Symbol:
Ncaph2
Name:
non-SMC condensin II complex, subunit H2
RGD ID:
1565937
Description:
Predicted to enable chromatin binding activity. Predicted to be involved in meiotic chromosome condensation; nuclear chromosome segregation; and regulation of chromosome segregation. Predicted to act upstream of or within T cell differentiation in thymus. Predicted to be located in cell junction; intercellular bridge; and nuclear lumen. Predicted to be part of condensin complex. Predicted to be active in chromosome and nucleus. Orthologous to human NCAPH2 (non-SMC condensin II complex subunit H2); INTERACTS WITH 17alpha-ethynylestradiol; acrylamide; bisphenol A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
condensin-2 complex subunit H2; MGC114417; non-SMC condensin II complex subunit H2; similar to hypothetical protein D15Ertd785e
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NCAPH2 (non-SMC condensin II complex subunit H2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):
Ncaph2 (non-SMC condensin II complex, subunit H2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ncaph2 (non-SMC condensin II complex subunit H2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NCAPH2 (non-SMC condensin II complex subunit H2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NCAPH2 (non-SMC condensin II complex subunit H2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ncaph2 (non-SMC condensin II complex subunit H2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NCAPH2 (non-SMC condensin II complex subunit H2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NCAPH2 (non-SMC condensin II complex subunit H2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ncaph2 (non-SMC condensin II complex subunit H2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
NCAPH2 (non-SMC condensin II complex subunit H2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Ncaph2 (non-SMC condensin II complex, subunit H2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ncaph2 (non-SMC condensin II complex, subunit H2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
kle-2
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
Cap-H2
Alliance
DIOPT (OrthoFinder|PANTHER)
Xenopus tropicalis (tropical clawed frog):
ncaph2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 122,302,550 - 122,319,570 (+) NCBI GRCr8 mRatBN7.2 7 120,422,926 - 120,439,942 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 120,422,956 - 120,439,938 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 122,173,646 - 122,191,436 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 124,399,800 - 124,417,590 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 124,362,467 - 124,380,299 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 130,326,597 - 130,343,655 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 130,326,600 - 130,342,493 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 130,011,904 - 130,028,836 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 127,650,768 - 127,666,461 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 7 116,890,045 - 116,911,675 (+) NCBI Celera Cytogenetic Map 7 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ncaph2 Rat 1,2-dimethylhydrazine increases expression ISO Ncaph2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of NCAPH2 mRNA CTD PMID:22206623 Ncaph2 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of NCAPH2 mRNA CTD PMID:17108234 Ncaph2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Ncaph2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to NCAPH2 promoter] CTD PMID:19654925 Ncaph2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO NCAPH2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of NCAPH2 mRNA CTD PMID:22574217 Ncaph2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ncaph2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of NCAPH2 mRNA CTD PMID:21570461 Ncaph2 Rat 4,4'-sulfonyldiphenol increases expression ISO Ncaph2 (Mus musculus) 6480464 bisphenol S results in increased expression of NCAPH2 mRNA CTD PMID:39298647 Ncaph2 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of NCAPH2 mRNA CTD PMID:28959563 Ncaph2 Rat aflatoxin B1 increases expression ISO Ncaph2 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of