Symbol:
Napsa
Name:
napsin A aspartic peptidase
RGD ID:
61940
Description:
Predicted to enable aspartic-type endopeptidase activity. Predicted to be involved in membrane protein proteolysis and surfactant homeostasis. Predicted to be located in alveolar lamellar body. Predicted to be active in extracellular space and lysosome. Orthologous to human NAPSA (napsin A aspartic peptidase); INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Kdap; kidney-derived aspartic protease-like protein; napsin-A
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NAPSA (napsin A aspartic peptidase) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Napsa (napsin A aspartic peptidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Napsa (napsin A aspartic peptidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NAPSA (napsin A aspartic peptidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NAPSA (napsin A aspartic peptidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Napsa (napsin A aspartic peptidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NAPSA (napsin A aspartic peptidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NAPSA (napsin A aspartic peptidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Napsa (napsin A aspartic peptidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Napsa (napsin A aspartic peptidase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
NAPSA (napsin A aspartic peptidase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
napsa (napsin A aspartic peptidase)
Alliance
DIOPT (Ensembl Compara|PANTHER)
Saccharomyces cerevisiae (baker's yeast):
PEP4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
asp-12
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
asp-15
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
asp-16
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
asp-18
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
asp-19
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
asp-5
Alliance
DIOPT (Ensembl Compara|PANTHER)
Xenopus tropicalis (tropical clawed frog):
napsa
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 104,200,967 - 104,213,603 (+) NCBI GRCr8 mRatBN7.2 1 95,064,726 - 95,077,101 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 95,064,900 - 95,077,094 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 100,450,303 - 100,462,481 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 108,922,947 - 108,935,138 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 102,213,368 - 102,225,554 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 100,577,497 - 100,589,802 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 100,577,056 - 100,589,836 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 101,642,884 - 101,655,189 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 95,050,761 - 95,062,774 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 95,128,906 - 95,140,864 (+) NCBI Celera 1 89,327,190 - 89,339,345 (+) NCBI Celera Cytogenetic Map 1 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Napsa Rat 1,1-dichloroethene decreases expression ISO RGD:62233 6480464 vinylidene chloride results in decreased expression of NAPSA mRNA CTD PMID:26682919 Napsa Rat 1,2-dimethylhydrazine increases expression ISO RGD:62233 6480464 1,2-Dimethylhydrazine results in increased expression of NAPSA mRNA CTD PMID:22206623 Napsa Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of NAPSA mRNA CTD PMID:32741896 Napsa Rat 17beta-estradiol decreases expression ISO RGD:1347374 6480464 Estradiol results in decreased expression of NAPSA mRNA CTD PMID:31614463 Napsa Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of NAPSA mRNA CTD PMID:32741896 Napsa Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of NAPSA mRNA CTD PMID:22298810 Napsa Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of NAPSA mRNA CTD PMID:32109520|PMID:34747641 Napsa Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:62233 6480464 Tetrachlorodibenzodioxin results in increased expression of NAPSA mRNA CTD PMID:28213091 Napsa Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:62233 6480464 Tetrachlorodibenzodioxin affects the expression of NAPSA mRNA CTD PMID:21570461 Napsa Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO RGD:62233 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of NAPSA mRNA CTD PMID:38648751 Napsa Rat 2-palmitoylglycerol increases expression ISO RGD:1347374 6480464 2-palmitoylglycerol results in increased expression of NAPSA mRNA CTD PMID:37199045 Napsa Rat 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine increases expression EXP 6480464 Puromycin Aminonucleoside results in increased expression of