Symbol:
Palld
Name:
palladin, cytoskeletal associated protein
RGD ID:
2322545
Description:
Enables cytoskeletal protein binding activity. Involved in several processes, including plasma membrane bounded cell projection organization; positive regulation of podosome assembly; and trophoblast giant cell differentiation. Located in several cellular components, including Z disc; actin cytoskeleton; and axonal growth cone. Human ortholog(s) of this gene implicated in pancreatic cancer. Orthologous to human PALLD (palladin, cytoskeletal associated protein); INTERACTS WITH 1,3-dinitrobenzene; 2,3,7,8-tetrachlorodibenzodioxine; atrazine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
AABR07025295.1; LOC100360205; LOC103693936; LOC290704; palladin; palladin-like; palladin-like 1; Palldl1; similar to palladin
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PALLD (palladin, cytoskeletal associated protein) HGNC
Ensembl, HomoloGene, OrthoDB, Panther
Mus musculus (house mouse):
Palld (palladin, cytoskeletal associated protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PALLD (palladin, cytoskeletal associated protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PALLD (palladin, cytoskeletal associated protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Palld (palladin, cytoskeletal associated protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PALLD (palladin, cytoskeletal associated protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PALLD (palladin, cytoskeletal associated protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Palld (palladin, cytoskeletal associated protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Palld (palladin, cytoskeletal associated protein)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PALLD (palladin, cytoskeletal associated protein)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
palld (palladin, cytoskeletal associated protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 33,238,943 - 33,632,236 (+) NCBI GRCr8 mRatBN7.2 16 28,228,006 - 28,621,349 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 27,981,354 - 28,621,337 (+) Ensembl mRatBN7.2 Ensembl Rnor_6.0 16 31,865,712 - 31,948,168 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 31,734,944 - 31,946,242 (+) NCBI Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 31,401,114 - 31,786,201 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 31,854,459 - 31,933,792 NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 16 28,535,132 - 28,616,857 (+) NCBI Celera Cytogenetic Map 16 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Palld Rat 1,3-dinitrobenzene increases expression EXP 6480464 3-dinitrobenzene results in increased expression of PALLD mRNA CTD PMID:21983209 Palld Rat 17beta-estradiol increases expression ISO PALLD (Homo sapiens) 6480464 Estradiol results in increased expression of PALLD mRNA CTD PMID:20106945 more ... Palld Rat 17beta-estradiol increases expression ISO Palld (Mus musculus) 6480464 Estradiol results in increased expression of PALLD mRNA CTD PMID:39298647 Palld Rat 17beta-estradiol multiple interactions ISO PALLD (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of PALLD mRNA CTD PMID:30165855 Palld Rat 17beta-estradiol decreases expression ISO PALLD (Homo sapiens) 6480464 Estradiol results in decreased expression of PALLD mRNA CTD PMID:19167446 Palld Rat 17beta-estradiol affects expression ISO PALLD (Homo sapiens) 6480464 Estradiol affects the expression of PALLD mRNA CTD PMID:14699072 and PMID:22574217 Palld Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO PALLD (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of PALLD mRNA CTD PMID:29581250 Palld Rat 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO Palld (Mus musculus) 6480464 [Flame Retardants results in increased abundance of 2 more ... CTD PMID:38995820 Palld Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Palld (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PALLD mRNA CTD PMID:19770486 Palld Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Palld (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PALLD mRNA CTD PMID:21570461 and PMID:26377647 Palld Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO PALLD (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of PALLD mRNA CTD PMID:26238291 Palld Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PALLD mRNA CTD PMID:23238561 Palld Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Palld (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PALLD mRNA CTD PMID:23238561 Palld Rat 2,6-dimethoxyphenol multiple interactions ISO PALLD (Homo sapiens) 6480464 [pyrogallol 1 and 3-dimethyl ether co-treated with Furaldehyde] results in decreased expression of and affects the localization of PALLD protein CTD PMID:38598786 Palld Rat 2-butoxyethanol increases expression ISO Palld (Mus musculus) 6480464 n-butoxyethanol results in increased expression of PALLD mRNA CTD PMID:19812364 Palld Rat 2-butoxyethanol decreases expression ISO Palld (Mus musculus) 6480464 n-butoxyethanol results in decreased expression of PALLD mRNA CTD PMID:19812364 Palld Rat 4,4'-sulfonyldiphenol increases expression ISO Palld (Mus musculus) 6480464 bisphenol S results in increased expression of PALLD mRNA CTD PMID:39298647 Palld Rat 4,4'-sulfonyldiphenol affects methylation ISO Palld (Mus musculus) 