Symbol:
Slc7a14
Name:
solute carrier family 7, member 14
RGD ID:
1594375
Description:
Predicted to enable gamma-aminobutyric acid transmembrane transporter activity. Predicted to be involved in gamma-aminobutyric acid import. Predicted to be located in cytosol; lysosomal membrane; and nucleoplasm. Predicted to be active in plasma membrane. Human ortholog(s) of this gene implicated in retinitis pigmentosa 68. Orthologous to human SLC7A14 (solute carrier family 7 member 14); INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-Tetrachlorodibenzofuran; 3,7-dihydropurine-6-thione.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
hypothetical protein LOC499587; LOC499587; LOC681347; probable cationic amino acid transporter; similar to solute carrier family 7, member 14; solute carrier family 7 (cationic amino acid transporter, y+ system), member 14; solute carrier family 7 (orphan transporter), member 14; solute carrier family 7 member 14
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SLC7A14 (solute carrier family 7 member 14) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther
Mus musculus (house mouse):
Slc7a14 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Slc7a14 (solute carrier family 7 member 14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SLC7A14 (solute carrier family 7 member 14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SLC7A14 (solute carrier family 7 member 14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Slc7a14 (solute carrier family 7 member 14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SLC7A14 (solute carrier family 7 member 14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SLC7A14 (solute carrier family 7 member 14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Slc7a14 (solute carrier family 7 member 14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
SLC7A14 (solute carrier family 7 member 14)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Slc7a14 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 14)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
slc7a14a (solute carrier family 7 member 14a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG12531
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
BAP3
Alliance
DIOPT (Ensembl Compara|InParanoid)
Saccharomyces cerevisiae (baker's yeast):
GNP1
Alliance
DIOPT (Ensembl Compara|InParanoid)
Saccharomyces cerevisiae (baker's yeast):
MMP1
Alliance
DIOPT (Ensembl Compara|InParanoid)
Saccharomyces cerevisiae (baker's yeast):
AGP3
Alliance
DIOPT (Ensembl Compara|InParanoid)
Saccharomyces cerevisiae (baker's yeast):
GAP1
Alliance
DIOPT (Ensembl Compara|InParanoid)
Saccharomyces cerevisiae (baker's yeast):
AGP1
Alliance
DIOPT (Ensembl Compara|InParanoid)
Saccharomyces cerevisiae (baker's yeast):
AGP2
Alliance
DIOPT (Ensembl Compara|InParanoid)
Saccharomyces cerevisiae (baker's yeast):
ALP1
Alliance
DIOPT (Ensembl Compara|InParanoid)
Saccharomyces cerevisiae (baker's yeast):
BAP2
Alliance
DIOPT (Ensembl Compara|InParanoid)
Saccharomyces cerevisiae (baker's yeast):
CAN1
Alliance
DIOPT (Ensembl Compara|InParanoid)
Saccharomyces cerevisiae (baker's yeast):
DIP5
Alliance
DIOPT (Ensembl Compara|InParanoid)
Saccharomyces cerevisiae (baker's yeast):
PUT4
Alliance
DIOPT (Ensembl Compara|InParanoid)
Saccharomyces cerevisiae (baker's yeast):
SAM3
Alliance
DIOPT (Ensembl Compara|InParanoid)
Xenopus tropicalis (tropical clawed frog):
slc7a14
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 113,993,781 - 114,099,810 (+) NCBI GRCr8 mRatBN7.2 2 112,065,286 - 112,171,319 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 112,065,286 - 112,171,313 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 118,713,850 - 118,819,501 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 116,826,419 - 116,932,057 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 111,535,164 - 111,641,542 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 115,678,344 - 115,788,688 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 115,678,344 - 115,788,687 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 135,373,151 - 135,484,827 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 116,462,113 - 116,579,876 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 2 107,253,260 - 107,359,313 (+) NCBI Celera Cytogenetic Map 2 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Slc7a14 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of SLC7A14 mRNA CTD PMID:29097150 Slc7a14 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2,3,7,8-tetrachlorodibenzofuran results in decreased expression of SLC7A14 mRNA CTD PMID:32109520 Slc7a14 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression ISO RGD:1605648 6480464 2,2',4,4',5-brominated diphenyl ether results in increased expression of SLC7A14 mRNA CTD PMID:26705709 Slc7a14 Rat 3,7-dihydropurine-6-thione decreases expression EXP 6480464 Mercaptopurine results in decreased expression of SLC7A14 mRNA CTD PMID:23358152 