Symbol:
Tpi1 (Ensembl: Tpi1l2)
Name:
triosephosphate isomerase 1 (Ensembl:triosephosphate isomerase 1 like 2)
RGD ID:
3896
Description:
Enables triose-phosphate isomerase activity. Predicted to be involved in several processes, including glucose metabolic process; glyceraldehyde-3-phosphate biosynthetic process; and methylglyoxal biosynthetic process. Predicted to act upstream of or within glucose metabolic process. Predicted to be active in cytosol. Biomarker of ocular hypertension. Human ortholog(s) of this gene implicated in carbohydrate metabolic disorder and triosephosphate isomerase deficiency. Orthologous to human TPI1 (triosephosphate isomerase 1); PARTICIPATES IN Fanconi syndrome pathway; fructose and mannose metabolic pathway; fructose-1,6-bisphosphatase deficiency pathway; INTERACTS WITH (+)-schisandrin B; 1,2,4-trimethylbenzene; 1,3-dinitrobenzene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC100911515; methylglyoxal synthase; MGC156639; TIM; Tpi; triose-phosphate isomerase; triosephosphate isomerase; triosephosphate isomerase-like
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TPI1 (triosephosphate isomerase 1) RGD
RGD
Mus musculus (house mouse):
Tpi1 (triosephosphate isomerase 1) RGD
RGD
Chinchilla lanigera (long-tailed chinchilla):
Tpi1 (triosephosphate isomerase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TPI1 (triosephosphate isomerase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TPI1 (triosephosphate isomerase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tpi1 (triosephosphate isomerase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TPI1 (triosephosphate isomerase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TPI1 (triosephosphate isomerase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tpi1 (triosephosphate isomerase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
TPI1 (triosephosphate isomerase 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Mus musculus (house mouse):
Tpi1 (triosephosphate isomerase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tpi1a (triosephosphate isomerase 1a)
Alliance
DIOPT (InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
tpi1b (triosephosphate isomerase 1b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Tpi
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
TPI1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
tpi-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
tpi1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Related Pseudogenes:
LOC681129
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 159,301,558 - 159,305,088 (-) NCBI GRCr8 mRatBN7.2 4 157,615,283 - 157,618,813 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 157,615,386 - 157,619,541 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 163,843,450 - 163,846,958 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 159,626,360 - 159,629,868 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 158,261,966 - 158,265,490 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 157,328,375 - 157,331,905 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_5.0 4 224,345,971 - 224,349,501 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 160,933,341 - 160,936,871 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 161,178,382 - 161,181,807 (-) NCBI Celera 4 146,353,273 - 146,356,791 (-) NCBI Celera Cytogenetic Map 4 q42 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tpi1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of TPI1 mRNA] CTD PMID:31150632 Tpi1 Rat 1,2,4-trimethylbenzene decreases expression EXP 6480464 pseudocumene results in decreased expression of TPI1 protein CTD PMID:17337753 Tpi1 Rat 1,2-dimethylhydrazine multiple interactions ISO Tpi1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TPI1 mRNA CTD PMID:22206623 Tpi1 Rat 1,3-dinitrobenzene decreases expression EXP 6480464 3-dinitrobenzene results in decreased expression of TPI1 protein CTD PMID:24140754 Tpi1 Rat 1-bromopropane increases expression EXP 6480464 1-bromopropane results in increased expression of TPI1 protein CTD PMID:21925529 Tpi1 Rat 1-bromopropane decreases expression EXP 6480464 1-bromopropane results in decreased expression of TPI1 protein CTD PMID:21925529 Tpi1 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of TPI1 mRNA CTD PMID:12075121 and PMID:15576828 Tpi1 Rat 17alpha-ethynylestradiol affects expression ISO Tpi1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of TPI1 mRNA CTD PMID:17555576 Tpi1 Rat 17beta-estradiol multiple interactions ISO TPI1 (Homo sapiens) 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in increased expression of TPI1 mRNA CTD PMID:20823114 Tpi1 Rat 17beta-estradiol increases expression ISO Tpi1 (Mus musculus) 6480464 Estradiol results in increased expression of TPI1 mRNA CTD PMID:39298647 Tpi1 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of TPI1 mRNA CTD PMID:32145629 Tpi1 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Tpi1 (Mus musculus) 6480464 [2 more ... CTD PMID:23457121 Tpi1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO TPI1 (Homo sapiens) 6480464 2-methyl-2H-pyrazole-3-carboxylic acid (2-methyl-4-o-tolylazophenyl)amide inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of TPI1 mRNA] and alpha-naphthoflavone inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of TPI1 mRNA] CTD PMID:23152189 Tpi1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of TPI1 mRNA CTD PMID:32109520 and PMID:33387578 Tpi1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Tpi1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TPI1 mRNA CTD PMID:21570461 Tpi1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO TPI1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of TPI1 mRNA CTD PMID:23152189 Tpi1 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Tpi1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression EXP 6480464 2 more ... CTD PMID:19954255 Tpi1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Tpi1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Tpi1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of TPI1 mRNA CTD PMID:21346803 Tpi1 Rat 2,5-hexanedione increases expression EXP 6480464 2 more ... CTD PMID:19033394 and PMID:22952946 Tpi1 Rat 2,6-dimethoxyphenol multiple interactions ISO TPI1 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Tpi1 Rat 3-chloropropane-1,2-diol