6480464 bisphenol S affects the methylation of PALLD gene CTD PMID:31683443 Palld Rat 4-hydroxyphenyl retinamide decreases expression ISO Palld (Mus musculus) 6480464 Fenretinide results in decreased expression of PALLD mRNA CTD PMID:28973697 Palld Rat 5-aza-2'-deoxycytidine affects expression ISO PALLD (Homo sapiens) 6480464 Decitabine affects the expression of PALLD mRNA CTD PMID:23300844 Palld Rat aflatoxin B1 affects expression ISO PALLD (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of PALLD protein CTD PMID:20106945 Palld Rat aflatoxin B1 decreases methylation ISO PALLD (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of PALLD gene CTD PMID:27153756 Palld Rat aflatoxin B1 increases expression ISO PALLD (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of PALLD mRNA CTD PMID:21632981 more ... Palld Rat all-trans-retinoic acid decreases expression ISO PALLD (Homo sapiens) 6480464 Tretinoin results in decreased expression of PALLD mRNA CTD PMID:21934132 Palld Rat all-trans-retinoic acid increases expression ISO PALLD (Homo sapiens) 6480464 Tretinoin results in increased expression of PALLD mRNA CTD PMID:16054129 more ... Palld Rat antirheumatic drug increases expression ISO PALLD (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of PALLD mRNA CTD PMID:24449571 Palld Rat aristolochic acid A decreases expression ISO PALLD (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of PALLD mRNA CTD PMID:33212167 Palld Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of PALLD gene CTD PMID:35440735 Palld Rat azathioprine increases expression ISO PALLD (Homo sapiens) 6480464 Azathioprine results in increased expression of PALLD mRNA CTD PMID:22623647 Palld Rat benzo[a]pyrene decreases expression ISO Palld (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of PALLD mRNA CTD PMID:19770486 Palld Rat benzo[a]pyrene decreases methylation ISO PALLD (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of PALLD promoter CTD PMID:27901495 Palld Rat benzo[a]pyrene affects methylation ISO PALLD (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PALLD 5' UTR and Benzo(a)pyrene affects the methylation of PALLD exon CTD PMID:27901495 and PMID:30157460 Palld Rat benzo[a]pyrene increases methylation ISO Palld (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of PALLD intron CTD PMID:27901495 Palld Rat benzo[a]pyrene increases expression ISO PALLD (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of PALLD mRNA CTD PMID:20106945 more ... Palld Rat benzo[a]pyrene decreases expression ISO PALLD (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PALLD protein CTD PMID:32717239 Palld Rat benzo[a]pyrene diol epoxide I decreases expression ISO PALLD (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Palld Rat benzo[b]fluoranthene decreases expression ISO Palld (Mus musculus) 6480464 benzo(b)fluoranthene results in decreased expression of PALLD mRNA CTD PMID:26377693 Palld Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PALLD mRNA CTD PMID:25181051 Palld Rat bisphenol A increases expression ISO PALLD (Homo sapiens) 6480464 bisphenol A results in increased expression of PALLD protein CTD PMID:37567409 Palld Rat bisphenol A multiple interactions ISO PALLD (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of PALLD gene CTD PMID:31601247 Palld Rat bisphenol A increases expression ISO Palld (Mus musculus) 6480464 bisphenol A results in increased expression of PALLD mRNA CTD PMID:32156529 and PMID:33221593 Palld Rat bisphenol A affects expression ISO PALLD (Homo sapiens) 6480464 bisphenol A affects the expression of PALLD mRNA CTD PMID:30903817 Palld Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PALLD mRNA CTD PMID:30816183 more ... Palld Rat Bisphenol B increases expression ISO PALLD (Homo sapiens) 6480464 bisphenol B results in increased expression of PALLD protein CTD PMID:34186270 Palld Rat bisphenol F increases expression ISO PALLD (Homo sapiens) 6480464 bisphenol F results in increased expression of PALLD protein CTD PMID:34186270 Palld Rat bortezomib increases expression ISO PALLD (Homo sapiens) 6480464 Bortezomib results in increased expression of PALLD mRNA CTD PMID:20977926 Palld Rat calcitriol decreases expression ISO PALLD (Homo sapiens) 6480464 Calcitriol results in decreased expression of PALLD mRNA CTD PMID:16002434 Palld Rat cannabidiol decreases expression ISO PALLD (Homo sapiens) 6480464 Cannabidiol results in decreased expression of PALLD mRNA CTD PMID:33244087 Palld Rat carbon nanotube decreases expression ISO Palld (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of PALLD mRNA CTD PMID:25554681 Palld Rat CGP 52608 multiple interactions ISO PALLD (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to PALLD gene] CTD PMID:28238834 Palld Rat chloropicrin affects expression ISO PALLD (Homo sapiens) 6480464 chloropicrin affects the expression of PALLD mRNA CTD PMID:26352163 Palld Rat choline multiple interactions ISO Palld (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of PALLD mRNA CTD PMID:20938992 Palld Rat cisplatin affects expression ISO PALLD (Homo sapiens) 6480464 Cisplatin affects the expression of PALLD mRNA CTD PMID:23300844 Palld Rat copper atom multiple interactions ISO PALLD (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of PALLD mRNA CTD PMID:20971185 Palld Rat copper atom multiple interactions