Slc7a14 Rat 3-iodothyronamine affects uptake ISO RGD:1605648 6480464 SLC7A14 mRNA affects the uptake of 3-iodothyronamine CTD PMID:19074582 Slc7a14 Rat 5-aza-2'-deoxycytidine affects expression ISO RGD:1605648 6480464 Decitabine affects the expression of SLC7A14 mRNA CTD PMID:23300844 Slc7a14 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of SLC7A14 mRNA CTD PMID:30047161 Slc7a14 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of SLC7A14 mRNA CTD PMID:28959563 Slc7a14 Rat aflatoxin B1 decreases methylation ISO RGD:1605648 6480464 Aflatoxin B1 results in decreased methylation of SLC7A14 gene CTD PMID:27153756 Slc7a14 Rat all-trans-retinoic acid increases expression ISO RGD:1605648 6480464 Tretinoin results in increased expression of SLC7A14 mRNA CTD PMID:23724009 Slc7a14 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of SLC7A14 mRNA CTD PMID:30047161 Slc7a14 Rat arsane affects methylation ISO RGD:1605648 6480464 Arsenic affects the methylation of SLC7A14 gene CTD PMID:25304211 Slc7a14 Rat arsenic atom affects methylation ISO RGD:1605648 6480464 Arsenic affects the methylation of SLC7A14 gene CTD PMID:25304211 Slc7a14 Rat arsenous acid increases expression ISO RGD:1605648 6480464 Arsenic Trioxide results in increased expression of SLC7A14 mRNA CTD PMID:20458559 Slc7a14 Rat atrazine increases expression ISO RGD:1605648 6480464 Atrazine results in increased expression of SLC7A14 mRNA CTD PMID:22378314 Slc7a14 Rat benzo[a]pyrene affects methylation ISO RGD:1605648 6480464 Benzo(a)pyrene affects the methylation of SLC7A14 5' UTR; Benzo(a)pyrene affects the methylation of SLC7A14 promoter CTD PMID:27901495 Slc7a14 Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:1605648 6480464 Diethylhexyl Phthalate results in decreased expression of SLC7A14 mRNA CTD PMID:31163220 Slc7a14 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of SLC7A14 mRNA CTD PMID:25181051 Slc7a14 Rat bisphenol A decreases expression ISO RGD:1622922 6480464 bisphenol A results in decreased expression of SLC7A14 mRNA CTD PMID:32156529 Slc7a14 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SLC7A14 mRNA CTD PMID:34947998 Slc7a14 Rat bisphenol A increases expression ISO RGD:1605648 6480464 bisphenol A results in increased expression of SLC7A14 mRNA CTD PMID:29275510 Slc7a14 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of SLC7A14 mRNA CTD PMID:33453195 Slc7a14 Rat cadmium dichloride decreases expression ISO RGD:1605648 6480464 Cadmium Chloride results in decreased expression of SLC7A14 mRNA CTD PMID:26472689 Slc7a14 Rat CGP 52608 multiple interactions ISO RGD:1605648 6480464 CGP 52608 promotes the reaction [RORA protein binds to SLC7A14 gene] CTD PMID:28238834 Slc7a14 Rat cisplatin affects expression ISO RGD:1605648 6480464 Cisplatin affects the expression of SLC7A14 mRNA CTD PMID:23300844 Slc7a14 Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of SLC7A14 mRNA CTD PMID:26033743 Slc7a14 Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of SLC7A14 mRNA CTD PMID:26033743 Slc7a14 Rat diarsenic trioxide increases expression ISO RGD:1605648 6480464 Arsenic Trioxide results in increased expression of SLC7A14 mRNA CTD PMID:20458559 Slc7a14 Rat ethanol increases expression ISO RGD:1622922 6480464 Ethanol results in increased expression of SLC7A14 mRNA CTD PMID:30319688 Slc7a14 Rat genistein decreases expression ISO RGD:1622922 6480464 Genistein results in decreased expression of SLC7A14 mRNA CTD PMID:32186404 Slc7a14 Rat indole-3-methanol multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of SLC7A14 mRNA CTD PMID:22129741 Slc7a14 Rat lead(0) affects expression ISO RGD:1605648 6480464 Lead affects the expression of SLC7A14 mRNA CTD PMID:28903495 Slc7a14 Rat mercaptopurine decreases expression EXP 6480464 Mercaptopurine results in decreased expression of SLC7A14 mRNA CTD PMID:23358152 Slc7a14 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of SLC7A14 mRNA CTD PMID:30047161 Slc7a14 Rat N-acetyl-L-cysteine multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of SLC7A14 mRNA CTD PMID:22129741 Slc7a14 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of SLC7A14 mRNA CTD PMID:22129741 Slc7a14 Rat ozone multiple interactions ISO RGD:1622922 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ... CTD PMID:34911549 Slc7a14 Rat perfluorohexanesulfonic acid increases expression ISO RGD:1622922 6480464 perfluorohexanesulfonic acid results in increased expression of SLC7A14 mRNA CTD PMID:37995155 Slc7a14 Rat purine-6-thiol decreases expression EXP 6480464 Mercaptopurine results in decreased expression of SLC7A14 mRNA CTD PMID:23358152 Slc7a14 Rat serpentine asbestos increases methylation ISO RGD:1605648 6480464 Asbestos, Serpentine results in increased methylation of SLC7A14 gene CTD PMID:29523930 Slc7a14 Rat sodium arsenite decreases expression ISO RGD:1622922 6480464 sodium arsenite results in decreased expression of SLC7A14 mRNA CTD PMID:37682722 Slc7a14 Rat sodium arsenite decreases expression ISO RGD:1605648 6480464 sodium arsenite results in decreased expression of SLC7A14 mRNA CTD PMID:35954277 Slc7a14 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of SLC7A14 mRNA CTD PMID:30047161 Slc7a14 Rat titanium dioxide decreases methylation ISO RGD:1622922 6480464 titanium dioxide results in decreased methylation of SLC7A14 gene CTD PMID:35295148 Slc7a14 Rat triptonide increases expression ISO RGD:1622922 6480464 triptonide results in increased expression of SLC7A14 mRNA CTD PMID:33045310 Slc7a14 Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of SLC7A14 mRNA CTD PMID:29427782