NAPSA mRNA; Puromycin Aminonucleoside results in increased expression more ... CTD PMID:12501893 Napsa Rat 3-chloropropane-1,2-diol multiple interactions ISO RGD:62233 6480464 [alpha-Chlorohydrin co-treated with glycidol] results in decreased expression of NAPSA mRNA CTD PMID:33187795 Napsa Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ... CTD PMID:36041667 Napsa Rat 4-hydroxyphenyl retinamide increases expression ISO RGD:62233 6480464 Fenretinide results in increased expression of NAPSA mRNA CTD PMID:28973697 Napsa Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of NAPSA mRNA CTD PMID:24780913 Napsa Rat all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of NAPSA mRNA CTD PMID:20488242 Napsa Rat all-trans-retinoic acid affects expression ISO RGD:1347374 6480464 Tretinoin affects the expression of NAPSA mRNA CTD PMID:31600526 Napsa Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of NAPSA mRNA CTD PMID:35163327 Napsa Rat alpha-Zearalanol increases expression EXP 6480464 Zeranol results in increased expression of NAPSA mRNA CTD PMID:35163327 Napsa Rat amiodarone decreases expression EXP 6480464 Amiodarone results in decreased expression of NAPSA mRNA CTD PMID:17991464 Napsa Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of NAPSA mRNA CTD PMID:16483693 Napsa Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of NAPSA mRNA CTD PMID:30779732 Napsa Rat benzo[a]pyrene increases expression ISO RGD:62233 6480464 Benzo(a)pyrene results in increased expression of NAPSA mRNA CTD PMID:22228805 Napsa Rat benzo[a]pyrene increases methylation ISO RGD:1347374 6480464 Benzo(a)pyrene results in increased methylation of NAPSA 5' UTR CTD PMID:27901495 Napsa Rat benzo[a]pyrene affects methylation ISO RGD:1347374 6480464 Benzo(a)pyrene affects the methylation of NAPSA promoter CTD PMID:27901495 Napsa Rat benzo[a]pyrene multiple interactions ISO RGD:62233 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of NAPSA mRNA] CTD PMID:22228805 Napsa Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NAPSA mRNA CTD PMID:25181051|PMID:30816183|PMID:32145629|PMID:32528016 Napsa Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ... CTD PMID:36041667 Napsa Rat bisphenol A increases expression ISO RGD:62233 6480464 bisphenol A results in increased expression of NAPSA mRNA CTD PMID:32156529 Napsa Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ... CTD PMID:36041667 Napsa Rat cadmium dichloride decreases expression ISO RGD:1347374 6480464 Cadmium Chloride results in decreased expression of NAPSA mRNA CTD PMID:38382870 Napsa Rat carbon nanotube increases expression ISO RGD:62233 6480464 Nanotubes, Carbon results in increased expression of NAPSA mRNA CTD PMID:25554681 Napsa Rat choline multiple interactions ISO RGD:62233 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Napsa Rat cisplatin multiple interactions ISO RGD:1347374 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of NAPSA mRNA CTD PMID:27392435 Napsa Rat cisplatin increases expression ISO RGD:1347374 6480464 Cisplatin results in increased expression of NAPSA mRNA CTD PMID:27392435 Napsa Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of NAPSA mRNA CTD PMID:30556269 Napsa Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of NAPSA mRNA CTD PMID:30556269 Napsa Rat Dibutyl phosphate affects expression ISO RGD:1347374 6480464 di-n-butylphosphoric acid affects the expression of NAPSA mRNA CTD PMID:37042841 Napsa Rat dimethylarsinic acid multiple interactions ISO RGD:62233 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ... CTD PMID:34876320 Napsa Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression more ... CTD PMID:33729688 Napsa Rat doxorubicin affects expression EXP 6480464 Doxorubicin affects the expression of NAPSA mRNA CTD PMID:12501893 Napsa Rat doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of NAPSA protein CTD PMID:12501893 Napsa Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of NAPSA mRNA CTD PMID:18035473 Napsa Rat folic acid multiple interactions ISO RGD:62233 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Napsa Rat glycidol multiple interactions ISO RGD:62233 6480464 [alpha-Chlorohydrin co-treated with glycidol] results in decreased expression of NAPSA mRNA CTD PMID:33187795 Napsa Rat L-methionine multiple interactions ISO RGD:62233 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Napsa Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of NAPSA gene CTD PMID:35440735 Napsa Rat methylarsonic acid multiple interactions ISO RGD:62233 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ... CTD PMID:34876320 Napsa Rat methylmercury chloride increases expression EXP 6480464 methylmercuric