ISO Palld (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression of PALLD mRNA CTD PMID:15467011 Palld Rat copper(0) multiple interactions ISO PALLD (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of PALLD mRNA CTD PMID:20971185 Palld Rat copper(0) multiple interactions ISO Palld (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression of PALLD mRNA CTD PMID:15467011 Palld Rat copper(II) chloride increases expression ISO PALLD (Homo sapiens) 6480464 cupric chloride results in increased expression of PALLD mRNA CTD PMID:17211630 Palld Rat copper(II) sulfate increases expression ISO PALLD (Homo sapiens) 6480464 Copper Sulfate results in increased expression of PALLD mRNA CTD PMID:19549813 Palld Rat coumarin affects phosphorylation ISO PALLD (Homo sapiens) 6480464 coumarin affects the phosphorylation of PALLD protein CTD PMID:35688186 Palld Rat cyclosporin A increases expression ISO Palld (Mus musculus) 6480464 Cyclosporine results in increased expression of PALLD mRNA CTD PMID:19770486 Palld Rat cyclosporin A increases expression ISO PALLD (Homo sapiens) 6480464 Cyclosporine results in increased expression of PALLD mRNA CTD PMID:20106945 more ... Palld Rat DDE decreases expression ISO PALLD (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of PALLD mRNA CTD PMID:38568856 Palld Rat deoxynivalenol affects phosphorylation ISO Palld (Mus musculus) 6480464 deoxynivalenol affects the phosphorylation of PALLD protein CTD PMID:23811945 Palld Rat dexamethasone increases expression ISO PALLD (Homo sapiens) 6480464 Dexamethasone results in increased expression of PALLD mRNA CTD PMID:25047013 Palld Rat Dibutyl phosphate affects expression ISO PALLD (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PALLD mRNA CTD PMID:37042841 Palld Rat dorsomorphin multiple interactions ISO PALLD (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Palld Rat doxorubicin decreases expression ISO Palld (Mus musculus) 6480464 Doxorubicin results in decreased expression of PALLD mRNA CTD PMID:19277126 Palld Rat elemental selenium decreases expression ISO PALLD (Homo sapiens) 6480464 Selenium results in decreased expression of PALLD mRNA CTD PMID:19244175 Palld Rat entinostat decreases expression ISO PALLD (Homo sapiens) 6480464 entinostat results in decreased expression of PALLD mRNA CTD PMID:26272509 Palld Rat entinostat multiple interactions ISO PALLD (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PALLD mRNA CTD PMID:27188386 Palld Rat entinostat increases expression ISO PALLD (Homo sapiens) 6480464 entinostat results in increased expression of PALLD mRNA CTD PMID:27188386 Palld Rat ethanol increases expression ISO Palld (Mus musculus) 6480464 Ethanol results in increased expression of PALLD mRNA CTD PMID:30319688 Palld Rat fenamidone increases expression ISO Palld (Mus musculus) 6480464 fenamidone results in increased expression of PALLD mRNA CTD PMID:27029645 Palld Rat folic acid multiple interactions ISO Palld (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of PALLD mRNA CTD PMID:20938992 Palld Rat folic acid decreases expression ISO Palld (Mus musculus) 6480464 Folic Acid results in decreased expression of PALLD mRNA CTD PMID:25629700 Palld Rat FR900359 decreases phosphorylation ISO PALLD (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of PALLD protein CTD PMID:37730182 Palld Rat fulvestrant multiple interactions ISO PALLD (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of PALLD gene CTD PMID:31601247 Palld Rat furfural multiple interactions ISO PALLD (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Palld Rat hydrogen peroxide affects expression ISO PALLD (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of PALLD mRNA CTD PMID:23410634 Palld Rat isoprenaline decreases expression ISO Palld (Mus musculus) 6480464 Isoproterenol results in decreased expression of PALLD mRNA CTD PMID:20003209 Palld Rat ketoconazole decreases expression ISO Palld (Mus musculus) 6480464 Ketoconazole results in decreased expression of PALLD mRNA CTD PMID:31099283 Palld Rat L-glutamic acid increases expression EXP 6480464 Glutamic Acid results in increased expression of PALLD mRNA CTD PMID:25797319 Palld Rat L-methionine multiple interactions ISO Palld (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of PALLD mRNA CTD PMID:20938992 Palld Rat leflunomide increases expression ISO PALLD (Homo sapiens) 6480464 leflunomide results in increased expression of PALLD mRNA CTD PMID:28988120 Palld Rat menadione affects expression ISO PALLD (Homo sapiens) 6480464 Vitamin K 3 affects the expression of PALLD mRNA CTD PMID:23410634 Palld Rat mercury dibromide increases expression ISO PALLD (Homo sapiens) 6480464 mercuric bromide results in increased expression of PALLD mRNA CTD PMID:26272509 Palld Rat mercury dibromide multiple interactions ISO PALLD (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PALLD mRNA CTD PMID:27188386 Palld Rat methamphetamine increases expression ISO Palld (Mus musculus) 6480464 Methamphetamine results in increased expression of PALLD mRNA CTD PMID:26307267 Palld Rat methotrexate increases expression ISO PALLD (Homo sapiens) 6480464 Methotrexate results in increased expression of PALLD mRNA CTD PMID:24449571 Palld Rat methyl methanesulfonate increases expression ISO PALLD (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of PALLD