Slc7a14 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 113,993,781 - 114,099,810 (+) NCBI GRCr8 mRatBN7.2 2 112,065,286 - 112,171,319 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 112,065,286 - 112,171,313 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 118,713,850 - 118,819,501 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 116,826,419 - 116,932,057 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 111,535,164 - 111,641,542 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 115,678,344 - 115,788,688 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 115,678,344 - 115,788,687 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 135,373,151 - 135,484,827 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 116,462,113 - 116,579,876 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 2 107,253,260 - 107,359,313 (+) NCBI Celera Cytogenetic Map 2 q24 NCBI
SLC7A14 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 170,459,548 - 170,586,075 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 170,459,548 - 170,586,075 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 170,177,336 - 170,303,864 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 171,667,255 - 171,786,552 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 3 168,576,516 - 168,703,058 (-) NCBI Celera Cytogenetic Map 3 q26.2 NCBI HuRef 3 167,547,022 - 167,673,468 (-) NCBI HuRef CHM1_1 3 170,140,494 - 170,267,053 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 173,243,852 - 173,370,405 (-) NCBI T2T-CHM13v2.0
Slc7a14 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 31,257,003 - 31,364,712 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 31,257,007 - 31,364,527 (-) Ensembl GRCm39 Ensembl GRCm38 3 31,202,854 - 31,310,567 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 31,202,858 - 31,310,378 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 31,101,776 - 31,209,241 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 31,397,101 - 31,501,173 (-) NCBI MGSCv36 mm8 Celera 3 31,118,087 - 31,225,413 (-) NCBI Celera Cytogenetic Map 3 A3 NCBI cM Map 3 15.17 NCBI
Slc7a14 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955420 624,929 - 732,282 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955420 624,929 - 732,108 (-) NCBI ChiLan1.0 ChiLan1.0
SLC7A14 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 168,354,461 - 168,479,884 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 168,359,185 - 168,484,607 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 167,473,566 - 167,599,271 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 175,662,571 - 175,787,309 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 175,662,571 - 175,728,590 (-) Ensembl panpan1.1 panPan2
SLC7A14 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 34 34,953,442 - 35,065,447 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 34 34,958,156 - 35,012,544 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 34 43,965,831 - 44,077,781 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 34 35,036,711 - 35,147,854 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 34 35,043,064 - 35,147,837 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 34 34,978,545 - 35,090,251 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 34 34,949,830 - 35,061,425 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 34 35,211,838 - 35,323,499 (-) NCBI UU_Cfam_GSD_1.0
Slc7a14 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 101,571,562 - 101,683,388 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936593 1,991,491 - 2,044,329 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936593 1,938,392 - 2,045,639 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SLC7A14 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 109,115,006 - 109,231,433 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 109,108,461 - 109,231,712 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 117,996,231 - 118,112,752 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SLC7A14 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 15 18,842,801 - 18,965,673 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 15 18,842,732 - 18,958,180 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666063 27,618,718 - 27,741,774 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Slc7a14
.