affects expression EXP 6480464 alpha-Chlorohydrin analog affects the expression of TPI1 protein CTD PMID:26597043 Tpi1 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of TPI1 protein CTD PMID:26597043 Tpi1 Rat 4,4'-sulfonyldiphenol increases expression ISO Tpi1 (Mus musculus) 6480464 bisphenol S results in increased expression of TPI1 mRNA CTD PMID:39298647 Tpi1 Rat 4,4'-sulfonyldiphenol affects methylation ISO Tpi1 (Mus musculus) 6480464 bisphenol S affects the methylation of TPI1 gene CTD PMID:31683443 Tpi1 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of TPI1 mRNA CTD PMID:36041667 Tpi1 Rat 4-hydroxynon-2-enal affects binding ISO TPI1 (Homo sapiens) 6480464 4-hydroxy-2-nonenal binds to TPI1 protein CTD PMID:19374891 Tpi1 Rat 4-hydroxyphenyl retinamide decreases expression ISO Tpi1 (Mus musculus) 6480464 Fenretinide results in decreased expression of TPI1 mRNA CTD PMID:28973697 Tpi1 Rat 5-fluorouracil decreases expression ISO TPI1 (Homo sapiens) 6480464 Fluorouracil results in decreased expression of TPI1 mRNA CTD PMID:16510598 Tpi1 Rat 5-fluorouracil affects response to substance ISO TPI1 (Homo sapiens) 6480464 TPI1 protein affects the susceptibility to Fluorouracil CTD PMID:18309519 Tpi1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of TPI1 mRNA CTD PMID:30047161 Tpi1 Rat acrolein multiple interactions ISO TPI1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of TPI1 mRNA more ... CTD PMID:32699268 and PMID:32845096 Tpi1 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of TPI1 mRNA CTD PMID:28959563 Tpi1 Rat all-trans-retinoic acid decreases expression ISO TPI1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of TPI1 mRNA CTD PMID:23724009 Tpi1 Rat all-trans-retinoic acid increases expression ISO TPI1 (Homo sapiens) 6480464 Tretinoin results in increased expression of TPI1 mRNA CTD PMID:33167477 Tpi1 Rat all-trans-retinol increases expression EXP 6480464 Vitamin A results in increased expression of TPI1 mRNA alternative form CTD PMID:8793052 Tpi1 Rat alpha-naphthoflavone increases expression ISO TPI1 (Homo sapiens) 6480464 alpha-naphthoflavone results in increased expression of TPI1 mRNA CTD PMID:23152189 Tpi1 Rat alpha-naphthoflavone multiple interactions ISO TPI1 (Homo sapiens) 6480464 alpha-naphthoflavone inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of TPI1 mRNA] CTD PMID:23152189 Tpi1 Rat alpha-pinene multiple interactions ISO TPI1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of TPI1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of TPI1 mRNA CTD PMID:32699268 Tpi1 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of TPI1 mRNA and [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of TPI1 mRNA CTD PMID:35163327 Tpi1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of TPI1 mRNA CTD PMID:16483693 Tpi1 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of TPI1 mRNA CTD PMID:30779732 Tpi1 Rat aristolochic acid A increases expression ISO TPI1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of TPI1 protein CTD PMID:33212167 Tpi1 Rat arsane affects expression EXP 6480464 Arsenic affects the expression of TPI1 mRNA CTD PMID:18315880 Tpi1 Rat arsane decreases expression EXP 6480464 Arsenic results in decreased expression of TPI1 mRNA CTD PMID:18315880 Tpi1 Rat arsenic atom affects expression EXP 6480464 Arsenic affects the expression of TPI1 mRNA CTD PMID:18315880 Tpi1 Rat arsenic atom decreases expression EXP 6480464 Arsenic results in decreased expression of TPI1 mRNA CTD PMID:18315880 Tpi1 Rat arsenite(3-) multiple interactions ISO TPI1 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to TPI1 mRNA] CTD PMID:32406909 Tpi1 Rat arsenous acid multiple interactions ISO TPI1 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to TPI1 protein] CTD PMID:26598702 Tpi1 Rat Azaspiracid increases expression ISO TPI1 (Homo sapiens) 6480464 azaspiracid results in increased expression of TPI1 mRNA CTD PMID:28939011 Tpi1 Rat benzalkonium chloride decreases expression ISO Tpi1 (Mus musculus) 6480464 Benzalkonium Compounds results in decreased expression of TPI1 mRNA CTD PMID:31199489 Tpi1 Rat benzo[a]pyrene multiple interactions ISO Tpi1 (Mus musculus) 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of TPI1 mRNA] CTD PMID:22228805 Tpi1 Rat benzo[a]pyrene increases methylation ISO TPI1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of TPI1 promoter CTD PMID:27901495 Tpi1 Rat benzo[a]pyrene increases expression ISO Tpi1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of TPI1 mRNA CTD PMID:20127859 and PMID:22228805 Tpi1 Rat bis(2-chloroethyl) sulfide affects expression EXP 6480464 Mustard Gas affects the expression of TPI1 mRNA CTD PMID:15651846 Tpi1 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Tpi1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of TPI1 mRNA CTD PMID:39150890 Tpi1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Tpi1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of TPI1 mRNA CTD PMID:33754040 Tpi1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TPI1 mRNA and bisphenol A results in increased expression of TPI1 protein CTD PMID:12075121 and PMID:32145629 Tpi1 Rat bisphenol A increases expression ISO TPI1 (Homo sapiens) 6480464 bisphenol A results in increased expression of TPI1 protein CTD PMID:37567409 Tpi1 Rat bisphenol A decreases expression ISO Tpi1 (Mus musculus) 6480464 bisphenol A results in decreased expression of TPI1 protein CTD PMID:35999755 Tpi1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of TPI1 mRNA CTD PMID:36041667 Tpi1 Rat bisphenol A decreases expression ISO TPI1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of TPI1 protein CTD PMID:37664457 Tpi1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TPI1 mRNA CTD PMID:32528016 and PMID:34947998 Tpi1 Rat bisphenol A affects expression ISO TPI1 (Homo sapiens) 6480464 bisphenol A affects the expression of TPI1 mRNA CTD PMID:30903817 Tpi1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of TPI1 mRNA CTD PMID:25181051 Tpi1 Rat bisphenol AF increases expression ISO TPI1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of TPI1 protein CTD PMID:34186270 Tpi1 Rat bisphenol F increases expression ISO Tpi1 (Mus musculus) 6480464 bisphenol F results in increased expression of TPI1 mRNA CTD PMID:38685157 Tpi1 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of