chloride results in increased expression of NAPSA mRNA CTD PMID:31378766 Napsa Rat nickel sulfate decreases expression ISO RGD:62233 6480464 nickel sulfate results in decreased expression of NAPSA mRNA CTD PMID:16100012 Napsa Rat nitrates multiple interactions ISO RGD:62233 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of NAPSA more ... CTD PMID:35964746 Napsa Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of NAPSA mRNA CTD PMID:33484710 Napsa Rat okadaic acid decreases expression ISO RGD:1347374 6480464 Okadaic Acid results in decreased expression of NAPSA mRNA CTD PMID:38832940 Napsa Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of NAPSA mRNA CTD PMID:32680482 Napsa Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of NAPSA mRNA CTD PMID:35163327 Napsa Rat pirinixic acid multiple interactions ISO RGD:1347374 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Napsa Rat progesterone affects expression ISO RGD:62233 6480464 Progesterone affects the expression of NAPSA mRNA CTD PMID:17251523 Napsa Rat senecionine increases expression ISO RGD:62233 6480464 senecionine results in increased expression of NAPSA protein CTD PMID:35357534 Napsa Rat serpentine asbestos decreases expression ISO RGD:1347374 6480464 Asbestos, Serpentine results in decreased expression of NAPSA mRNA CTD PMID:21148743 Napsa Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of NAPSA mRNA CTD PMID:18685790 Napsa Rat silver atom increases expression ISO RGD:62233 6480464 Silver results in increased expression of NAPSA mRNA CTD PMID:27131904 Napsa Rat silver(0) increases expression ISO RGD:62233 6480464 Silver results in increased expression of NAPSA mRNA CTD PMID:27131904 Napsa Rat sodium arsenate multiple interactions ISO RGD:62233 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ... CTD PMID:34876320 Napsa Rat sodium arsenite multiple interactions ISO RGD:62233 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ... CTD PMID:34876320 Napsa Rat sulforaphane decreases expression ISO RGD:62233 6480464 sulforaphane results in decreased expression of NAPSA mRNA CTD PMID:30529165 Napsa Rat tert-butyl hydroperoxide increases expression ISO RGD:62233 6480464 tert-Butylhydroperoxide results in increased expression of NAPSA mRNA CTD PMID:14729362|PMID:15003993 Napsa Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of NAPSA mRNA CTD PMID:32741896 Napsa Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of NAPSA mRNA CTD PMID:23411599 Napsa Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of NAPSA mRNA CTD PMID:34492290 Napsa Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of NAPSA mRNA CTD PMID:33387578 Napsa Rat trimellitic anhydride increases expression ISO RGD:62233 6480464 trimellitic anhydride results in increased expression of NAPSA mRNA CTD PMID:19042947 Napsa Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of NAPSA mRNA CTD PMID:35594946 Napsa Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of NAPSA mRNA CTD PMID:19015723 Napsa Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of NAPSA mRNA CTD PMID:23034163
1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-palmitoylglycerol (ISO) 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (EXP) 3-chloropropane-1,2-diol (ISO) 4,4'-sulfonyldiphenol (EXP) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) all-trans-retinoic acid (EXP,ISO) alpha-Zearalanol (EXP) amiodarone (EXP) ammonium chloride (EXP) amphetamine (EXP) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) cadmium dichloride (ISO) carbon nanotube (ISO) choline (ISO) cisplatin (ISO) copper atom (EXP) copper(0) (EXP) Dibutyl phosphate (ISO) dimethylarsinic acid (ISO) dioxygen (EXP) doxorubicin (EXP) flavonoids (EXP) folic acid (ISO) glycidol (ISO) L-methionine (ISO) methoxychlor (EXP) methylarsonic acid (ISO) methylmercury chloride (EXP) nickel sulfate (ISO) nitrates (ISO) nitrofen (EXP) okadaic acid (ISO) paraquat (EXP) perfluorooctanoic acid (EXP) pirinixic acid (ISO) progesterone (ISO) senecionine (ISO) serpentine asbestos (ISO) silicon dioxide (EXP) silver atom (ISO) silver(0) (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sulforaphane (ISO) tert-butyl hydroperoxide (ISO) testosterone (EXP) thioacetamide (EXP) trichloroethene (EXP) trimellitic anhydride (ISO) valproic acid (EXP) vinclozolin (EXP)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
4.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.
GOA pipeline
RGD automated data pipeline
6.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
7.
Cloning, expression and functional characterization of rat napsin.
Schauer-Vukasinovic V, etal., Biochim Biophys Acta 2000 Jun 21;1492(1):207-10.