Predicted Target Of
Count of predictions: 50 Count of miRNA genes: 45 Interacting mature miRNAs: 49 Transcripts: ENSRNOT00000036717 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2293671 Bss44 Bone structure and strength QTL 44 10.97 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 2 43162366 148478373 Rat 631566 Bp90 Blood pressure QTL 90 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 102803808 147803808 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1598865 Bp296 Blood pressure QTL 296 2.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 81018907 126018907 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1578772 Stresp14 Stress response QTL 14 5 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 2 82345893 130923501 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 152025242 Bw191 Body weight QTL 191 3.62 body mass (VT:0001259) 2 38573329 122609194 Rat 1598862 Glom9 Glomerulus QTL 9 3.5 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 2 92337601 137337601 Rat 631198 Cm22 Cardiac mass QTL 22 4.3 0.0008 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 76539322 150540526 Rat 1598863 Cm65 Cardiac mass QTL 65 2.3 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 92337601 137337601 Rat 1302794 Stl27 Serum triglyceride level QTL 27 4.4 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 25413423 143657569 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 1358901 Cm38 Cardiac mass QTL 38 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 2300165 Bmd49 Bone mineral density QTL 49 4.8 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 2 88862519 133862519 Rat 1358899 Kidm23 Kidney mass QTL 23 3.88 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358908 Bw49 Body weight QTL 49 3.36 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 2300170 Bmd45 Bone mineral density QTL 45 12.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 2 88862519 133862519 Rat 1358910 Kidm27 Kidney mass QTL 27 5.77 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358911 Kidm28 Kidney mass QTL 28 5.42 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358904 Cm39 Cardiac mass QTL 39 2.26 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 7411551 Bw131 Body weight QTL 131 29.6 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 2 67942638 112942638 Rat 8662836 Vetf8 Vascular elastic tissue fragility QTL 8 0.66 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 104559726 149559726 Rat 1358887 Bw50 Body weight QTL 50 2.39 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 2290453 Scl55 Serum cholesterol level QTL 55 2.83 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 2 26917817 136917119 Rat 2299162 Iddm32 Insulin dependent diabetes mellitus QTL 32 2.36 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 78665616 143657569 Rat 1358894 Kidm24 Kidney mass QTL 24 4.03 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 2300185 Bmd46 Bone mineral density QTL 46 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 2 88862519 133862519 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 61374 Edpm2 Estrogen-dependent pituitary mass QTL 2 4.42 0.86 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 76539322 202447032 Rat 61392 Bp6 Blood pressure QTL 6 7 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 2 80270434 125270434 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 2293835 Kiddil5 Kidney dilation QTL 5 3.8 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 157142209 Rat 1581552 Pur12 Proteinuria QTL 12 5.19 0.0009 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 2 112103657 148076632 Rat 1558653 Prcr1 Prostate cancer resistance QTL 1 5 prostate integrity trait (VT:0010571) area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899) 2 72532993 157142209 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 7207808 Bmd89 Bone mineral density QTL 89 4.1 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 2 88862519 133862519 Rat 1558648 Smcn1 Smooth muscle cell number QTL 1 0.039 blood vessel smooth muscle cell quantity (VT:0010525) aorta smooth muscle cell count per unit vessel length (CMO:0001646) 2 59134147 127460910 Rat 2293843 Kiddil6 Kidney dilation QTL 6 3.1 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 182042367 Rat 152025206 Hrtrt23 Heart rate QTL 23 5.98 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 152025204 Hrtrt22 Heart rate QTL 22 5.6 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1354601 Slep1 Serum leptin concentration QTL 1 5.39 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 2 43171017 184114403 Rat 61438 Cia7 Collagen induced arthritis QTL 7 4.6 0.0001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 2 59324377 141596857 Rat 1354603 Bp243 Blood pressure QTL 243 3.9 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 26917817 127469484 Rat