mRNA CTD PMID:23649840 Palld Rat methylmercury chloride increases expression ISO PALLD (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of PALLD mRNA CTD PMID:23179753 more ... Palld Rat methylmercury chloride multiple interactions ISO PALLD (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PALLD mRNA CTD PMID:27188386 Palld Rat nickel sulfate decreases expression ISO PALLD (Homo sapiens) 6480464 nickel sulfate results in decreased expression of PALLD mRNA CTD PMID:22714537 Palld Rat p-chloromercuribenzoic acid increases expression ISO PALLD (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in increased expression of PALLD mRNA CTD PMID:26272509 Palld Rat p-chloromercuribenzoic acid multiple interactions ISO PALLD (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PALLD mRNA CTD PMID:27188386 Palld Rat paracetamol affects expression ISO Palld (Mus musculus) 6480464 Acetaminophen affects the expression of PALLD mRNA CTD PMID:17562736 Palld Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of PALLD mRNA CTD PMID:32680482 Palld Rat phenylmercury acetate increases expression ISO PALLD (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of PALLD mRNA CTD PMID:26272509 Palld Rat phenylmercury acetate multiple interactions ISO PALLD (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PALLD mRNA CTD PMID:27188386 Palld Rat pirinixic acid decreases expression ISO Palld (Mus musculus) 6480464 pirinixic acid results in decreased expression of PALLD mRNA CTD PMID:17426115 Palld Rat pirinixic acid increases expression ISO Palld (Mus musculus) 6480464 pirinixic acid results in increased expression of PALLD mRNA CTD PMID:18301758 Palld Rat piroxicam decreases expression ISO PALLD (Homo sapiens) 6480464 Piroxicam results in decreased expression of PALLD mRNA CTD PMID:21858171 Palld Rat potassium chromate decreases expression ISO PALLD (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of PALLD mRNA CTD PMID:22714537 Palld Rat propanal decreases expression ISO PALLD (Homo sapiens) 6480464 propionaldehyde results in decreased expression of PALLD mRNA CTD PMID:26079696 Palld Rat propiconazole increases expression ISO Palld (Mus musculus) 6480464 propiconazole results in increased expression of PALLD mRNA CTD PMID:21278054 Palld Rat quercetin increases expression ISO PALLD (Homo sapiens) 6480464 Quercetin results in increased expression of PALLD mRNA CTD PMID:21632981 Palld Rat quinolin-8-ol increases expression ISO PALLD (Homo sapiens) 6480464 Oxyquinoline results in increased expression of PALLD mRNA CTD PMID:21632981 Palld Rat raloxifene affects expression ISO PALLD (Homo sapiens) 6480464 Raloxifene Hydrochloride affects the expression of PALLD mRNA CTD PMID:14699072 Palld Rat SB 431542 multiple interactions ISO PALLD (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Palld Rat selenium atom decreases expression ISO PALLD (Homo sapiens) 6480464 Selenium results in decreased expression of PALLD mRNA CTD PMID:19244175 Palld Rat silver atom increases expression ISO PALLD (Homo sapiens) 6480464 Silver results in increased expression of PALLD mRNA CTD PMID:26014281 Palld Rat silver(0) increases expression ISO PALLD (Homo sapiens) 6480464 Silver results in increased expression of PALLD mRNA CTD PMID:26014281 Palld Rat sodium arsenite increases expression ISO PALLD (Homo sapiens) 6480464 sodium arsenite results in increased expression of PALLD mRNA CTD PMID:38568856 Palld Rat sodium arsenite decreases expression ISO PALLD (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PALLD mRNA CTD PMID:34032870 Palld Rat sodium chloride multiple interactions ISO PALLD (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of PALLD protein CTD PMID:38598786 Palld Rat sunitinib decreases expression ISO PALLD (Homo sapiens) 6480464 Sunitinib results in decreased expression of PALLD mRNA CTD PMID:31533062 Palld Rat tamoxifen affects expression ISO PALLD (Homo sapiens) 6480464 Tamoxifen affects the expression of PALLD mRNA CTD PMID:14699072 Palld Rat tamoxifen increases expression ISO Palld (Mus musculus) 6480464 Tamoxifen results in increased expression of PALLD mRNA CTD PMID:17555576 Palld Rat tebuconazole decreases expression ISO PALLD (Homo sapiens) 6480464 tebuconazole results in decreased expression of PALLD mRNA CTD PMID:30458266 Palld Rat tert-butyl hydroperoxide affects expression ISO PALLD (Homo sapiens) 6480464 tert-Butylhydroperoxide affects the expression of PALLD mRNA CTD PMID:23410634 Palld Rat testosterone enanthate affects expression ISO PALLD (Homo sapiens) 6480464 testosterone enanthate affects the expression of PALLD mRNA CTD PMID:17440010 Palld Rat tetrachloromethane increases expression ISO Palld (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of PALLD mRNA CTD PMID:31919559 Palld Rat tetrahydropalmatine decreases expression ISO PALLD (Homo sapiens) 6480464 tetrahydropalmatine results in decreased expression of PALLD protein CTD PMID:20109541 Palld Rat tetraphene decreases expression ISO Palld (Mus musculus) 6480464 benz(a)anthracene results in decreased expression of PALLD mRNA CTD PMID:26377693 Palld Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of PALLD protein CTD PMID:35544339 Palld Rat thiram increases expression ISO PALLD (Homo sapiens) 6480464 Thiram results in increased expression of PALLD mRNA CTD PMID:38568856 Palld Rat titanium