NCAPH2 mRNA CTD PMID:19770486 Ncaph2 Rat all-trans-retinoic acid decreases expression ISO NCAPH2 (Homo sapiens) 6480464 Tretinoin results in decreased expression of NCAPH2 mRNA CTD PMID:33167477 Ncaph2 Rat Aroclor 1254 increases expression ISO Ncaph2 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of NCAPH2 mRNA CTD PMID:23650126 Ncaph2 Rat atrazine decreases expression ISO NCAPH2 (Homo sapiens) 6480464 Atrazine results in decreased expression of NCAPH2 mRNA CTD PMID:22378314 Ncaph2 Rat benzo[a]pyrene increases expression ISO Ncaph2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of NCAPH2 mRNA CTD PMID:22228805 Ncaph2 Rat benzo[a]pyrene increases methylation ISO NCAPH2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of NCAPH2 promoter CTD PMID:27901495 Ncaph2 Rat beta-lapachone decreases expression ISO NCAPH2 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of NCAPH2 mRNA CTD PMID:38218311 Ncaph2 Rat bisphenol A increases expression ISO NCAPH2 (Homo sapiens) 6480464 bisphenol A results in increased expression of NCAPH2 mRNA CTD PMID:25047013 Ncaph2 Rat bisphenol A affects splicing ISO Ncaph2 (Mus musculus) 6480464 bisphenol A affects the splicing of NCAPH2 mRNA CTD PMID:37894381 Ncaph2 Rat bisphenol A multiple interactions ISO NCAPH2 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of NCAPH2 gene CTD PMID:31601247 Ncaph2 Rat bisphenol A increases methylation ISO NCAPH2 (Homo sapiens) 6480464 bisphenol A results in increased methylation of NCAPH2 gene CTD PMID:31601247 Ncaph2 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with tributyltin] results in decreased expression of NCAPH2 mRNA CTD PMID:31129395 Ncaph2 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of NCAPH2 gene CTD PMID:28505145 Ncaph2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of NCAPH2 mRNA CTD PMID:25181051 and PMID:34947998 Ncaph2 Rat butanal increases expression ISO NCAPH2 (Homo sapiens) 6480464 butyraldehyde results in increased expression of NCAPH2 mRNA CTD PMID:26079696 Ncaph2 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of NCAPH2 mRNA CTD PMID:33453195 Ncaph2 Rat cadmium dichloride increases expression ISO Ncaph2 (Mus musculus) 6480464 Cadmium Chloride results in increased expression of NCAPH2 mRNA CTD PMID:24982889 Ncaph2 Rat chromium(6+) multiple interactions ISO NCAPH2 (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of NCAPH2 mRNA CTD PMID:38479592 Ncaph2 Rat cisplatin increases expression ISO NCAPH2 (Homo sapiens) 6480464 Cisplatin results in increased expression of NCAPH2 mRNA CTD PMID:27594783 Ncaph2 Rat corticosterone decreases expression EXP 6480464 Corticosterone results in decreased expression of NCAPH2 mRNA CTD PMID:15755911 Ncaph2 Rat coumarin affects phosphorylation ISO NCAPH2 (Homo sapiens) 6480464 coumarin affects the phosphorylation of NCAPH2 protein CTD PMID:35688186 Ncaph2 Rat coumestrol increases expression ISO NCAPH2 (Homo sapiens) 6480464 Coumestrol results in increased expression of NCAPH2 mRNA CTD PMID:19167446 Ncaph2 Rat DDE increases expression ISO NCAPH2 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of NCAPH2 mRNA CTD PMID:38568856 Ncaph2 Rat ethanol affects splicing ISO Ncaph2 (Mus musculus) 6480464 Ethanol affects the splicing of NCAPH2 mRNA CTD PMID:30319688 Ncaph2 Rat fenthion decreases expression ISO Ncaph2 (Mus musculus) 6480464 Fenthion results in decreased expression of NCAPH2 mRNA CTD PMID:34813904 Ncaph2 Rat folic acid decreases expression ISO Ncaph2 (Mus musculus) 6480464 Folic Acid results in decreased expression of NCAPH2 mRNA CTD PMID:25629700 Ncaph2 Rat FR900359 decreases phosphorylation ISO NCAPH2 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of NCAPH2 protein CTD PMID:37730182 Ncaph2 Rat fulvestrant multiple interactions ISO NCAPH2 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of NCAPH2 gene CTD PMID:31601247 Ncaph2 Rat glyphosate increases methylation EXP 6480464 Glyphosate results in increased methylation of NCAPH2 gene CTD PMID:31011160 Ncaph2 Rat hydrogen cyanide decreases expression ISO Ncaph2 (Mus musculus) 6480464 Hydrogen Cyanide results in decreased expression of NCAPH2 mRNA CTD PMID:33914522 Ncaph2 Rat hydrogen peroxide multiple interactions ISO Ncaph2 (Mus musculus) 6480464 N-(oxo-5 more ... CTD PMID:31494107 Ncaph2 Rat hydrogen peroxide increases phosphorylation ISO Ncaph2 (Mus musculus) 6480464 Hydrogen Peroxide results in increased phosphorylation of NCAPH2 protein CTD PMID:31494107 Ncaph2 Rat hypochlorous acid decreases expression ISO Ncaph2 (Mus musculus) 6480464 Hypochlorous Acid results in decreased expression of NCAPH2 mRNA CTD PMID:19376150 Ncaph2 Rat ivermectin decreases expression ISO NCAPH2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of NCAPH2 protein CTD PMID:32959892 Ncaph2 Rat methyl methanesulfonate increases expression ISO NCAPH2 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of NCAPH2 mRNA CTD PMID:23649840 Ncaph2 Rat N-ethyl-N-nitrosourea increases mutagenesis ISO Ncaph2 (Mus musculus) 6480464 Ethylnitrosourea results in increased mutagenesis of NCAPH2 gene CTD PMID:17640884 Ncaph2 Rat nickel atom increases expression ISO NCAPH2 (Homo sapiens) 6480464 Nickel results in increased expression of NCAPH2 mRNA CTD PMID:25583101 Ncaph2 Rat nitrates multiple interactions ISO Ncaph2 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of NCAPH2 mRNA CTD PMID:35964746 Ncaph2 Rat oxaliplatin decreases expression EXP 6480464 oxaliplatin results in decreased expression of NCAPH2 mRNA CTD PMID:25729387 Ncaph2 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of NCAPH2 mRNA CTD PMID:25729387 Ncaph2 Rat ozone multiple interactions ISO NCAPH2 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of NCAPH2 mRNA CTD PMID:35430440 Ncaph2 Rat paracetamol affects expression ISO Ncaph2 (Mus musculus) 6480464 Acetaminophen affects the expression of NCAPH2 mRNA CTD PMID:17562736 Ncaph2 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of NCAPH2 mRNA CTD PMID:33387578 Ncaph2 Rat paracetamol increases expression ISO NCAPH2 (Homo sapiens) 6480464 Acetaminophen results in increased expression of NCAPH2 mRNA CTD PMID:22230336 Ncaph2 Rat pentachlorophenol increases expression ISO Ncaph2 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of NCAPH2 mRNA CTD PMID:23892564 Ncaph2 Rat potassium cyanide increases expression ISO Ncaph2 (Mus musculus) 6480464 Potassium Cyanide results in increased expression of NCAPH2 mRNA CTD PMID:33914522 Ncaph2 Rat quercetin decreases phosphorylation ISO NCAPH2 (Homo sapiens) 6480464 Quercetin results in decreased phosphorylation of NCAPH2 protein CTD PMID:35688186 Ncaph2 Rat sodium arsenite decreases expression ISO NCAPH2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of NCAPH2 mRNA CTD PMID:38568856 Ncaph2 Rat sodium arsenite increases expression ISO NCAPH2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of NCAPH2 mRNA CTD PMID:34032870 Ncaph2 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of NCAPH2 mRNA CTD PMID:34492290 Ncaph2 Rat titanium dioxide increases methylation ISO Ncaph2 (Mus musculus) 6480464 titanium dioxide results in increased methylation of NCAPH2 gene CTD PMID:35295148 Ncaph2 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of NCAPH2 mRNA CTD PMID:25729387 Ncaph2 Rat tributylstannane multiple interactions EXP 6480464 [bisphenol A co-treated with tributyltin] results in decreased expression of NCAPH2 mRNA CTD PMID:31129395 Ncaph2 Rat trimellitic anhydride increases expression ISO Ncaph2 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of NCAPH2 mRNA CTD PMID:19042947 Ncaph2 Rat triphenyl phosphate affects expression ISO NCAPH2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of NCAPH2 mRNA CTD PMID:37042841 Ncaph2 Rat triptonide decreases expression ISO Ncaph2 (Mus musculus) 6480464 triptonide results in decreased expression of NCAPH2 mRNA CTD PMID:33045310 Ncaph2 Rat trovafloxacin decreases expression ISO Ncaph2 (Mus musculus) 6480464 trovafloxacin results in decreased expression of NCAPH2 mRNA CTD PMID:35537566 Ncaph2 Rat valproic acid affects expression ISO Ncaph2 (Mus musculus) 6480464 Valproic Acid affects the expression of NCAPH2 mRNA CTD PMID:17292431 Ncaph2 Rat valproic acid increases methylation ISO NCAPH2 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of NCAPH2 gene CTD PMID:29154799 Ncaph2 Rat valproic acid affects expression ISO NCAPH2 (Homo sapiens) 6480464 Valproic Acid affects the expression of NCAPH2 mRNA CTD PMID:25979313