D2Rat30
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 114,032,149 - 114,032,305 (+) Marker Load Pipeline mRatBN7.2 2 112,103,657 - 112,103,813 (+) MAPPER mRatBN7.2 Rnor_6.0 2 115,721,880 - 115,722,035 NCBI Rnor6.0 Rnor_5.0 2 135,417,671 - 135,417,826 UniSTS Rnor5.0 RGSC_v3.4 2 116,504,240 - 116,504,396 RGD RGSC3.4 RGSC_v3.4 2 116,504,241 - 116,504,396 UniSTS RGSC3.4 RGSC_v3.1 2 116,449,203 - 116,449,358 RGD RH 3.4 Map 2 718.1 UniSTS RH 3.4 Map 2 718.1 RGD RH 2.0 Map 2 506.4 RGD SHRSP x BN Map 2 38.8198 RGD Cytogenetic Map 2 q24 UniSTS
D2Wox6
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 114,094,673 - 114,094,849 (+) Marker Load Pipeline mRatBN7.2 2 112,166,180 - 112,166,356 (+) MAPPER mRatBN7.2 Rnor_6.0 2 115,783,552 - 115,783,727 NCBI Rnor6.0 Rnor_5.0 2 135,479,691 - 135,479,866 UniSTS Rnor5.0 RGSC_v3.4 2 116,574,739 - 116,574,915 RGD RGSC3.4 RGSC_v3.4 2 116,574,740 - 116,574,915 UniSTS RGSC3.4 RGSC_v3.1 2 116,519,702 - 116,519,877 RGD Celera 2 107,354,177 - 107,354,352 UniSTS RH 3.4 Map 2 719.5 RGD RH 3.4 Map 2 719.5 UniSTS Cytogenetic Map 2 q24 UniSTS
BE102448
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 112,171,163 - 112,171,316 (+) MAPPER mRatBN7.2 Rnor_6.0 2 115,788,533 - 115,788,685 NCBI Rnor6.0 Rnor_5.0 2 135,484,672 - 135,484,824 UniSTS Rnor5.0 RGSC_v3.4 2 116,579,721 - 116,579,873 UniSTS RGSC3.4 Celera 2 107,359,158 - 107,359,310 UniSTS RH 3.4 Map 2 718.1 UniSTS Cytogenetic Map 2 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
6
23
110
31
29
6
6
6
3
88
45
93
22
56
23
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000036717 ⟹ ENSRNOP00000035746
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 112,065,286 - 112,171,313 (+) Ensembl Rnor_6.0 Ensembl 2 115,678,344 - 115,788,682 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000085452 ⟹ ENSRNOP00000071834
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 112,155,896 - 112,171,313 (+) Ensembl Rnor_6.0 Ensembl 2 115,739,813 - 115,788,687 (+) Ensembl
RefSeq Acc Id:
NM_001134615 ⟹ NP_001128087
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 113,993,781 - 114,099,810 (+) NCBI mRatBN7.2 2 112,065,286 - 112,171,319 (+) NCBI Rnor_6.0 2 115,678,344 - 115,788,688 (+) NCBI Rnor_5.0 2 135,373,151 - 135,484,827 (+) NCBI RGSC_v3.4 2 116,462,113 - 116,579,876 (+) RGD Celera 2 107,253,260 - 107,359,313 (+) RGD
Sequence:
CGATCTGAATAATTGAGGAGCGATTCAGCAGCAGCCGCTGCCTCCTGCCTTCCTTTATCACCACCACCGCCTCCATCTCAGCTGTAAGTGCAGACCGCCGGACATTAGCATCCAATCCAGACCATCAC
hide sequence
RefSeq Acc Id:
NP_001128087 ⟸ NM_001134615
- UniProtKB:
A6IHJ8 (UniProtKB/TrEMBL), A0A0G2K1G8 (UniProtKB/TrEMBL)
- Sequence:
MPWPVMGCFSGKGFLAHVSSYTETPVVACIVSGFLAALLSLLVSLRDLIEMMSIGTLLAYTLVSVCVLLLRYQPESDIDGFVKFLSEEHTKKKEGILADCEKETCSPVSEGEEFSSPATNTCGAKNLP
hide sequence
Ensembl Acc Id:
ENSRNOP00000035746 ⟸ ENSRNOT00000036717
Ensembl Acc Id:
ENSRNOP00000071834 ⟸ ENSRNOT00000085452
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-07-29
Slc7a14
solute carrier family 7, member 14
LOC681347
similar to solute carrier family 7, member 14
Data merged from RGD:1596743
737654 PROVISIONAL
2013-08-02
Slc7a14
solute carrier family 7, member 14
Slc7a14
solute carrier family 7 (orphan transporter), member 14
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-10-16
Slc7a14
solute carrier family 7 (orphan transporter), member 14
Slc7a14
solute carrier family 7 (cationic amino acid transporter, y+ system), member 14
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2010-04-21
Slc7a14
solute carrier family 7 (cationic amino acid transporter, y+ system), member 14
LOC499587
similar to solute carrier family 7, member 14
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-11-20
LOC681347
similar to solute carrier family 7, member 14
Symbol and Name status set to provisional
70820 PROVISIONAL
2006-11-20
LOC499587
similar to solute carrier family 7, member 14
Symbol and Name status set to provisional
70820 PROVISIONAL