dioxide increases expression ISO Palld (Mus musculus) 6480464 titanium dioxide results in increased expression of PALLD mRNA CTD PMID:29264374 Palld Rat titanium dioxide increases methylation ISO Palld (Mus musculus) 6480464 titanium dioxide results in increased methylation of PALLD gene CTD PMID:35295148 Palld Rat torcetrapib increases expression ISO PALLD (Homo sapiens) 6480464 torcetrapib results in increased expression of PALLD mRNA CTD PMID:23228038 Palld Rat trichloroethene decreases phosphorylation ISO PALLD (Homo sapiens) 6480464 Trichloroethylene results in decreased phosphorylation of PALLD protein CTD PMID:26018768 Palld Rat trichostatin A decreases expression ISO PALLD (Homo sapiens) 6480464 trichostatin A results in decreased expression of PALLD mRNA CTD PMID:26272509 Palld Rat trichostatin A affects expression ISO PALLD (Homo sapiens) 6480464 trichostatin A affects the expression of PALLD mRNA CTD PMID:28542535 Palld Rat trichostatin A multiple interactions ISO PALLD (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PALLD mRNA CTD PMID:27188386 Palld Rat triphenyl phosphate affects expression ISO PALLD (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PALLD mRNA CTD PMID:37042841 Palld Rat triptonide decreases expression ISO Palld (Mus musculus) 6480464 triptonide results in decreased expression of PALLD mRNA CTD PMID:33045310 Palld Rat valproic acid affects expression ISO PALLD (Homo sapiens) 6480464 Valproic Acid affects the expression of PALLD mRNA CTD PMID:25979313 Palld Rat valproic acid increases expression ISO PALLD (Homo sapiens) 6480464 Valproic Acid results in increased expression of PALLD mRNA CTD PMID:19101580 more ... Palld Rat vorinostat decreases expression ISO PALLD (Homo sapiens) 6480464 vorinostat results in decreased expression of PALLD mRNA CTD PMID:27188386
1,3-dinitrobenzene (EXP) 17beta-estradiol (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dimethoxyphenol (ISO) 2-butoxyethanol (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) atrazine (EXP) azathioprine (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[b]fluoranthene (ISO) bisphenol A (EXP,ISO) Bisphenol B (ISO) bisphenol F (ISO) bortezomib (ISO) calcitriol (ISO) cannabidiol (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chloropicrin (ISO) choline (ISO) cisplatin (ISO) copper atom (ISO) copper(0) (ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) coumarin (ISO) cyclosporin A (ISO) DDE (ISO) deoxynivalenol (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) dorsomorphin (ISO) doxorubicin (ISO) elemental selenium (ISO) entinostat (ISO) ethanol (ISO) fenamidone (ISO) folic acid (ISO) FR900359 (ISO) fulvestrant (ISO) furfural (ISO) hydrogen peroxide (ISO) isoprenaline (ISO) ketoconazole (ISO) L-glutamic acid (EXP) L-methionine (ISO) leflunomide (ISO) menadione (ISO) mercury dibromide (ISO) methamphetamine (ISO) methotrexate (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) nickel sulfate (ISO) p-chloromercuribenzoic acid (ISO) paracetamol (ISO) paraquat (EXP) phenylmercury acetate (ISO) pirinixic acid (ISO) piroxicam (ISO) potassium chromate (ISO) propanal (ISO) propiconazole (ISO) quercetin (ISO) quinolin-8-ol (ISO) raloxifene (ISO) SB 431542 (ISO) selenium atom (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sodium chloride (ISO) sunitinib (ISO) tamoxifen (ISO) tebuconazole (ISO) tert-butyl hydroperoxide (ISO) testosterone enanthate (ISO) tetrachloromethane (ISO) tetrahydropalmatine (ISO) tetraphene (ISO) thapsigargin (EXP) thiram (ISO) titanium dioxide (ISO) torcetrapib (ISO) trichloroethene (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) triptonide (ISO) valproic acid (ISO) vorinostat (ISO)
Cellular Component
actin cytoskeleton (IEA,ISO) actin filament (IEA,ISO) anchoring junction (IEA) axon (IDA,IEA) axonal growth cone (IDA) cell projection (IEA) cytoplasm (IEA) cytoskeleton (IDA,IEA,ISO) cytosol (IEA,ISO) excitatory synapse (IDA) filopodium (IDA) focal adhesion (IEA,ISO) growth cone (IDA,IEA) lamellipodium (IEA,ISO) mitochondrion (IEA,ISO) neuronal cell body (IDA) nucleus (IEA,ISO) plasma membrane (IEA,ISO) podosome (IDA,IEA) ruffle (IDA,IEA) stress fiber (IDA,IEA,IMP,ISO) Z disc (IDA,IEA,ISO)
1.
A role for the cytoskeleton-associated protein palladin in neurite outgrowth.
Boukhelifa M, etal., Mol Biol Cell. 2001 Sep;12(9):2721-9. doi: 10.1091/mbc.12.9.2721.
2.
A critical role for palladin in astrocyte morphology and response to injury.
Boukhelifa M, etal., Mol Cell Neurosci. 2003 Aug;23(4):661-8.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Palladin binds to Eps8 and enhances the formation of dorsal ruffles and podosomes in vascular smooth muscle cells.
Goicoechea S, etal., J Cell Sci. 2006 Aug 15;119(Pt 16):3316-24. Epub 2006 Jul 25.
5.
Isoform-specific upregulation of palladin in human and murine pancreas tumors.
Goicoechea SM, etal., PLoS One. 2010 Apr 26;5(4):e10347.
6.
Hypoxia inhibits differentiation of lineage-specific Rcho-1 trophoblast giant cells.
Gultice AD, etal., Biol Reprod. 2006 Jun;74(6):1041-50. Epub 2006 Feb 15.
7.
Palladin is expressed preferentially in excitatory terminals in the rat central nervous system.
Hwang SJ, etal., J Comp Neurol. 2001 Jul 23;436(2):211-24.
8.
CLP36 and RIL recruit a-actinin-1 to stress fibers and differentially regulate stress fiber dynamics in F2408 fibroblasts.