8.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
9.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
Napsa Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 104,200,967 - 104,213,603 (+) NCBI GRCr8 mRatBN7.2 1 95,064,726 - 95,077,101 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 95,064,900 - 95,077,094 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 100,450,303 - 100,462,481 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 108,922,947 - 108,935,138 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 102,213,368 - 102,225,554 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 100,577,497 - 100,589,802 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 100,577,056 - 100,589,836 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 101,642,884 - 101,655,189 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 95,050,761 - 95,062,774 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 95,128,906 - 95,140,864 (+) NCBI Celera 1 89,327,190 - 89,339,345 (+) NCBI Celera Cytogenetic Map 1 q22 NCBI
NAPSA Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 50,358,477 - 50,365,639 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 50,358,472 - 50,365,830 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 50,861,734 - 50,868,896 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 55,553,546 - 55,560,743 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 55,553,546 - 55,560,743 NCBI Celera 19 47,911,985 - 47,919,182 (-) NCBI Celera Cytogenetic Map 19 q13.33 NCBI HuRef 19 47,199,888 - 47,207,085 (-) NCBI HuRef CHM1_1 19 50,863,518 - 50,870,712 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 53,446,012 - 53,456,925 (-) NCBI T2T-CHM13v2.0
Napsa Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 44,221,869 - 44,236,270 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 44,221,804 - 44,236,286 (+) Ensembl GRCm39 Ensembl GRCm38 7 44,572,445 - 44,586,846 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 44,572,380 - 44,586,862 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 51,827,815 - 51,842,216 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 44,440,487 - 44,454,888 (+) NCBI MGSCv36 mm8 Celera 7 40,022,411 - 40,036,713 (+) NCBI Celera Cytogenetic Map 7 B3 NCBI cM Map 7 28.84 NCBI
Napsa Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955559 769,477 - 778,543 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955559 769,555 - 777,970 (+) NCBI ChiLan1.0 ChiLan1.0
NAPSA Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 56,423,327 - 56,435,810 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 58,344,656 - 58,357,209 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 47,321,581 - 47,333,307 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 56,225,421 - 56,232,978 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 56,225,421 - 56,232,822 (-) Ensembl panpan1.1 panPan2
NAPSA Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 106,351,842 - 106,361,592 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 106,318,488 - 106,374,987 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 105,924,958 - 105,934,699 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 106,862,954 - 106,872,701 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 106,829,581 - 106,896,644 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 106,535,027 - 106,544,763 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 106,176,569 - 106,186,313 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 107,017,232 - 107,026,974 (+) NCBI UU_Cfam_GSD_1.0
Napsa
NAPSA Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 55,221,205 - 55,230,449 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 55,221,203 - 55,230,609 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 51,070,030 - 51,079,473 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NAPSA Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 43,416,721 - 43,428,423 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 43,416,338 - 43,428,297 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666073 23,402,227 - 23,408,910 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Napsa
.
Predicted Target Of
Count of predictions: 44 Count of miRNA genes: 43 Interacting mature miRNAs: 44 Transcripts: ENSRNOT00000026992 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 78479925 123479925 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 2300324 Fetw1 Fetal weight QTL 1 12.1 0.005 fetal growth trait (VT:0004201) fetal body weight (CMO:0002080) 1 85424647 100358001 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 1331800 Scl25 Serum cholesterol level QTL 25 3.013 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 94494440 117601394 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 1302788 Scl19 Serum cholesterol QTL 19 4.6 0.001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 90532338 123479925 Rat 1549903 Bp267 Blood pressure QTL 267 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 77876254 106047988 Rat 2313083 Bmd74 Bone mineral density QTL 74 4 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 82174743 118944897 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 4889494 Scort2 Serum corticosterone level QTL 2 4.2 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 80592172 125592172 Rat 724567 Tcas6 Tongue tumor susceptibility QTL 6 6.85 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 1 92948896 144267916 Rat 61342 Bp27 Blood pressure QTL 27 3.4 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 56732668 98773277 Rat 61344 Bp29 Blood pressure QTL 29 7.