Biological Process
chromosome condensation (IEA) female meiosis chromosome separation (IEA,ISO) female meiotic nuclear division (IEA,ISO) meiotic chromosome condensation (IBA,IEA,ISO) mitotic chromosome condensation (IEA,ISO,ISS) mitotic sister chromatid separation (IBA,IEA,ISO) positive regulation of chromosome segregation (IEA,ISO) positive regulation of chromosome separation (IEA,ISO) T cell differentiation in thymus (IEA,ISO)
Cellular Component
cell junction (IEA,ISO) chromosome (IEA,ISO) condensed chromosome (IEA,ISO) condensed nuclear chromosome (IEA,ISO) condensin complex (IBA,IEA,ISO) intercellular bridge (IEA,ISO) nucleoplasm (IEA,ISO) nucleus (IBA,IEA,ISO)
Ncaph2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 122,302,550 - 122,319,570 (+) NCBI GRCr8 mRatBN7.2 7 120,422,926 - 120,439,942 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 120,422,956 - 120,439,938 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 122,173,646 - 122,191,436 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 124,399,800 - 124,417,590 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 124,362,467 - 124,380,299 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 130,326,597 - 130,343,655 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 130,326,600 - 130,342,493 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 130,011,904 - 130,028,836 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 127,650,768 - 127,666,461 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 7 116,890,045 - 116,911,675 (+) NCBI Celera Cytogenetic Map 7 q34 NCBI
NCAPH2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 22 50,508,224 - 50,524,780 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 22 50,508,224 - 50,524,780 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 22 50,946,653 - 50,963,209 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 22 49,293,511 - 49,308,782 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 22 34,822,672 - 34,839,236 (+) NCBI Celera Cytogenetic Map 22 q13.33 NCBI HuRef 22 33,837,777 - 33,854,227 (+) NCBI HuRef CHM1_1 22 50,905,383 - 50,921,946 (+) NCBI CHM1_1 T2T-CHM13v2.0 22 51,018,752 - 51,035,345 (+) NCBI T2T-CHM13v2.0
Ncaph2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 89,239,920 - 89,257,030 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 89,239,922 - 89,257,029 (+) Ensembl GRCm39 Ensembl GRCm38 15 89,355,719 - 89,372,850 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 89,355,719 - 89,372,826 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 89,186,153 - 89,203,259 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 89,183,539 - 89,200,593 (+) NCBI MGSCv36 mm8 Celera 15 91,484,861 - 91,501,969 (+) NCBI Celera Cytogenetic Map 15 E3 NCBI cM Map 15 44.84 NCBI
Ncaph2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955413 33,492,348 - 33,503,804 (+) NCBI ChiLan1.0 ChiLan1.0
NCAPH2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 23 60,428,408 - 60,444,629 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 22 63,119,266 - 63,134,153 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 22 30,754,994 - 30,771,103 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 22 49,872,496 - 49,881,027 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 22 49,873,223 - 49,881,027 (+) Ensembl panpan1.1 panPan2
NCAPH2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 16,790,137 - 16,801,851 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 16,741,761 - 16,801,824 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 16,767,846 - 16,779,558 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 17,516,609 - 17,528,431 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 17,515,284 - 17,528,433 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 17,240,896 - 17,252,608 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 17,563,917 - 17,575,625 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 17,696,140 - 17,707,852 (-) NCBI UU_Cfam_GSD_1.0
Ncaph2
NCAPH2
NCAPH2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 19 32,978,771 - 32,995,055 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 19 32,978,562 - 32,997,160 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 92,346,255 - 92,356,666 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ncaph2