Miyazaki K, etal., Exp Cell Res. 2012 Aug 15;318(14):1716-25. doi: 10.1016/j.yexcr.2012.05.006. Epub 2012 May 30.
9.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
10.
Palladin mutation causes familial pancreatic cancer and suggests a new cancer mechanism.
Pogue-Geile KL, etal., PLoS Med. 2006 Dec;3(12):e516.
11.
Palladin is a regulator of actin filament bundles at the ectoplasmic specialization in adult rat testes.
Qian X, etal., Endocrinology. 2013 May;154(5):1907-20. doi: 10.1210/en.2012-2269. Epub 2013 Apr 1.
12.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
14.
Comprehensive gene review and curation
RGD comprehensive gene curation
15.
Isoform-specific regulation of the actin-organizing protein palladin during TGF-beta1-induced myofibroblast differentiation.
Ronty MJ, etal., J Invest Dermatol. 2006 Nov;126(11):2387-96. Epub 2006 Jun 22.
16.
Involvement of palladin and alpha-actinin in targeting of the Abl/Arg kinase adaptor ArgBP2 to the actin cytoskeleton.
Rönty M, etal., Exp Cell Res. 2005 Oct 15;310(1):88-98. doi: 10.1016/j.yexcr.2005.06.026.
17.
Palladin is overexpressed in the non-neoplastic stroma of infiltrating ductal adenocarcinomas of the pancreas, but is only rarely overexpressed in neoplastic cells.
Salaria SN, etal., Cancer Biol Ther. 2007 Mar;6(3):324-8. Epub 2007 Mar 24.
Palld Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 33,238,943 - 33,632,236 (+) NCBI GRCr8 mRatBN7.2 16 28,228,006 - 28,621,349 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 27,981,354 - 28,621,337 (+) Ensembl mRatBN7.2 Ensembl Rnor_6.0 16 31,865,712 - 31,948,168 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 31,734,944 - 31,946,242 (+) NCBI Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 31,401,114 - 31,786,201 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 31,854,459 - 31,933,792 NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 16 28,535,132 - 28,616,857 (+) NCBI Celera Cytogenetic Map 16 p12 NCBI
PALLD Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 168,497,052 - 168,928,441 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 168,497,052 - 168,928,457 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 169,418,203 - 169,849,592 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 169,654,792 - 170,086,183 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 4 166,748,020 - 167,180,983 (+) NCBI Celera Cytogenetic Map 4 q32.3 NCBI HuRef 4 165,170,970 - 165,603,126 (+) NCBI HuRef CHM1_1 4 169,394,774 - 169,826,047 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 171,856,045 - 172,287,862 (+) NCBI T2T-CHM13v2.0
Palld Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 61,964,465 - 62,355,741 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 61,964,467 - 62,355,724 (-) Ensembl GRCm39 Ensembl GRCm38 8 61,511,431 - 61,902,707 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 61,511,433 - 61,902,690 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 63,993,818 - 64,381,487 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 64,403,398 - 64,794,832 (-) NCBI MGSCv36 mm8 Celera 8 64,078,203 - 64,475,199 (-) NCBI Celera Cytogenetic Map 8 B3.1 NCBI cM Map 8 31.23 NCBI
PALLD Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 166,273,693 - 166,697,100 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 166,787,075 - 167,052,445 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 160,718,475 - 161,140,436 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 173,120,958 - 173,216,409 (+) NCBI panpan1.1 PanPan1.1 panPan2
PALLD Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 25 19,147,310 - 19,568,712 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 25 19,146,898 - 19,553,679 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 25 19,178,454 - 19,599,760 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 25 19,285,396 - 19,694,065 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 25 19,285,412 - 19,694,079 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 25 19,146,258 - 19,574,549 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 25 19,153,183 - 19,562,304 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 25 19,215,651 - 19,637,403 (+) NCBI UU_Cfam_GSD_1.0
Palld Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404943 20,372,101 - 20,739,513 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936516 802,484 - 1,151,801 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936516 786,358 - 1,151,910 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PALLD Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 20,678,452 - 21,020,125 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 20,678,456 - 21,020,125 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 21,965,285 - 22,200,581 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PALLD
Palld
.
