Symbol:
Cxcl13
Name:
C-X-C motif chemokine ligand 13
RGD ID:
1564256
Description:
Predicted to enable chemokine receptor binding activity; fibroblast growth factor binding activity; and heparin binding activity. Predicted to be involved in several processes, including cell chemotaxis; regulation of chemotaxis; and response to bacterium. Predicted to act upstream of or within lymph node development. Predicted to be located in extracellular region. Predicted to be active in extracellular space. Orthologous to human CXCL13 (C-X-C motif chemokine ligand 13); PARTICIPATES IN chemokine mediated signaling pathway; cytokine mediated signaling pathway; INTERACTS WITH 1,2-dimethylhydrazine; 1-naphthyl isothiocyanate; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
C-X-C motif chemokine 13; chemokine (C-X-C motif) ligand 13; LOC498335; similar to Small inducible cytokine B13 precursor (CXCL13) (B lymphocyte chemoattractant) (CXC chemokine BLC)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CXCL13 (C-X-C motif chemokine ligand 13) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Cxcl13 (C-X-C motif chemokine ligand 13) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cxcl13 (C-X-C motif chemokine ligand 13) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CXCL13 (C-X-C motif chemokine ligand 13) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CXCL13 (C-X-C motif chemokine ligand 13) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cxcl13 (C-X-C motif chemokine ligand 13) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CXCL13 (C-X-C motif chemokine ligand 13) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CXCL13 (C-X-C motif chemokine ligand 13) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cxcl13 (C-X-C motif chemokine ligand 13) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
KIAA1614 (KIAA1614) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
CXCL13 (C-X-C motif chemokine ligand 13)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Cxcl13 (C-X-C motif chemokine ligand 13)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 13,912,858 - 13,917,920 (-) NCBI GRCr8 mRatBN7.2 14 13,608,894 - 13,613,965 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 13,608,902 - 13,613,933 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 13,576,171 - 13,581,214 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 14,876,016 - 14,881,059 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 13,592,498 - 13,597,541 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 15,253,146 - 15,258,221 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 15,253,125 - 15,258,207 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 15,193,472 - 15,198,546 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 15,126,332 - 15,131,368 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 14 13,649,303 - 13,654,347 (-) NCBI Celera Cytogenetic Map 14 p22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cxcl13 Rat 1,2-dimethylhydrazine multiple interactions EXP 6480464 [APC protein affects the susceptibility to 1 and 2-Dimethylhydrazine] which results in increased expression of CXCL13 mRNA CTD PMID:27840820 Cxcl13 Rat 1,2-dimethylhydrazine increases expression ISO Cxcl13 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of CXCL13 mRNA CTD PMID:22206623 Cxcl13 Rat 1-naphthyl isothiocyanate decreases expression EXP 6480464 1-Naphthylisothiocyanate results in decreased expression of CXCL13 mRNA CTD PMID:25380136 and PMID:30723492 Cxcl13 Rat 1-nitropyrene decreases expression ISO CXCL13 (Homo sapiens) 6480464 1-nitropyrene results in decreased expression of CXCL13 mRNA CTD PMID:19428942 Cxcl13 Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of CXCL13 mRNA CTD PMID:32741896 Cxcl13 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of CXCL13 mRNA CTD PMID:32145629 Cxcl13 Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of CXCL13 mRNA CTD PMID:32741896 Cxcl13 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions EXP 6480464 [3 more ... CTD PMID:16984957 Cxcl13 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO CXCL13 (Homo sapiens) 6480464 [Tetrachlorodibenzodioxin results in increased activity of AHR protein] which results in increased expression of CXCL13 mRNA and Tetrachlorodibenzodioxin promotes the reaction [[AHR protein binds to RELB protein] which binds to CXCL13 promoter] CTD PMID:17900530 Cxcl13 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CXCL13 mRNA CTD PMID:34747641 Cxcl13 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Cxcl13 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CXCL13 mRNA CTD PMID:26377647 and PMID:28922406 Cxcl13 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO CXCL13 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of CXCL13 mRNA CTD PMID:20106945 and PMID:26159488 Cxcl13 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO CXCL13 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of CXCL13 mRNA CTD PMID:22298810 Cxcl13 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of CXCL13 mRNA CTD PMID:21215274 Cxcl13 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 AHR protein alternative form affects the reaction [Tetrachlorodibenzodioxin results in decreased expression of CXCL13 mRNA] CTD PMID:21215274 Cxcl13 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Cxcl13 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of CXCL13 mRNA CTD PMID:19770486 more ... Cxcl13 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Cxcl13 (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to CXCL13 promoter] CTD PMID:19654925 Cxcl13 Rat 2,4,6-trinitrobenzenesulfonic acid increases expression ISO Cxcl13 (Mus musculus) 6480464 Trinitrobenzenesulfonic Acid results in increased expression of CXCL13 mRNA CTD PMID:15973123 Cxcl13 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Cxcl13 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Cxcl13 Rat 3,3',4,4',5-pentachlorobiphenyl multiple interactions EXP 6480464 [3 more ... CTD PMID:16984957 Cxcl13 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Cxcl13 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of CXCL13 mRNA CTD PMID:20409345 Cxcl13 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of CXCL13 mRNA CTD PMID:28522335 Cxcl13 Rat 4,4'-diaminodiphenylmethane decreases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of CXCL13 mRNA CTD PMID:25380136 Cxcl13 Rat 4,4'-sulfonyldiphenol increases expression ISO Cxcl13 (Mus musculus) 6480464 bisphenol S results in increased expression of CXCL13 mRNA CTD PMID:39298647 Cxcl13 Rat 7,12-dimethyltetraphene affects expression ISO Cxcl13 (Mus musculus) 6480464 9 more ... CTD PMID:21785161 Cxcl13 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of CXCL13 mRNA CTD PMID:28959563 Cxcl13 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of CXCL13 mRNA CTD PMID:23630614 more ... Cxcl13 Rat aflatoxin B1 decreases expression ISO CXCL13 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of CXCL13 mRNA CTD PMID:32234424 Cxcl13 Rat alpha-Zearalanol increases expression EXP 6480464 Zeranol results in increased expression of CXCL13 mRNA CTD PMID:35163327 Cxcl13 Rat andrographolide multiple interactions ISO Cxcl13 (Mus musculus) 6480464 [andrographolide co-treated with beta-Naphthoflavone] results in decreased expression of CXCL13 mRNA CTD PMID:19737545 Cxcl13 Rat antirheumatic drug decreases expression ISO CXCL13 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of CXCL13 mRNA CTD PMID:24449571 Cxcl13 Rat asperentin increases expression ISO Cxcl13 (Mus musculus) 6480464 cladosporin results in increased expression of CXCL13 mRNA CTD PMID:19818335 Cxcl13 Rat benzo[a]pyrene decreases expression ISO CXCL13 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of CXCL13 mRNA CTD PMID:20106945 Cxcl13 Rat benzo[a]pyrene multiple interactions ISO Cxcl13 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of CXCL13 mRNA CTD PMID:27858113 Cxcl13 Rat benzo[a]pyrene increases methylation ISO CXCL13 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of