NCBI MGSCv36 mm8 Celera 15 83,352,799 - 83,356,252 (+) NCBI Celera Cytogenetic Map 15 E1 NCBI cM Map 15 38.02 NCBI
Mchr1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955413 26,343,759 - 26,347,520 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955413 26,343,771 - 26,347,374 (+) NCBI ChiLan1.0 ChiLan1.0
MCHR1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 23 50,512,835 - 50,516,718 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 22 53,212,725 - 53,216,607 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 22 21,577,190 - 21,581,062 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 22 39,673,698 - 39,677,517 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 22 39,673,698 - 39,677,517 (+) Ensembl panpan1.1 panPan2
MCHR1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 24,526,687 - 24,560,948 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 24,526,693 - 24,559,836 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 24,462,281 - 24,464,655 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 25,276,788 - 25,311,181 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 25,276,794 - 25,280,056 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 24,990,613 - 24,992,985 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 25,312,293 - 25,314,664 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 25,486,758 - 25,489,135 (-) NCBI UU_Cfam_GSD_1.0
Mchr1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 8,143,469 - 8,147,147 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936492 1,153,651 - 1,157,142 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936492 1,153,895 - 1,156,980 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MCHR1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 7,735,825 - 7,738,701 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 7,735,752 - 7,752,006 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 4,916,103 - 4,918,861 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MCHR1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 19 23,240,509 - 23,245,553 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 19 23,241,487 - 23,243,950 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 102,341,335 - 102,346,097 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mchr1
.
Predicted Target Of
Count of predictions: 78 Count of miRNA genes: 65 Interacting mature miRNAs: 67 Transcripts: ENSRNOT00000025564 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 1300112 Bp183 Blood pressure QTL 183 3.51 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 111182207 135012528 Rat 1331728 Bp214 Blood pressure QTL 214 2.825 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 80221299 124373579 Rat 1331731 Bp216 Blood pressure QTL 216 2.851 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 102297359 133492884 Rat 2298475 Eau6 Experimental allergic uveoretinitis QTL 6 0.0029 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 7 84257275 129257275 Rat 71114 Niddm14 Non-insulin dependent diabetes mellitus QTL 14 4.5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 7 84257275 129257275 Rat 1357336 Gluco6 Glucose level QTL 6 3.4 blood glucose amount (VT:0000188) serum glucose level (CMO:0000543) 7 94811326 116294265 Rat 631687 Hcas1 Hepatocarcinoma susceptibility QTL 1 3.9 0.001 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 7 91412594 129807172 Rat 70159 Bp61 Blood pressure QTL 61 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 103146217 116738842 Rat 1357339 Stl14 Serum triglyceride level QTL 14 3.45 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 112729683 133492707 Rat 634331 Pia17 Pristane induced arthritis QTL 17 4.7 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 7 73829340 130221005 Rat 1358914 Bp266 Blood pressure QTL 266 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 634322 Bw12 Body weight QTL 12 0 body mass (VT:0001259) body weight (CMO:0000012) 7 83153392 128153392 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 1549899 Stresp8 Stress response QTL 8 4.37 0.0008 stress-related behavior trait (VT:0010451) defensive burying duration (CMO:0001961) 7 90482196 135012528 Rat 2317052 Aia17 Adjuvant induced arthritis QTL 17 2.13 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 7 81737938 126737938 Rat 731176 Glom5 Glomerulus QTL 5 2.5 0.0035 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 7 96670164 135012528 Rat 7411607 Foco15 Food consumption QTL 15 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2306821 Bp335 Blood pressure QTL 335 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 106571501 135012528 Rat 631663 Bw6 Body weight QTL 6 3.4 body mass (VT:0001259) body weight (CMO:0000012) 7 111075573 134976056 Rat 1558655 Swd4 Spike wave discharge measurement QTL 4 3.68 0.0002 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge severity grade (CMO:0001988) 7 86983365 131983365 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 1331768 Kidm10 Kidney mass QTL 10 4.62096 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 80221299 125221299 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 2313102 Bmd79 Bone mineral density QTL 79 2.3 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 7 94811085 116738842 Rat 731174 Uae23 Urinary albumin excretion QTL 23 2.4 0.0042 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 7 104603555 135012528 Rat 2316947 Rf58 Renal function QTL 58 7.8 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 7 68938720 113886318 Rat 1331748 Bp215 Blood pressure QTL 215 4.043 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 112308254 133492884 Rat 7411654 Foco25 Food consumption QTL 25 9.3 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2316955 Stl24 Serum triglyceride level QTL 24 7.1 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 7 68938720 113886318 Rat 2299163 Iddm34 Insulin dependent diabetes mellitus QTL 34 2.71 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 7 91281130 135012528 Rat 2316952 Pur22 Proteinuria QTL 22 5.2 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 7 68938720 113886318 Rat 631540 Bw9 Body weight QTL 9 4.5 body mass (VT:0001259) body weight (CMO:0000012) 7 69736226 117455174 Rat 1358891 Bp265 Blood pressure QTL 265 2.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
8
11
21
113
59
56
31
9
31
6
141
53
93
41
58
25
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000025564 ⟹ ENSRNOP00000025564
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 112,761,554 - 112,764,032 (+) Ensembl Rnor_6.0 Ensembl 7 122,456,799 - 122,459,960 (+) Ensembl
RefSeq Acc Id:
NM_031758 ⟹ NP_113946
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 114,641,721 - 114,644,199 (+) NCBI mRatBN7.2 7 112,761,554 - 112,764,032 (+) NCBI Rnor_6.0 7 122,456,846 - 122,459,324 (+) NCBI Rnor_5.0 7 122,432,538 - 122,435,016 (+) NCBI RGSC_v3.4 7 119,557,141 - 119,559,619 (+) RGD Celera 7 109,080,262 - 109,082,740 (+) RGD
Sequence:
GCAGGCGACCTGCACCGGCTGCATGGATCTGCAAACCTCGTTGCTGTCCACTGGCCCCAATGCCAGCAACATCTCCGATGGCCAGGATAATCTCACATTGCCGGGGTCACCTCCTCGCACAGGGAGTG
hide sequence
RefSeq Acc Id:
XM_039079955 ⟹ XP_038935883
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 114,641,829 - 114,644,913 (+) NCBI mRatBN7.2 7 112,761,712 - 112,764,746 (+) NCBI
RefSeq Acc Id:
NP_113946 ⟸ NM_031758
- UniProtKB:
A0A140TAD3 (UniProtKB/Swiss-Prot), P97639 (UniProtKB/Swiss-Prot)
- Sequence:
MDLQTSLLSTGPNASNISDGQDNLTLPGSPPRTGSVSYINIIMPSVFGTICLLGIVGNSTVIFAVVKKSKLHWCSNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQF
hide sequence
Ensembl Acc Id:
ENSRNOP00000025564 ⟸ ENSRNOT00000025564
RefSeq Acc Id:
XP_038935883 ⟸ XM_039079955
- Peptide Label:
isoform X1
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-03-30
Mchr1
melanin-concentrating hormone receptor 1
Gpr24
G protein-coupled receptor 24
Symbol and Name updated
1299863 APPROVED
2004-12-14
Gpr24
G protein-coupled receptor 24
somatostatin receptor-like protein
Name updated
1299863 APPROVED
2002-08-07
Gpr24
somatostatin receptor-like protein
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_pathway
involves in the Ca2+, cAMP and MAP kinases signaling pathways
628540
gene_protein
all three N-linked glycosylation sites are glycosylated in vivo
628540
gene_regulation
N-glycosylation at Asn23 is important for cell surface expression, ligand binding and signal transduction
628540