.
Predicted Target Of
Count of predictions: 62 Count of miRNA genes: 57 Interacting mature miRNAs: 61 Transcripts: ENSRNOT00000055808 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 1354582 Stl11 Serum triglyceride level QTL 11 3.42 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 119513385 135012528 Rat 1300112 Bp183 Blood pressure QTL 183 3.51 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 111182207 135012528 Rat 1331728 Bp214 Blood pressure QTL 214 2.825 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 80221299 124373579 Rat 1331731 Bp216 Blood pressure QTL 216 2.851 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 102297359 133492884 Rat 2298475 Eau6 Experimental allergic uveoretinitis QTL 6 0.0029 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 7 84257275 129257275 Rat 71114 Niddm14 Non-insulin dependent diabetes mellitus QTL 14 4.5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 7 84257275 129257275 Rat 631687 Hcas1 Hepatocarcinoma susceptibility QTL 1 3.9 0.001 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 7 91412594 129807172 Rat 1357339 Stl14 Serum triglyceride level QTL 14 3.45 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 112729683 133492707 Rat 634331 Pia17 Pristane induced arthritis QTL 17 4.7 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 7 73829340 130221005 Rat 1358914 Bp266 Blood pressure QTL 266 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat 634322 Bw12 Body weight QTL 12 0 body mass (VT:0001259) body weight (CMO:0000012) 7 83153392 128153392 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 1549899 Stresp8 Stress response QTL 8 4.37 0.0008 stress-related behavior trait (VT:0010451) defensive burying duration (CMO:0001961) 7 90482196 135012528 Rat 2317052 Aia17 Adjuvant induced arthritis QTL 17 2.13 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 7 81737938 126737938 Rat 731176 Glom5 Glomerulus QTL 5 2.5 0.0035 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 7 96670164 135012528 Rat 7411607 Foco15 Food consumption QTL 15 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2306821 Bp335 Blood pressure QTL 335 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 106571501 135012528 Rat 631663 Bw6 Body weight QTL 6 3.4 body mass (VT:0001259) body weight (CMO:0000012) 7 111075573 134976056 Rat 1558655 Swd4 Spike wave discharge measurement QTL 4 3.68 0.0002 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge severity grade (CMO:0001988) 7 86983365 131983365 Rat 631201 Panci1 Pancreas inflammation QTL 1 0 0.001 pancreas integrity trait (VT:0010560) percentage of study population displaying chronic pancreatitis at a point in time (CMO:0001214) 7 116677189 127103496 Rat 1331768 Kidm10 Kidney mass QTL 10 4.62096 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 80221299 125221299 Rat 731174 Uae23 Urinary albumin excretion QTL 23 2.4 0.0042 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 7 104603555 135012528 Rat 1331748 Bp215 Blood pressure QTL 215 4.043 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 112308254 133492884 Rat 7411654 Foco25 Food consumption QTL 25 9.3 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2299163 Iddm34 Insulin dependent diabetes mellitus QTL 34 2.71 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 7 91281130 135012528 Rat 1582240 Sffal1 Serum free fatty acids level QTL 1 3.4 0.0021 blood free fatty acid amount (VT:0001553) serum free fatty acids level (CMO:0000547) 7 116677010 124049952 Rat 1358891 Bp265 Blood pressure QTL 265 2.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat
RH128722
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 120,438,507 - 120,438,709 (+) MAPPER mRatBN7.2 Rnor_6.0 7 130,342,221 - 130,342,422 NCBI Rnor6.0 Rnor_5.0 7 130,027,402 - 130,027,603 UniSTS Rnor5.0 RGSC_v3.4 7 127,666,258 - 127,666,459 UniSTS RGSC3.4 Celera 7 116,911,472 - 116,911,673 UniSTS RH 3.4 Map 7 948.7 UniSTS Cytogenetic Map 7 q34 UniSTS
RH133077
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 120,418,599 - 120,418,798 (+) MAPPER mRatBN7.2 Rnor_6.0 7 130,322,275 - 130,322,473 NCBI Rnor6.0 Rnor_5.0 7 130,007,576 - 130,007,774 UniSTS Rnor5.0 RGSC_v3.4 7 127,646,391 - 127,646,589 UniSTS RGSC3.4 Celera 7 116,892,413 - 116,892,611 UniSTS RH 3.4 Map 7 958.3 UniSTS Cytogenetic Map 7 q34 UniSTS