CXCL13 promoter CTD PMID:27901495 Cxcl13 Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of CXCL13 mRNA CTD PMID:21839799 Cxcl13 Rat benzo[a]pyrene decreases expression ISO Cxcl13 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of CXCL13 mRNA CTD PMID:19770486 Cxcl13 Rat benzo[b]fluoranthene multiple interactions ISO Cxcl13 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of CXCL13 mRNA CTD PMID:27858113 Cxcl13 Rat Benzo[k]fluoranthene increases expression ISO Cxcl13 (Mus musculus) 6480464 benzo(k)fluoranthene results in increased expression of CXCL13 mRNA CTD PMID:26377693 Cxcl13 Rat beta-naphthoflavone multiple interactions ISO Cxcl13 (Mus musculus) 6480464 [andrographolide co-treated with beta-Naphthoflavone] results in decreased expression of CXCL13 mRNA CTD PMID:19737545 Cxcl13 Rat bis(2-ethylhexyl) phthalate increases expression ISO Cxcl13 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of CXCL13 mRNA CTD PMID:28085963 and PMID:35550907 Cxcl13 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO CXCL13 (Homo sapiens) 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in decreased expression of CXCL13 mRNA CTD PMID:32949613 Cxcl13 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Cxcl13 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate] affects the expression of and affects the secretion of CXCL13 protein CTD PMID:38954831 Cxcl13 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CXCL13 mRNA CTD PMID:25181051 Cxcl13 Rat bisphenol A increases expression ISO Cxcl13 (Mus musculus) 6480464 bisphenol A results in increased expression of CXCL13 mRNA CTD PMID:32156529 and PMID:38701888 Cxcl13 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CXCL13 mRNA CTD PMID:33296240 Cxcl13 Rat bisphenol F increases expression ISO Cxcl13 (Mus musculus) 6480464 bisphenol F results in increased expression of CXCL13 mRNA CTD PMID:38685157 Cxcl13 Rat bleomycin A2 affects expression ISO Cxcl13 (Mus musculus) 6480464 Bleomycin affects the expression of CXCL13 mRNA CTD PMID:26345256 Cxcl13 Rat Brevianamide A increases expression ISO Cxcl13 (Mus musculus) 6480464 brevianamide A results in increased expression of CXCL13 mRNA CTD PMID:19818335 Cxcl13 Rat bromobenzene decreases expression EXP 6480464 bromobenzene results in decreased expression of CXCL13 mRNA CTD PMID:32479839 Cxcl13 Rat Butylbenzyl phthalate multiple interactions ISO Cxcl13 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate] affects the expression of and affects the secretion of CXCL13 protein CTD PMID:38954831 Cxcl13 Rat Butylbenzyl phthalate multiple interactions ISO CXCL13 (Homo sapiens) 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in decreased expression of CXCL13 mRNA CTD PMID:32949613 Cxcl13 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of CXCL13 mRNA CTD PMID:25993096 Cxcl13 Rat carbamazepine affects expression ISO CXCL13 (Homo sapiens) 6480464 Carbamazepine affects the expression of CXCL13 mRNA CTD PMID:25979313 Cxcl13 Rat carbon nanotube increases expression ISO Cxcl13 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of CXCL13 mRNA CTD PMID:25554681 and PMID:25620056 Cxcl13 Rat carbon nanotube increases expression ISO CXCL13 (Homo sapiens) 6480464 Nanotubes and Carbon results in increased expression of CXCL13 mRNA CTD PMID:29348435 Cxcl13 Rat carbon nanotube affects expression ISO Cxcl13 (Mus musculus) 6480464 Nanotubes and Carbon analog affects the expression of CXCL13 mRNA CTD PMID:25554681 Cxcl13 Rat cefaloridine increases expression EXP 6480464 Cephaloridine results in increased expression of CXCL13 mRNA CTD PMID:18500788 Cxcl13 Rat CGP 52608 multiple interactions ISO CXCL13 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to CXCL13 gene] CTD PMID:28238834 Cxcl13 Rat choline multiple interactions ISO Cxcl13 (Mus musculus) 6480464 [Dietary Fats co-treated with Choline deficiency] results in increased expression of CXCL13 protein and PANX1 gene mutant form inhibits the reaction [[Dietary Fats co-treated with Choline deficiency] results