TPI1 mRNA CTD PMID:36041667 Tpi1 Rat bortezomib increases expression ISO TPI1 (Homo sapiens) 6480464 Bortezomib results in increased expression of TPI1 mRNA CTD PMID:20977926 Tpi1 Rat bromobenzene affects binding EXP 6480464 bromobenzene metabolite binds to TPI1 protein CTD PMID:17305373 Tpi1 Rat bucladesine multiple interactions ISO TPI1 (Homo sapiens) 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in increased expression of TPI1 mRNA CTD PMID:20823114 Tpi1 Rat bufalin decreases expression ISO TPI1 (Homo sapiens) 6480464 bufalin results in decreased expression of TPI1 protein CTD PMID:23091618 Tpi1 Rat Butylbenzyl phthalate multiple interactions ISO Tpi1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of TPI1 mRNA CTD PMID:39150890 Tpi1 Rat cadmium acetate increases expression ISO TPI1 (Homo sapiens) 6480464 cadmium acetate results in increased expression of TPI1 mRNA CTD PMID:12965115 Tpi1 Rat cadmium atom increases oxidation ISO Tpi1 (Mus musculus) 6480464 Cadmium results in increased oxidation of TPI1 protein CTD PMID:24077948 Tpi1 Rat cadmium atom multiple interactions ISO TPI1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of TPI1 mRNA CTD PMID:35301059 Tpi1 Rat cadmium dichloride decreases expression ISO TPI1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of TPI1 protein CTD PMID:24419708 Tpi1 Rat cadmium dichloride multiple interactions ISO TPI1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of TPI1 mRNA CTD PMID:35301059 Tpi1 Rat cadmium dichloride increases expression ISO TPI1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of TPI1 protein CTD PMID:24527689 Tpi1 Rat caffeine decreases phosphorylation ISO TPI1 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of TPI1 protein CTD PMID:35688186 Tpi1 Rat capsaicin increases expression ISO TPI1 (Homo sapiens) 6480464 Capsaicin results in increased expression of TPI1 mRNA and Capsaicin results in increased expression of TPI1 protein CTD PMID:19891501 Tpi1 Rat captan increases expression ISO Tpi1 (Mus musculus) 6480464 Captan results in increased expression of TPI1 mRNA CTD PMID:31558096 Tpi1 Rat carbamazepine affects expression ISO TPI1 (Homo sapiens) 6480464 Carbamazepine affects the expression of TPI1 mRNA CTD PMID:25979313 Tpi1 Rat carbon dioxide increases expression EXP 6480464 Carbon Dioxide results in increased expression of TPI1 mRNA CTD PMID:14762718 Tpi1 Rat carbon nanotube increases expression ISO Tpi1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Tpi1 Rat casticin increases expression ISO Tpi1 (Mus musculus) 6480464 casticin results in increased expression of TPI1 mRNA CTD PMID:28444820 Tpi1 Rat ceruletide increases expression EXP 6480464 Ceruletide results in increased expression of TPI1 protein CTD PMID:18024178 Tpi1 Rat chloropicrin affects expression ISO TPI1 (Homo sapiens) 6480464 chloropicrin affects the expression of TPI1 mRNA CTD PMID:26352163 Tpi1 Rat chloropicrin decreases expression ISO TPI1 (Homo sapiens) 6480464 chloropicrin results in decreased expression of TPI1 mRNA CTD PMID:28476498 Tpi1 Rat chlorpyrifos increases expression ISO Tpi1 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of TPI1 mRNA CTD PMID:37019170 Tpi1 Rat cisplatin increases expression ISO TPI1 (Homo sapiens) 6480464 Cisplatin results in increased expression of TPI1 mRNA and Cisplatin results in increased expression of TPI1 protein CTD PMID:21924258 and PMID:27594783 Tpi1 Rat cisplatin affects response to substance ISO TPI1 (Homo sapiens) 6480464 TPI1 protein affects the susceptibility to Cisplatin CTD PMID:18309519 Tpi1 Rat clobetasol increases expression ISO Tpi1 (Mus musculus) 6480464 Clobetasol results in increased expression of TPI1 mRNA CTD PMID:27462272 Tpi1 Rat clofibrate increases expression EXP 6480464 Clofibrate results in increased expression of TPI1 mRNA CTD PMID:18670166 Tpi1 Rat clozapine increases expression EXP 6480464 Clozapine results in increased expression of TPI1 mRNA CTD PMID:15860345 Tpi1 Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of TPI1 mRNA CTD PMID:14762718 and PMID:24386269 Tpi1 Rat copper(II) sulfate decreases expression ISO TPI1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of TPI1 mRNA CTD PMID:19549813 Tpi1 Rat coumestrol multiple interactions ISO TPI1 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of TPI1 mRNA CTD PMID:19167446 Tpi1 Rat cyclosporin A decreases expression ISO TPI1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of TPI1 mRNA CTD PMID:20106945 more ... Tpi1 Rat deguelin decreases expression ISO TPI1 (Homo sapiens) 6480464 deguelin results in decreased expression of TPI1 mRNA CTD PMID:33512557 Tpi1 Rat desferrioxamine B increases expression EXP 6480464 Deferoxamine results in increased expression of TPI1 mRNA CTD PMID:14762718 Tpi1 Rat dexamethasone decreases expression ISO Tpi1 (Mus musculus) 6480464 Dexamethasone results in decreased expression of TPI1 protein CTD PMID:33567340 Tpi1 Rat dextran sulfate increases expression ISO Tpi1 (Mus musculus) 6480464 Dextran Sulfate results in increased expression of TPI1 mRNA CTD PMID:35093514 Tpi1 Rat dextran sulfate decreases expression ISO Tpi1 (Mus musculus) 6480464 Dextran Sulfate results in decreased expression of TPI1 protein CTD PMID:35999755 Tpi1 Rat diarsenic trioxide multiple interactions ISO TPI1 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to TPI1 protein] CTD PMID:26598702 Tpi1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of TPI1 mRNA CTD PMID:21266533 Tpi1 Rat dibutyl phthalate multiple interactions ISO Tpi1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of TPI1 mRNA CTD PMID:39150890 Tpi1 Rat dibutyl phthalate decreases expression ISO Tpi1 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of TPI1 mRNA CTD PMID:21266533 Tpi1 Rat diethyl phthalate multiple interactions ISO Tpi1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of TPI1 mRNA CTD PMID:39150890 Tpi1 Rat dihydroartemisinin affects binding ISO TPI1 (Homo sapiens) 6480464 artenimol analog binds to TPI1 protein CTD PMID:26340163 Tpi1 Rat dihydroxyacetone increases expression EXP 6480464 Dihydroxyacetone results in increased expression of TPI protein CTD PMID:38582340 Tpi1 Rat dihydroxyacetone phosphate affects metabolic processing EXP 6480464 TPI1 protein affects the metabolism of Dihydroxyacetone Phosphate CTD PMID:14762718 Tpi1 Rat diisobutyl