RH139883
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 120,438,861 - 120,439,050 (+) MAPPER mRatBN7.2 Rnor_6.0 7 130,342,575 - 130,342,763 NCBI Rnor6.0 Rnor_5.0 7 130,027,756 - 130,027,944 UniSTS Rnor5.0 RGSC_v3.4 7 127,666,612 - 127,666,800 UniSTS RGSC3.4 Celera 7 116,911,826 - 116,912,014 UniSTS RH 3.4 Map 7 961.8 UniSTS Cytogenetic Map 7 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000055808 ⟹ ENSRNOP00000052664
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 120,422,975 - 120,438,710 (+) Ensembl Rnor_6.0 Ensembl 7 130,326,650 - 130,342,423 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000084776 ⟹ ENSRNOP00000073049
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 120,422,956 - 120,439,938 (+) Ensembl Rnor_6.0 Ensembl 7 130,326,600 - 130,342,493 (+) Ensembl
RefSeq Acc Id:
NM_001024877 ⟹ NP_001020048
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 122,302,579 - 122,319,570 (+) NCBI mRatBN7.2 7 120,422,951 - 120,439,942 (+) NCBI Rnor_6.0 7 130,326,650 - 130,342,424 (+) NCBI Rnor_5.0 7 130,011,904 - 130,028,836 (+) NCBI RGSC_v3.4 7 127,650,768 - 127,666,461 (+) RGD Celera 7 116,890,045 - 116,911,675 (+) RGD
Sequence:
CCAGTAGCAGGTTGAACCAAGTTTCCGGGCCTCTAGTCCCTTTCTGGACATGGAGGATGTGGAGGTGCGCTTTGCTCACCTCTTGCAGCCCATCCGAGATCTCACTAAGAACTGGGAGGTGGACGTGG
hide sequence
RefSeq Acc Id:
NM_001399741 ⟹ NP_001386670
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 122,302,579 - 122,319,570 (+) NCBI mRatBN7.2 7 120,422,951 - 120,439,942 (+) NCBI
RefSeq Acc Id:
XM_006242186 ⟹ XP_006242248
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 122,302,550 - 122,319,566 (+) NCBI mRatBN7.2 7 120,422,927 - 120,439,942 (+) NCBI Rnor_6.0 7 130,326,597 - 130,343,655 (+) NCBI Rnor_5.0 7 130,011,904 - 130,028,836 (+) NCBI
Sequence:
GCAGTGCCCTGGGTACGTACTTCCTGGGCGGGAACACCAAAATGGCGCCAGAACCAGTAGCAGGTTGAACCAAGTTTCCGGGCCTCTAGTCCCTTTCTGGACATGGAGGATGTGGAGGTGCGCTTTGC
hide sequence
RefSeq Acc Id:
XM_006242188 ⟹ XP_006242250
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 122,302,578 - 122,319,566 (+) NCBI mRatBN7.2 7 120,422,958 - 120,439,942 (+) NCBI Rnor_6.0 7 130,326,632 - 130,343,655 (+) NCBI Rnor_5.0 7 130,011,904 - 130,028,836 (+) NCBI
Sequence:
ACCAAAATGGCGCCAGAACCAGTAGCAGGTTGAACCAAGTTTCCGGGCCTCTAGTCCCTTTCTGGACATGGAGGATGTGGAGGTGCGCTTTGCTCACCTCTTGCAGCCCATCCGAGATCTCACTAAGA
hide sequence
RefSeq Acc Id:
XM_063263347 ⟹ XP_063119417
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 122,302,566 - 122,319,566 (+) NCBI
RefSeq Acc Id:
NP_001020048 ⟸ NM_001024877
- Peptide Label:
isoform 2
- UniProtKB:
Q4V8I2 (UniProtKB/Swiss-Prot), A0A8L2QQZ1 (UniProtKB/TrEMBL)
- Sequence:
MNFIEAALLIQGSACVYSKKVEYLYSLVYQALDFISGKRRAKQLSLVQEDGSNRAVNSGTPCETEDEFLSLDDFPDSRANVDLKNDQASSELLIIPLLPMALVAPDEVEKSSNPLYSCQGEVLASRKD
hide sequence
RefSeq Acc Id:
XP_006242248 ⟸ XM_006242186
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2K4H8 (UniProtKB/TrEMBL)
- Sequence:
MEDVEVRFAHLLQPIRDLTKNWEVDVAAQLGEYLEELDQICISFDEGKTTMNFIEAALLIQGSA
hide sequence
RefSeq Acc Id:
XP_006242250 ⟸ XM_006242188
- Peptide Label:
isoform X2
- UniProtKB:
A0A8L2QQZ1 (UniProtKB/TrEMBL)
- Sequence:
MWRCALLTSCSPSEISLRTGRWTWRLSWLDQICISFDEGKTTMNFIEAALLIQGSACVYSKKVE
hide sequence
Ensembl Acc Id:
ENSRNOP00000052664 ⟸ ENSRNOT00000055808
Ensembl Acc Id:
ENSRNOP00000073049 ⟸ ENSRNOT00000084776
RefSeq Acc Id:
NP_001386670 ⟸ NM_001399741
- Peptide Label:
isoform 1
- UniProtKB:
A0A0G2K4H8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063119417 ⟸ XM_063263347
- Peptide Label:
isoform X3
- UniProtKB:
A0A8L2QQZ1 (UniProtKB/TrEMBL)
RGD ID: 13695593 Promoter ID: EPDNEW_R6110 Type: multiple initiation site Name: Ncaph2_1 Description: non-SMC condensin II complex, subunit H2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 130,326,615 - 130,326,675 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-06
Ncaph2
non-SMC condensin II complex, subunit H2
MGC114417
similar to hypothetical protein D15Ertd785e
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-02-09
MGC114417
similar to hypothetical protein D15Ertd785e
Symbol and Name status set to provisional
70820 PROVISIONAL