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 78350581 123350581 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 2300164 Bmd44 Bone mineral density QTL 44 5.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 1 56949932 101949932 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 1300153 Bp171 Blood pressure QTL 171 3.37 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 90664883 143200202 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 738022 Anxrr13 Anxiety related response QTL 13 4.6 0.00039 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of, or within a discrete space in an open field apparatus (CMO:0001514) 1 83547917 128547917 Rat 152025249 Scl82 Serum cholesterol level QTL 82 4.77 blood cholesterol amount (VT:0000180) 1 50343510 99980958 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 77857876 122857876 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 78430536 123430536 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 2293142 Bp314 Blood pressure QTL 314 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 92184926 137184926 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat 724529 Cm16 Cardiac mass QTL 16 2.7 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 1 87580395 150700247 Rat
AA858922
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 95,075,500 - 95,075,744 (+) MAPPER mRatBN7.2 Rnor_6.0 1 100,588,096 - 100,588,339 NCBI Rnor6.0 Rnor_5.0 1 101,653,483 - 101,653,726 UniSTS Rnor5.0 RGSC_v3.4 1 95,061,360 - 95,061,603 UniSTS RGSC3.4 Celera 1 89,337,787 - 89,338,030 UniSTS Cytogenetic Map 1 q22 UniSTS
BE110283
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 95,075,420 - 95,075,618 (+) MAPPER mRatBN7.2 Rnor_6.0 1 100,588,016 - 100,588,213 NCBI Rnor6.0 Rnor_5.0 1 101,653,403 - 101,653,600 UniSTS Rnor5.0 RGSC_v3.4 1 95,061,280 - 95,061,477 UniSTS RGSC3.4 Celera 1 89,337,707 - 89,337,904 UniSTS RH 3.4 Map 1 905.89 UniSTS Cytogenetic Map 1 q22 UniSTS
Napsa
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 1 104,212,422 - 104,213,360 (+) Marker Load Pipeline mRatBN7.2 1 95,075,910 - 95,076,851 (+) MAPPER mRatBN7.2 Rnor_6.0 1 100,588,506 - 100,589,559 NCBI Rnor6.0 Rnor_5.0 1 101,653,893 - 101,654,946 UniSTS Rnor5.0 Celera 1 89,338,197 - 89,339,102 UniSTS Cytogenetic Map 1 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
47
109
91
90
59
25
59
6
216
95
89
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000026992 ⟹ ENSRNOP00000026992
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 95,064,900 - 95,077,094 (+) Ensembl Rnor_6.0 Ensembl 1 100,577,056 - 100,589,836 (+) Ensembl
RefSeq Acc Id:
NM_031670 ⟹ NP_113858
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 104,201,414 - 104,213,603 (+) NCBI mRatBN7.2 1 95,064,900 - 95,077,094 (+) NCBI Rnor_6.0 1 100,577,497 - 100,589,802 (+) NCBI Rnor_5.0 1 101,642,884 - 101,655,189 (+) NCBI RGSC_v3.4 1 95,050,761 - 95,062,774 (+) RGD Celera 1 89,327,190 - 89,339,345 (+) RGD
Sequence:
GAGCCACAGGACATCTTGGCCCAGTCCTAGTCCCCAGAGATGTTGCCACCACCGCTGCTGCTGCTGCTGTGCCTGGTGCTGCTGGGGAATTTGGAGCCTGCGGCCACACTGATCCGAGTCCCTCTTCG
hide sequence
RefSeq Acc Id:
XM_039089063 ⟹ XP_038944991
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 104,200,967 - 104,213,603 (+) NCBI mRatBN7.2 1 95,064,726 - 95,077,101 (+) NCBI
RefSeq Acc Id:
NP_113858 ⟸ NM_031670
- Peptide Label:
precursor
- UniProtKB:
Q9QX71 (UniProtKB/TrEMBL), A6JAR3 (UniProtKB/TrEMBL), F7FL28 (UniProtKB/TrEMBL), Q68G15 (UniProtKB/TrEMBL)
- Sequence:
MLPPPLLLLLCLVLLGNLEPAATLIRVPLRRIHPGHRIFSPLYGWEQRAELSRTPTSGGKTAFVPLSKFMNTQYFGDIGLGTPPQNFTVVFDTGSSNLWVPSTRCHFFSLACWFHHRFNPKASSSFRP
hide sequence
Ensembl Acc Id:
ENSRNOP00000026992 ⟸ ENSRNOT00000026992
RefSeq Acc Id:
XP_038944991 ⟸ XM_039089063
- Peptide Label:
isoform X1
RGD ID: 13690002 Promoter ID: EPDNEW_R527 Type: multiple initiation site Name: Napsa_1 Description: napsin A aspartic peptidase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 100,577,519 - 100,577,579 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Napsa
napsin A aspartic peptidase
Kdap
kidney-derived aspartic protease-like protein
Symbol and Name updated
1299863 APPROVED
2002-06-10
Kdap
kidney-derived aspartic protease-like protein
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_expression
expressed in kidney, lung and spleen
61649
gene_regulation
enzymatic activity is inhibited by pepstatin
61649