phthalate multiple interactions ISO Tpi1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of TPI1 mRNA CTD PMID:39150890 Tpi1 Rat diisononyl phthalate multiple interactions ISO Tpi1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of TPI1 mRNA CTD PMID:39150890 Tpi1 Rat dinophysistoxin 1 increases expression ISO TPI1 (Homo sapiens) 6480464 dinophysistoxin 1 results in increased expression of TPI1 mRNA CTD PMID:28939011 Tpi1 Rat dioxygen increases expression ISO Tpi1 (Mus musculus) 6480464 Oxygen deficiency results in increased expression of TPI1 mRNA CTD PMID:20880076 Tpi1 Rat dioxygen multiple interactions ISO TPI1 (Homo sapiens) 6480464 [IL15 protein co-treated with Oxygen deficiency] results in increased expression of TPI1 mRNA CTD PMID:27129235 Tpi1 Rat dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate increases expression ISO TPI1 (Homo sapiens) 6480464 Antimony Potassium Tartrate results in increased expression of TPI1 mRNA CTD PMID:28713220 Tpi1 Rat dizocilpine maleate increases expression EXP 6480464 Dizocilpine Maleate results in increased expression of TPI1 protein CTD PMID:21297352 Tpi1 Rat dorsomorphin multiple interactions ISO TPI1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TPI1 mRNA CTD PMID:27188386 Tpi1 Rat doxorubicin affects response to substance ISO TPI1 (Homo sapiens) 6480464 TPI1 protein affects the susceptibility to Doxorubicin CTD PMID:18309519 Tpi1 Rat doxorubicin decreases expression ISO TPI1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of TPI1 mRNA CTD PMID:29803840 Tpi1 Rat elemental selenium increases expression ISO TPI1 (Homo sapiens) 6480464 Selenium results in increased expression of TPI1 mRNA CTD PMID:19244175 Tpi1 Rat Enterolactone multiple interactions ISO TPI1 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of TPI1 mRNA CTD PMID:19167446 Tpi1 Rat enzyme inhibitor multiple interactions ISO TPI1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of TPI1 protein CTD PMID:23301498 Tpi1 Rat ethanol increases expression ISO TPI1 (Homo sapiens) 6480464 Ethanol results in increased expression of TPI1 protein CTD PMID:20621659 Tpi1 Rat ethanol decreases expression ISO TPI1 (Homo sapiens) 6480464 Ethanol results in decreased expression of TPI1 mRNA CTD PMID:28986285 Tpi1 Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of TPI1 protein CTD PMID:23702218 Tpi1 Rat etoposide multiple interactions ISO TPI1 (Homo sapiens) 6480464 CDK2 affects the reaction [Etoposide results in increased phosphorylation of TPI1 protein] CTD PMID:20149834 Tpi1 Rat etoposide increases phosphorylation ISO TPI1 (Homo sapiens) 6480464 Etoposide results in increased phosphorylation of TPI1 protein CTD PMID:20149834 Tpi1 Rat fenthion decreases expression ISO Tpi1 (Mus musculus) 6480464 Fenthion results in decreased expression of TPI1 mRNA CTD PMID:34813904 Tpi1 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of TPI1 protein CTD PMID:17311803 Tpi1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of TPI1 mRNA CTD PMID:24136188 Tpi1 Rat folic acid multiple interactions ISO Tpi1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TPI1 mRNA CTD PMID:22206623 Tpi1 Rat folpet increases expression ISO Tpi1 (Mus musculus) 6480464 folpet results in increased expression of TPI1 mRNA CTD PMID:31558096 Tpi1 Rat FR900359 affects phosphorylation ISO TPI1 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of TPI1 protein CTD PMID:37730182 Tpi1 Rat furan affects binding EXP 6480464 furan binds to TPI1 protein CTD PMID:22240984 Tpi1 Rat furfural multiple interactions ISO TPI1 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Tpi1 Rat genistein increases expression EXP 6480464 Genistein results in increased expression of TPI1 mRNA CTD PMID:12075121 Tpi1 Rat haloperidol increases expression EXP 6480464 Haloperidol results in increased expression of TPI1 mRNA CTD PMID:15860345 Tpi1 Rat hydralazine multiple interactions ISO TPI1 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of TPI1 mRNA CTD PMID:17183730 Tpi1 Rat ibuprofen increases expression ISO TPI1 (Homo sapiens) 6480464 Ibuprofen results in increased expression of TPI1 mRNA CTD PMID:18351690 Tpi1 Rat ibuprofen affects expression ISO TPI1 (Homo sapiens) 6480464 Ibuprofen affects the expression of TPI1 protein CTD PMID:18351690 Tpi1 Rat indometacin decreases expression EXP 6480464 Indomethacin results in decreased expression of TPI1 mRNA CTD PMID:36868495 Tpi1 Rat ivermectin decreases expression ISO TPI1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of TPI1 protein CTD PMID:32959892 Tpi1 Rat lithium atom increases expression EXP 6480464 Lithium results in increased expression of TPI1 protein CTD PMID:18296634 Tpi1 Rat lithium hydride increases expression EXP 6480464 Lithium results in increased expression of TPI1 protein CTD PMID:18296634 Tpi1 Rat mancozeb increases expression ISO Tpi1 (Mus musculus) 6480464 mancozeb results in increased expression of TPI1 protein CTD PMID:21375462 Tpi1 Rat medroxyprogesterone acetate multiple interactions ISO TPI1 (Homo sapiens) 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in increased expression of TPI1 mRNA CTD PMID:20823114 Tpi1 Rat methamphetamine affects expression EXP 6480464 Methamphetamine affects the expression of TPI1 protein CTD PMID:19826936 Tpi1 Rat methidathion decreases expression ISO Tpi1 (Mus musculus) 6480464 methidathion results in decreased expression of TPI1 mRNA CTD PMID:34813904 Tpi1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of TPI1 mRNA CTD PMID:30047161 Tpi1 Rat methotrexate decreases expression ISO TPI1 (Homo sapiens) 6480464 Methotrexate results in decreased expression of TPI1 protein CTD PMID:24736981 Tpi1 Rat methylisothiazolinone increases expression ISO TPI1 (Homo sapiens) 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of TPI1 mRNA CTD PMID:31629900 Tpi1 Rat methylmercury chloride increases expression ISO TPI1 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of TPI1 mRNA CTD PMID:28001369 Tpi1 Rat microcystin-LR increases expression EXP 6480464 cyanoginosin LR results in increased expression of TPI1 protein CTD PMID:22430071 Tpi1 Rat N-methyl-4-phenylpyridinium decreases expression ISO Tpi1 (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of TPI1 mRNA CTD PMID:22776087 Tpi1 Rat N-nitrosodiethylamine multiple interactions ISO Tpi1 (Mus musculus) 6480464 [2 more ... CTD PMID:23457121 Tpi1 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of TPI1 mRNA CTD PMID:22110744 Tpi1 Rat nickel dichloride increases expression ISO Tpi1 (Mus musculus) 6480464 nickel chloride results in increased expression of TPI1 mRNA CTD PMID:12426141 more ... Tpi1 Rat nickel dichloride multiple interactions ISO Tpi1 (Mus musculus) 6480464 HIF1A affects the reaction [nickel chloride results in increased expression of TPI1 mRNA] CTD PMID:12426141 and PMID:12729255 Tpi1 Rat nickel subsulfide affects expression ISO Tpi1 (Mus musculus) 6480464 nickel subsulfide affects the expression of TPI1 mRNA CTD PMID:12729255 Tpi1 Rat nickel subsulfide increases expression EXP 6480464 nickel subsulfide results in increased expression of TPI1 mRNA CTD PMID:21086188 Tpi1 Rat niclosamide increases expression ISO TPI1 (Homo sapiens) 6480464 Niclosamide results in increased expression of TPI1 mRNA CTD PMID:22576131 Tpi1 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of TPI1 mRNA CTD PMID:24136188 Tpi1 Rat nitrates multiple interactions ISO Tpi1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of TPI1 mRNA CTD PMID:35964746 Tpi1 Rat olomoucine multiple interactions ISO TPI1 (Homo sapiens) 6480464 olomoucine inhibits the reaction [CDK2 protein results in increased phosphorylation of TPI1 protein] CTD PMID:20149834 Tpi1 Rat ouabain affects expression ISO TPI1 (Homo sapiens) 6480464 Ouabain affects the expression of TPI1 protein CTD PMID:17268060 Tpi1 Rat ozone multiple interactions ISO TPI1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of TPI1 mRNA more ... CTD PMID:32699268 and PMID:32845096 Tpi1 Rat ozone increases phosphorylation EXP 6480464 Ozone results in increased phosphorylation of TPI1 protein CTD PMID:33146391 Tpi1 Rat p-menthan-3-ol increases expression ISO TPI1 (Homo sapiens) 6480464 Menthol results in increased expression of TPI1 protein CTD PMID:26760959 Tpi1 Rat p-toluidine increases expression EXP 6480464 4-toluidine results in increased expression of TPI1 mRNA CTD PMID:27638505 Tpi1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of TPI1 protein CTD PMID:15800402 Tpi1 Rat paracetamol increases secretion ISO Tpi1 (Mus musculus) 6480464 Acetaminophen results in increased secretion of TPI1 protein CTD PMID:24038040 Tpi1 Rat paracetamol affects expression ISO Tpi1 (Mus musculus) 6480464 Acetaminophen affects the expression of TPI1 mRNA CTD PMID:17562736 Tpi1 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of TPI1 mRNA CTD PMID:32680482 Tpi1 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of TPI1 mRNA and [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of TPI1 mRNA CTD PMID:35163327 Tpi1 Rat phenylpropanolamine decreases expression ISO Tpi1 (Mus musculus) 6480464 Phenylpropanolamine results in decreased expression of TPI1 mRNA CTD PMID:16465460 Tpi1 Rat pioglitazone decreases expression ISO Tpi1 (Mus musculus) 6480464 pioglitazone results in decreased expression of TPI1 mRNA CTD PMID:20723549 Tpi1 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of TPI1 mRNA CTD PMID:16940010 Tpi1 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of TPI1 mRNA CTD PMID:30047161 Tpi1 Rat quartz decreases expression ISO TPI1 (Homo sapiens) 6480464 Quartz results in decreased expression of TPI1 protein CTD PMID:27917503 Tpi1 Rat quercetin increases expression ISO TPI1 (Homo sapiens) 6480464 Quercetin results in increased expression of TPI1 protein CTD PMID:14750173 and PMID:17292933 Tpi1 Rat quercetin decreases expression ISO TPI1 (Homo sapiens) 6480464 Quercetin results in decreased expression of TPI protein CTD PMID:15221776 Tpi1 Rat resveratrol increases expression ISO TPI1 (Homo sapiens) 6480464 resveratrol results in increased expression of TPI1 protein CTD PMID:23724044 Tpi1 Rat S-butyl-DL-homocysteine (S,R)-sulfoximine increases expression EXP 6480464 Buthionine Sulfoximine results in increased expression of TPI1 protein CTD PMID:23736079 Tpi1 Rat sarin affects expression EXP 6480464 Sarin affects the expression of TPI1 protein CTD PMID:28973502 Tpi1 Rat SB 431542 multiple interactions ISO TPI1 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Tpi1 Rat selenium atom increases expression ISO TPI1 (Homo sapiens) 6480464 Selenium results in increased expression of TPI1 mRNA CTD PMID:19244175 Tpi1 Rat silicon dioxide increases expression ISO TPI1 (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of TPI1 protein CTD PMID:27917503 Tpi1 Rat silicon dioxide increases secretion ISO TPI1 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased secretion of TPI1 protein CTD PMID:25895662 Tpi1 Rat sodium arsenite increases expression ISO TPI1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of TPI1 mRNA and sodium arsenite results in increased expression of TPI1 protein CTD PMID:15899475 more ... Tpi1 Rat sodium arsenite decreases expression ISO TPI1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of TPI1 mRNA CTD PMID:38568856 Tpi1 Rat sodium chloride multiple interactions ISO TPI1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of TPI1 protein more ... CTD PMID:38598786 Tpi1 Rat sodium dichromate increases expression ISO Tpi1 (Mus musculus) 6480464 sodium bichromate results in increased expression of TPI1 mRNA CTD PMID:31558096 Tpi1 Rat sodium fluoride increases expression ISO Tpi1 (Mus musculus) 6480464 Sodium Fluoride results in increased expression of TPI1 protein CTD PMID:27548804 Tpi1 Rat T-2 toxin affects expression EXP 6480464 T-2 Toxin affects the expression of TPI1 protein CTD PMID:26141394 Tpi1 Rat tamoxifen affects expression ISO Tpi1 (Mus musculus) 6480464 Tamoxifen affects the expression of TPI1 mRNA CTD PMID:17555576 Tpi1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of TPI1 mRNA] CTD PMID:31150632 Tpi1 Rat tetrachloromethane decreases expression ISO Tpi1 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of TPI1 mRNA CTD PMID:31919559 Tpi1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of TPI1 mRNA CTD PMID:31150632 Tpi1 Rat thapsigargin decreases expression ISO TPI1 (Homo sapiens) 6480464 Thapsigargin results in decreased expression of TPI1 mRNA CTD PMID:22378314 Tpi1 Rat thifluzamide decreases expression ISO TPI1 (Homo sapiens) 6480464 thifluzamide results in decreased expression of TPI1 mRNA CTD PMID:33512557 Tpi1 Rat thimerosal decreases expression ISO TPI1 (Homo sapiens) 