Predicted Target Of
Count of predictions: 391 Count of miRNA genes: 192 Interacting mature miRNAs: 211 Transcripts: ENSRNOT00000013636, ENSRNOT00000059673, ENSRNOT00000064850, ENSRNOT00000066265 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
631561 Hcuc2 Hepatic copper content QTL 2 2.8 liver copper amount (VT:0003065) liver total copper weight (CMO:0001507) 16 1 39533949 Rat 70215 Niddm29 Non-insulin dependent diabetes mellitus QTL 29 3.54 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 16 19004435 75226532 Rat 2307172 Activ4 Activity QTL 4 3.71 0.00023 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 16 1 33418960 Rat 2302057 Pia29 Pristane induced arthritis QTL 29 3.6 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111) 16 21735975 66735975 Rat 1354584 Despr6 Despair related QTL 6 3.1 0.0067 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 16 1 39533930 Rat 2302380 Slep6 Serum leptin concentration QTL 6 3.36 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 1 32139025 Rat 737819 Hcas4 Hepatocarcinoma susceptibility QTL 4 4.43 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 16 4227609 46975965 Rat 9590151 Scort8 Serum corticosterone level QTL 8 8.45 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 16 1 30836262 Rat 1354625 Despr7 Despair related QTL 7 3.16 0.016 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 16 1 44977551 Rat 6903294 Stl30 Serum triglyceride level QTL 30 2.6 0.0013 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 16 25152793 70152793 Rat 61338 Bp23 Blood pressure QTL 23 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 16 4227609 49227609 Rat 61405 Niddm6 Non-insulin dependent diabetes mellitus QTL 6 3.66 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 16 4227609 48972724 Rat 7411664 Foco30 Food consumption QTL 30 11 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 16 1 44588133 Rat 1600378 Arunc4 Aerobic running capacity QTL 4 0.03 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 16 380245 80345693 Rat 70183 BpQTLcluster13 Blood pressure QTL cluster 13 3.654 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 16 4227609 43025077 Rat 737826 Alc11 Alcohol consumption QTL 11 3.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 16 4227609 60252231 Rat 2303566 Bw90 Body weight QTL 90 2 body mass (VT:0001259) body weight (CMO:0000012) 16 1 39533930 Rat 8694453 Bw172 Body weight QTL 172 8.33 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 16 24325513 69325513 Rat 2312663 Slep9 Serum leptin concentration QTL 9 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 832236 59492508 Rat 2306902 Bp339 Blood pressure QTL 339 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 16 3380150 43025077 Rat 2312660 Bw95 Body weight QTL 95 0.05 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 16 832236 59492508 Rat 2312666 Insul16 Insulin level QTL 16 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 16 832236 59492508 Rat 70205 Gcr3 Gastric cancer resistance QTL 3 2.3 stomach morphology trait (VT:0000470) stomach tumor diameter (CMO:0001889) 16 17696791 82635055 Rat 2293343 Glom16 Glomerulus QTL 16 7.4 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 16 832236 46053497 Rat 6903319 Bw114 Body weight QTL 114 2.7 0.0037 body mass (VT:0001259) body weight (CMO:0000012) 16 1 43534949 Rat 2312669 Stl23 Serum triglyceride level QTL 23 0.01 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 16 832236 59492508 Rat
D16Rat18
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 16 33,565,275 - 33,565,431 (+) Marker Load Pipeline mRatBN7.2 16 28,554,370 - 28,554,528 (+) MAPPER mRatBN7.2 Rnor_6.0 16 31,881,203 - 31,881,358 NCBI Rnor6.0 Rnor_5.0 16 31,720,124 - 31,720,279 UniSTS Rnor5.0 RGSC_v3.4 16 31,868,072 - 31,868,228 RGD RGSC3.4 RGSC_v3.4 16 31,868,073 - 31,868,228 UniSTS RGSC3.4 RGSC_v3.1 16 31,867,979 - 31,868,331 RGD Celera 16 28,549,531 - 28,549,686 UniSTS RH 2.0 Map 16 362.8 RGD FHH x ACI Map 16 20.0199 RGD
D16Mco10
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 16 33,583,698 - 33,584,066 (+) Marker Load Pipeline mRatBN7.2 16 28,572,799 - 28,573,169 (+) MAPPER mRatBN7.2 Rnor_6.0 16 31,899,635 - 31,900,002 NCBI Rnor6.0 Rnor_5.0 16 31,738,901 - 31,739,268 UniSTS Rnor5.0 RGSC_v3.4 16 31,886,283 - 31,886,651 RGD RGSC3.4 RGSC_v3.4 16 31,886,284 - 31,886,651 UniSTS RGSC3.4 RGSC_v3.1 16 31,886,358 - 31,886,726 RGD Celera 16 28,568,309 - 28,568,676 UniSTS Cytogenetic Map 16 RGD
RH143884
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 28,620,160 - 28,620,310 (+) MAPPER mRatBN7.2 Rnor_6.0 16 31,946,985 - 31,947,134 NCBI Rnor6.0 Rnor_5.0 16 31,785,018 - 31,785,167 UniSTS Rnor5.0 RGSC_v3.4 16 31,933,337 - 31,933,486 UniSTS RGSC3.4 Celera 16 28,615,674 - 28,615,823 UniSTS
AU046415
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 28,493,639 - 28,493,872 (+) MAPPER mRatBN7.2 Rnor_6.0 16 31,817,845 - 31,818,077 NCBI Rnor6.0 Rnor_5.0 16 31,659,302 - 31,659,534 UniSTS Rnor5.0 RGSC_v3.4 16 31,808,078 - 31,808,310 UniSTS RGSC3.4 Celera 16 28,489,214 - 28,489,446 UniSTS
GDB:187424