6480464 Thimerosal results in decreased expression of TPI1 mRNA CTD PMID:27188386 Tpi1 Rat thiram decreases expression ISO TPI1 (Homo sapiens) 6480464 Thiram results in decreased expression of TPI1 mRNA CTD PMID:38568856 Tpi1 Rat toosendanin affects binding EXP 6480464 toosendanin metabolite binds to TPI1 protein CTD PMID:30848893 Tpi1 Rat toosendanin decreases activity EXP 6480464 toosendanin results in decreased activity of TPI1 protein CTD PMID:30848893 Tpi1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of TPI1 mRNA CTD PMID:14565619 Tpi1 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of TPI1 mRNA CTD PMID:33387578 Tpi1 Rat trimellitic anhydride increases expression ISO Tpi1 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of TPI1 mRNA CTD PMID:19042947 Tpi1 Rat triphenyl phosphate affects expression ISO TPI1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of TPI1 mRNA CTD PMID:37042841 Tpi1 Rat trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of TPI1 mRNA CTD PMID:24136188 Tpi1 Rat tunicamycin decreases expression ISO TPI1 (Homo sapiens) 6480464 Tunicamycin results in decreased expression of TPI1 mRNA CTD PMID:22378314 Tpi1 Rat undecane decreases expression EXP 6480464 undecane results in decreased expression of TPI1 protein CTD PMID:17337753 Tpi1 Rat valproic acid multiple interactions ISO TPI1 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of TPI1 mRNA more ... CTD PMID:17183730 and PMID:27188386 Tpi1 Rat valproic acid increases expression ISO TPI1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of TPI1 mRNA CTD PMID:23179753 more ... Tpi1 Rat valproic acid affects expression ISO TPI1 (Homo sapiens) 6480464 Valproic Acid affects the expression of TPI1 mRNA CTD PMID:25979313 Tpi1 Rat valproic acid affects expression ISO Tpi1 (Mus musculus) 6480464 Valproic Acid affects the expression of TPI1 mRNA CTD PMID:17963808 Tpi1 Rat vincristine affects response to substance ISO TPI1 (Homo sapiens) 6480464 TPI1 protein affects the susceptibility to Vincristine CTD PMID:18309519 Tpi1 Rat vitamin E increases expression ISO TPI1 (Homo sapiens) 6480464 Vitamin E results in increased expression of TPI1 mRNA CTD PMID:19244175 Tpi1 Rat vorinostat increases expression ISO TPI1 (Homo sapiens) 6480464 vorinostat results in increased expression of TPI mRNA and vorinostat results in increased expression of TPI protein CTD PMID:17593366 Tpi1 Rat Yessotoxin increases expression ISO TPI1 (Homo sapiens) 6480464 yessotoxin analog results in increased expression of TPI1 mRNA CTD PMID:30679557 Tpi1 Rat zearalenone decreases expression ISO Tpi1 (Mus musculus) 6480464 Zearalenone results in decreased expression of TPI1 protein CTD PMID:36252740 Tpi1 Rat zinc atom affects binding ISO TPI1 (Homo sapiens) 6480464 TPI1 protein binds to Zinc CTD PMID:14534351 Tpi1 Rat zinc(0) affects binding ISO TPI1 (Homo sapiens) 6480464 TPI1 protein binds to Zinc CTD PMID:14534351
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) 1,2,4-trimethylbenzene (EXP) 1,2-dimethylhydrazine (ISO) 1,3-dinitrobenzene (EXP) 1-bromopropane (EXP) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,5-hexanedione (EXP) 2,6-dimethoxyphenol (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxynon-2-enal (ISO) 4-hydroxyphenyl retinamide (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) acrolein (ISO) acrylamide (EXP) all-trans-retinoic acid (ISO) all-trans-retinol (EXP) alpha-naphthoflavone (ISO) alpha-pinene (ISO) alpha-Zearalanol (EXP) ammonium chloride (EXP) amphetamine (EXP) aristolochic acid A (ISO) arsane (EXP) arsenic atom (EXP) arsenite(3-) (ISO) arsenous acid (ISO) Azaspiracid (ISO) benzalkonium chloride (ISO) benzo[a]pyrene (ISO) bis(2-chloroethyl) sulfide (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (EXP,ISO) bortezomib (ISO) bromobenzene (EXP) bucladesine (ISO) bufalin (ISO) Butylbenzyl phthalate (ISO) cadmium acetate (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) capsaicin (ISO) captan (ISO) carbamazepine (ISO) carbon dioxide (EXP) carbon nanotube (ISO) casticin (ISO) ceruletide (EXP) chloropicrin (ISO) chlorpyrifos (ISO) cisplatin (ISO) clobetasol (ISO) clofibrate (EXP) clozapine (EXP) cobalt dichloride (EXP) copper(II) sulfate (ISO) coumestrol (ISO) cyclosporin A (ISO) deguelin (ISO) desferrioxamine B (EXP) dexamethasone (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) dibutyl phthalate (EXP,ISO) diethyl phthalate (ISO) dihydroartemisinin (ISO) dihydroxyacetone (EXP) dihydroxyacetone phosphate (EXP) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) dinophysistoxin 1 (ISO) dioxygen (ISO) dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO) dizocilpine maleate (EXP) dorsomorphin (ISO) doxorubicin (ISO) elemental selenium (ISO) Enterolactone (ISO) enzyme inhibitor (ISO) ethanol (EXP,ISO) etoposide (ISO) fenthion (ISO) flutamide (EXP) folic acid (ISO) folpet (ISO) FR900359 (ISO) furan (EXP) furfural (ISO) genistein (EXP) haloperidol (EXP) hydralazine (ISO) ibuprofen (ISO) indometacin (EXP) ivermectin (ISO) lithium atom (EXP) lithium hydride (EXP) mancozeb (ISO) medroxyprogesterone acetate (ISO) methamphetamine (EXP) methidathion (ISO) methimazole (EXP) methotrexate (ISO) methylisothiazolinone (ISO) methylmercury chloride (ISO) microcystin-LR (EXP) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (ISO) nickel dichloride (EXP,ISO) nickel subsulfide (EXP,ISO) niclosamide (ISO) nimesulide (EXP) nitrates (ISO) olomoucine (ISO) ouabain (ISO) ozone (EXP,ISO) p-menthan-3-ol (ISO) p-toluidine (EXP) paracetamol (EXP,ISO) paraquat (EXP) perfluorooctanoic acid (EXP) phenylpropanolamine (ISO) pioglitazone (ISO) pirinixic acid (EXP) pregnenolone 16alpha-carbonitrile (EXP) quartz (ISO) quercetin (ISO) resveratrol (ISO) S-butyl-DL-homocysteine (S,R)-sulfoximine (EXP) sarin (EXP) SB 431542 (ISO) selenium atom (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium chloride (ISO) sodium dichromate (ISO) sodium fluoride (ISO) T-2 toxin (EXP) tamoxifen (ISO) tetrachloromethane (EXP,ISO) thapsigargin (ISO) thifluzamide (ISO) thimerosal (ISO) thiram (ISO) toosendanin (EXP) trichloroethene (EXP) trimellitic anhydride (ISO) triphenyl phosphate (ISO) trovafloxacin (EXP) tunicamycin (ISO) undecane (EXP) valproic acid (ISO) vincristine (ISO) vitamin E (ISO) vorinostat (ISO) Yessotoxin (ISO) zearalenone (ISO) zinc atom (ISO) zinc(0) (ISO)
1.