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 28,291,913 - 28,293,343 (+) MAPPER mRatBN7.2 Rnor_6.0 16 31,606,413 - 31,607,842 NCBI Rnor6.0 Rnor_5.0 16 31,455,054 - 31,456,483 UniSTS Rnor5.0 Celera 16 28,287,265 - 28,288,694 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSRNOT00000059673 ⟹ ENSRNOP00000056425
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 28,418,961 - 28,621,337 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000064850 ⟹ ENSRNOP00000084755
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 27,981,354 - 28,022,515 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000067450 ⟹ ENSRNOP00000086932
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 27,999,122 - 28,022,526 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000095888 ⟹ ENSRNOP00000080820
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 28,228,014 - 28,621,337 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000111769 ⟹ ENSRNOP00000091553
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 27,999,196 - 28,620,047 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000113224 ⟹ ENSRNOP00000090355
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 27,999,196 - 28,621,337 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000113275 ⟹ ENSRNOP00000093125
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 27,999,122 - 28,006,116 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000116705 ⟹ ENSRNOP00000088354
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 28,540,427 - 28,621,070 (+) Ensembl
RefSeq Acc Id:
XM_008771231 ⟹ XP_008769453
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 33,551,169 - 33,632,236 (+) NCBI mRatBN7.2 16 28,539,993 - 28,621,349 (+) NCBI Rnor_6.0 16 31,865,714 - 31,948,168 (+) NCBI
Sequence:
TTTTTAAAAACCTAAAAACTTAATTATGGAATCAACGTGTCTTATTCCTTCCTTTAAAACACTTCACGAGGAAAATTCTCACATAGATGTTTTAAGTGACTGAAGTCCTCCAGTAGTTTATGACGGAA
hide sequence
RefSeq Acc Id:
XM_008771232 ⟹ XP_008769454
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 33,551,183 - 33,632,236 (+) NCBI mRatBN7.2 16 28,539,997 - 28,621,349 (+) NCBI Rnor_6.0 16 31,865,715 - 31,948,168 (+) NCBI
Sequence:
TTTTAAAAACCTAAAAACTTAATTATGGAATCAACGTGTCTTATTCCTTCCTTTAAAACACTTCACGAGGAAAATTCTCACATAGATGTTTTAAGTGACTGAAGTCCTCCAGTAGTTTATGACGGAAG
hide sequence
RefSeq Acc Id:
XM_039094914 ⟹ XP_038950842
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 33,238,944 - 33,632,236 (+) NCBI mRatBN7.2 16 28,228,007 - 28,621,349 (+) NCBI
RefSeq Acc Id:
XM_039094915 ⟹ XP_038950843
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 33,238,944 - 33,632,236 (+) NCBI mRatBN7.2 16 28,228,008 - 28,621,349 (+) NCBI
RefSeq Acc Id:
XM_039094916 ⟹ XP_038950844
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 33,238,943 - 33,630,272 (+) NCBI mRatBN7.2 16 28,228,006 - 28,619,384 (+) NCBI
RefSeq Acc Id:
XM_039094917 ⟹ XP_038950845
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 33,380,774 - 33,632,236 (+) NCBI mRatBN7.2 16 28,369,849 - 28,621,349 (+) NCBI
RefSeq Acc Id:
XP_008769453 ⟸ XM_008771231
- Peptide Label:
isoform X5
- Sequence:
MSALASRSTAMQSSGSFNYARPKQFIAAQNLGPASGLPTPTSSPSSSSLPSPLSPTPRPFGRAPGPPFVEPEAMWGPSSPSPPPPPPPVFSPSTAFPVPDVFPLPPPPPPLPSSTSHCASPARFSPGQ
hide sequence
RefSeq Acc Id:
XP_008769454 ⟸ XM_008771232
- Peptide Label:
isoform X6
- Sequence:
MSALASRSTAMQSSGSFNYARPKQFIAAQNLGPASGLPTPTSSPSSSSLPSPLSPTPRPFGRAP
hide sequence
RefSeq Acc Id:
XP_038950844 ⟸ XM_039094916
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_038950842 ⟸ XM_039094914
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_038950843 ⟸ XM_039094915
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6ADH4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038950845 ⟸ XM_039094917
- Peptide Label:
isoform X4
- UniProtKB:
F1M265 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000088354 ⟸ ENSRNOT00000116705
Ensembl Acc Id:
ENSRNOP00000091553 ⟸ ENSRNOT00000111769
Ensembl Acc Id:
ENSRNOP00000080820 ⟸ ENSRNOT00000095888
Ensembl Acc Id:
ENSRNOP00000084755 ⟸ ENSRNOT00000064850
Ensembl Acc Id:
ENSRNOP00000093125 ⟸ ENSRNOT00000113275
Ensembl Acc Id:
ENSRNOP00000090355 ⟸ ENSRNOT00000113224
Ensembl Acc Id:
ENSRNOP00000086932 ⟸ ENSRNOT00000067450
Ensembl Acc Id:
ENSRNOP00000056425 ⟸ ENSRNOT00000059673
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2022-06-02
Palld
palladin, cytoskeletal associated protein
AABR07025295.1
Data merged from RGD:15003360
737654 PROVISIONAL
2021-09-02
AABR07025295.1
Palldl1
palladin-like 1
Symbol and/or name change
19259462 PROVISIONAL
2021-08-09
Palldl1
palladin-like 1
AABR07025295.1
Symbol and/or name change
19259462 PROVISIONAL
2021-03-09
Palld
palladin, cytoskeletal associated protein
LOC103693936
palladin-like
Data merged from RGD:9212281
737654 PROVISIONAL
2019-11-08
AABR07025295.1
Symbol and Name status set to provisional
45752 PROVISIONAL
2014-08-25
LOC103693936
palladin-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2013-08-01
LOC100360205
palladin
LOC290704
similar to palladin
Data merged from RGD:1588598
737654 APPROVED
2013-08-01
Palld
palladin, cytoskeletal associated protein
LOC100360205
palladin
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2010-05-06
LOC100360205
palladin
Symbol and Name status set to provisional
70820 PROVISIONAL
2006-11-19
LOC290704
similar to palladin
Symbol and Name status set to provisional
70820 PROVISIONAL