Evidence for founder effect of the Glu104Asp substitution and identification of new mutations in triosephosphate isomerase deficiency.
Arya R, etal., Hum Mutat. 1997;10(4):290-4.
2.
Key enzymes of carbohydrate metabolism as targets of the 11.5-kDa Zn(2+)-binding protein (parathymosin).
Brand IA and Heinickel A, J Biol Chem. 1991 Nov 5;266(31):20984-9.
3.
The glycolytic enzymes, glyceraldehyde-3-phosphate dehydrogenase, triose-phosphate isomerase, and pyruvate kinase are components of the K(ATP) channel macromolecular complex and regulate its function.
Dhar-Chowdhury P, etal., J Biol Chem. 2005 Nov 18;280(46):38464-70. Epub 2005 Sep 16.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
6.
Differences in expression of retinal proteins between diabetic and normal rats.
Liu SQ, etal., World J Gastroenterol. 2007 Apr 14;13(14):2118-24.
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
Proteomic analysis of rat retina in a steroid-induced ocular hypertension model: potential vulnerability to oxidative stress.
Miyara N, etal., Jpn J Ophthalmol. 2008 Mar-Apr;52(2):84-90. Epub 2008 Apr 30.
9.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
11.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
12.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
13.
GOA pipeline
RGD automated data pipeline
14.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
15.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
16.
Information Derived from GenBank Report
RGD, Sept. 2003
17.
Proteomics profiling of nuclear proteins for kidney fibroblasts suggests hypoxia, meiosis, and cancer may meet in the nucleus.
Shakib K, etal., Proteomics. 2005 Jul;5(11):2819-38.
18.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Tpi1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 159,301,558 - 159,305,088 (-) NCBI GRCr8 mRatBN7.2 4 157,615,283 - 157,618,813 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 157,615,386 - 157,619,541 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 163,843,450 - 163,846,958 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 159,626,360 - 159,629,868 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 158,261,966 - 158,265,490 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 157,328,375 - 157,331,905 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_5.0 4 224,345,971 - 224,349,501 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 160,933,341 - 160,936,871 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 161,178,382 - 161,181,807 (-) NCBI Celera 4 146,353,273 - 146,356,791 (-) NCBI Celera Cytogenetic Map 4 q42 NCBI
TPI1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 6,867,420 - 6,870,948 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 6,867,119 - 6,870,948 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 6,976,584 - 6,980,112 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 6,846,967 - 6,850,253 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 6,846,966 - 6,850,253 NCBI Celera 12 8,593,870 - 8,597,397 (+) NCBI Celera Cytogenetic Map 12 p13.31 NCBI HuRef 12 6,830,312 - 6,833,839 (+) NCBI HuRef CHM1_1 12 6,975,582 - 6,979,109 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 6,876,717 - 6,880,246 (+) NCBI T2T-CHM13v2.0
Tpi1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 124,787,549 - 124,791,121 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 124,787,549 - 124,791,259 (-) Ensembl GRCm39 Ensembl GRCm38 6 124,810,586 - 124,814,158 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 124,810,586 - 124,814,296 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 124,760,610 - 124,764,314 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 124,776,334 - 124,780,031 (-) NCBI MGSCv36 mm8 Celera 6 126,486,721 - 126,490,425 (-) NCBI Celera Cytogenetic Map 6 F2 NCBI cM Map 6 59.17 NCBI
Tpi1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955413 4,467,566 - 4,471,177 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955413 4,467,615 - 4,471,594 (+) NCBI ChiLan1.0 ChiLan1.0
TPI1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 12,430,570 - 12,434,002 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 12,427,328 - 12,430,760 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 6,999,275 - 7,002,678 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 6,910,819 - 6,914,056 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 6,910,813 - 6,913,612 (+) Ensembl panpan1.1 panPan2
TPI1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 27 38,154,519 - 38,157,900 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 27 38,154,519 - 38,158,137 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 27 8,458,847 - 8,462,228 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 27 38,507,407 - 38,510,797 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 27 38,507,407 - 38,510,859 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 27 38,381,481 - 38,384,861 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 27 38,422,508 - 38,425,888 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 27 7,937,580 - 7,940,961 (+) NCBI UU_Cfam_GSD_1.0
Tpi1
TPI1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 63,838,506 - 63,843,134 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 63,839,473 - 63,842,853 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 66,274,980 - 66,278,361 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TPI1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 6,900,762 - 6,904,188 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 6,900,787 - 6,906,787 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666063 1,319,371 - 1,323,379 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tpi1
.
Predicted Target Of
Count of predictions: 135 Count of miRNA genes: 107 Interacting mature miRNAs: 114 Transcripts: ENSRNOT00000020647 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
6478754 Anxrr43 Anxiety related response QTL 43 0.14035 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 144639524 182687754 Rat 724558 Plsm2 Polydactyly-luxate syndrome (PLS) morphotypes QTL 2 0.0003 hindlimb integrity trait (VT:0010563) hind foot phalanges count (CMO:0001949) 4 132422778 177422778 Rat 1582237 Kidm34 Kidney mass QTL 34 4 0.0001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 4 148090542 168069246 Rat 6478693 Anxrr32 Anxiety related response QTL 32 0.00092 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957) 4 144639524 182687754 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 631683 Bp116 Blood pressure QTL 116 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 124303370 169303370 Rat 61451 Ciaa4 CIA Autoantibody QTL 4 3.1 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 4 126395976 167139601 Rat 1331738 Bp209 Blood pressure QTL 209 2.979 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 138503169 179293946 Rat 6478700 Anxrr33 Anxiety related response QTL 33 0.00896 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 1298524 Oia8 Oil induced arthritis QTL 8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 138503169 173369699 Rat 10053718 Scort25 Serum corticosterone level QTL 25 2.15 0.0097 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 155561574 182687754 Rat 1549827 Scl46 Serum cholesterol level QTL 46 3.5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 4 132396220 177396220 Rat 634335 Anxrr16 Anxiety related response QTL 16 7.22 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 93308457 167139447 Rat 737821 Hcar9 Hepatocarcinoma resistance QTL 9 3.7 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 109866907 167139601 Rat 7411558 Bw133 Body weight QTL 133 13.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 125590636 170590636 Rat 6478778 Anxrr51 Anxiety related response QTL 51 0.25384 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957) 4 124778595 169778595 Rat 10401796 Kidm48 Kidney mass QTL 48 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 4 145568712 182687754 Rat 6478718 Anxrr34 Anxiety related response QTL 34 0.00896 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 631511 Pia7 Pristane induced arthritis QTL 7 4.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 131730738 167139601 Rat 1581574 Eae20 Experimental allergic encephalomyelitis QTL 20 7.8 nervous system integrity trait (VT:0010566) percentage of study population developing experimental autoimmune encephalomyelitis during a period of time (CMO:0001047) 4 153031106 158841762 Rat 634347 Hcar8 Hepatocarcinoma resistance QTL 8 5.8 liver integrity trait (VT:0010547) liver tumorous lesion area to total liver area ratio (CMO:0001075) 4 123143783 168143783 Rat 1576316 Ept5 Estrogen-induced pituitary tumorigenesis QTL 5 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 4 83428419 177635233 Rat 2303623 Vencon2 Ventilatory control QTL 2 3.8 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 4 135204660 180204660 Rat 1578674 Bmd12 Bone mineral density QTL 12 3.8 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 4 135699135 180699135 Rat 1358202 Gluco11 Glucose level QTL 11 2.4 0.02 adipocyte glucose uptake trait (VT:0004185) absolute change in adipocyte glucose uptake (CMO:0000873) 4 85379421 167139601 Rat 61422 Cia13 Collagen induced arthritis QTL 13 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 132642577 167139601 Rat 634342 Cia24 Collagen induced arthritis QTL 24 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 146565735 175236377 Rat 737978 Pia23 Pristane induced arthritis QTL 23 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 131730738 167139601 Rat 61362 Oia2 Oil induced arthritis QTL 2 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 138503169 173369699 Rat 12798519 Anxrr54 Anxiety related response QTL 54 2.54 0.05 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 114627026 159627026 Rat 2293659 Bmd35 Bone mineral density QTL 35 4.5 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 4 137755016 181392681 Rat 1331759 Hrtrt13 Heart rate QTL 13 3.54628 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 110275411 168266883 Rat 724535 Cm18 Cardiac mass QTL 18 2.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 4 118856416 163856416 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 6478748 Anxrr42 Anxiety related response QTL 42 0.28008 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 12798525 Anxrr57 Anxiety related response QTL 57 3.21 0.05 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 147278504 167139601 Rat
RH94523
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 4 q42 UniSTS
RH129184
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 4 q42 UniSTS
AI411387
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 157,619,843 - 157,620,056 (-) MAPPER mRatBN7.2 mRatBN7.2 4 157,619,843 - 157,620,056 (+) MAPPER mRatBN7.2 Rnor_6.0 4 157,332,936 - 157,333,148 NCBI Rnor6.0 Rnor_6.0 9 20,212,509 - 20,212,721 NCBI Rnor6.0 Rnor_5.0 4 224,350,532 - 224,350,744 UniSTS Rnor5.0 Rnor_5.0 9 19,088,485 - 19,088,697 UniSTS Rnor5.0 RGSC_v3.4 4 160,937,902 - 160,938,114 UniSTS RGSC3.4 Celera 4 146,357,822 - 146,358,034 UniSTS RH 3.4 Map 4 1005.8 UniSTS Cytogenetic Map 4 q42 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
18
22
98
221
173
174
113
46
113
12
423
186
185
90
115
61
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000020647 ⟹ ENSRNOP00000020647
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 157,615,386 - 157,619,050 (-) Ensembl Rnor_6.0 Ensembl 4 157,328,379 - 157,331,905 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000071439 ⟹ ENSRNOP00000067409
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 157,615,386 - 157,618,825 (-) Ensembl Rnor_6.0 Ensembl 9 20,213,776 - 20,216,608 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000089341 ⟹ ENSRNOP00000069904
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 9 20,213,588 - 20,217,176 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000117284 ⟹ ENSRNOP00000088185
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 157,615,386 - 157,619,541 (-) Ensembl
RefSeq Acc Id:
NM_022922 ⟹ NP_075211
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 159,301,558 - 159,305,088 (-) NCBI mRatBN7.2 4 157,615,283 - 157,618,813 (-) NCBI Rnor_6.0 4 157,328,375 - 157,331,905 (-) NCBI Rnor_5.0 4 224,345,971 - 224,349,501 (-) NCBI RGSC_v3.4 4 160,933,341 - 160,936,871 (-) RGD Celera 4 146,353,273 - 146,356,791 (-) RGD
Sequence:
CTTCAGAGAGTTGATCCTTGTGCAATGGCGCCTTCCAGGAAGTTCTTCGTCGGGGGCAACTGGAAGATGAACGGGAGGAAGAAATGCCTGGGAGAACTCATCTGCACTCTGAACGCAGCCAAGCTGCC
hide sequence
RefSeq Acc Id:
NP_075211 ⟸ NM_022922
- UniProtKB:
A0JN18 (UniProtKB/Swiss-Prot), Q6P793 (UniProtKB/Swiss-Prot), P48500 (UniProtKB/Swiss-Prot), A0A8L2R053 (UniProtKB/TrEMBL)
- Sequence:
MAPSRKFFVGGNWKMNGRKKCLGELICTLNAAKLPADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGEISPGMIKDLGATWVVLGHSERRHIFGESDELIGQKVNHALSEGLGVIACI
hide sequence
Ensembl Acc Id:
ENSRNOP00000020647 ⟸ ENSRNOT00000020647
Ensembl Acc Id:
ENSRNOP00000067409 ⟸ ENSRNOT00000071439
Ensembl Acc Id:
ENSRNOP00000069904 ⟸ ENSRNOT00000089341
Ensembl Acc Id:
ENSRNOP00000088185 ⟸ ENSRNOT00000117284
RGD ID: 13693390 Promoter ID: EPDNEW_R3915 Type: multiple initiation site Name: Tpi1_1 Description: triosephosphate isomerase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 157,331,917 - 157,331,977 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Tpi1
triosephosphate isomerase 1
LOC100911515
triosephosphate isomerase-like
Data merged from RGD:6492323
737654 PROVISIONAL
2012-07-05
LOC100911515
triosephosphate isomerase-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2003-04-09
Tpi1
triosephosphate isomerase 1
Triosephosphate isomerase 1
Name updated
629478 APPROVED
2002-06-10
Tpi1
Triosephosphate isomerase 1
Symbol and Name status set to approved
70586 APPROVED