in increased expression of CXCL13 protein] CTD PMID:29246445 Cxcl13 Rat chrysene multiple interactions ISO Cxcl13 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of CXCL13 mRNA CTD PMID:27858113 Cxcl13 Rat ciguatoxin CTX1B affects expression ISO Cxcl13 (Mus musculus) 6480464 Ciguatoxins affects the expression of CXCL13 mRNA CTD PMID:18353800 Cxcl13 Rat cyclosporin A decreases expression ISO CXCL13 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of CXCL13 mRNA CTD PMID:20106945 Cxcl13 Rat cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of CXCL13 mRNA CTD PMID:21865292 Cxcl13 Rat decabromodiphenyl ether decreases expression EXP 6480464 decabromobiphenyl ether results in decreased expression of CXCL13 mRNA CTD PMID:23640034 Cxcl13 Rat dextran sulfate increases expression ISO Cxcl13 (Mus musculus) 6480464 Dextran Sulfate results in increased expression of CXCL13 mRNA CTD PMID:23894361 and PMID:35093514 Cxcl13 Rat dibutyl phthalate affects expression EXP 6480464 Dibutyl Phthalate affects the expression of CXCL13 mRNA CTD PMID:30934153 Cxcl13 Rat dibutyl phthalate multiple interactions ISO Cxcl13 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate] affects the expression of and affects the secretion of CXCL13 protein CTD PMID:38954831 Cxcl13 Rat dibutylstannane multiple interactions ISO CXCL13 (Homo sapiens) 6480464 [di-n-butyltin co-treated with LHB protein] results in decreased secretion of CXCL13 protein CTD PMID:38630605 Cxcl13 Rat diclofenac increases expression ISO Cxcl13 (Mus musculus) 6480464 Diclofenac results in increased expression of CXCL13 mRNA CTD PMID:26934552 Cxcl13 Rat diethyl phthalate multiple interactions ISO Cxcl13 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate] affects the expression of and affects the secretion of CXCL13 protein CTD PMID:38954831 Cxcl13 Rat diisobutyl phthalate multiple interactions ISO Cxcl13 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate] affects the expression of and affects the secretion of CXCL13 protein CTD PMID:38954831 Cxcl13 Rat diisononyl phthalate multiple interactions ISO Cxcl13 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate] affects the expression of and affects the secretion of CXCL13 protein CTD PMID:38954831 Cxcl13 Rat diisononyl phthalate multiple interactions ISO CXCL13 (Homo sapiens) 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in decreased expression of CXCL13 mRNA CTD PMID:32949613 Cxcl13 Rat doxorubicin increases expression ISO Cxcl13 (Mus musculus) 6480464 Doxorubicin results in increased expression of CXCL13 mRNA CTD PMID:28608983 Cxcl13 Rat epoxiconazole increases expression ISO Cxcl13 (Mus musculus) 6480464 epoxiconazole results in increased expression of CXCL13 mRNA CTD PMID:35436446 Cxcl13 Rat fentanyl increases expression EXP 6480464 Fentanyl results in increased expression of CXCL13 mRNA CTD PMID:36032789 Cxcl13 Rat furan increases expression EXP 6480464 furan results in increased expression of CXCL13 mRNA CTD PMID:27387713 Cxcl13 Rat genistein increases expression ISO Cxcl13 (Mus musculus) 6480464 Genistein results in increased expression of CXCL13 mRNA CTD PMID:32186404 Cxcl13 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of CXCL13 mRNA CTD PMID:33387578 Cxcl13 Rat graphene oxide increases expression ISO Cxcl13 (Mus musculus) 6480464 graphene oxide results in increased expression of CXCL13 mRNA CTD PMID:33227293 Cxcl13 Rat iron(2+) sulfate (anhydrous) decreases expression ISO CXCL13 (Homo sapiens) 6480464 ferrous sulfate results in decreased expression of CXCL13 mRNA CTD PMID:19428942 Cxcl13 Rat isoprenaline increases expression ISO Cxcl13 (Mus musculus) 6480464 Isoproterenol results in increased expression of CXCL13 mRNA CTD PMID:20003209 Cxcl13 Rat lead nitrate multiple interactions ISO CXCL13 (Homo sapiens) 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in decreased expression of CXCL13 mRNA CTD PMID:32949613 Cxcl13 Rat lidocaine decreases expression EXP 6480464 Lidocaine results in decreased expression of CXCL13 mRNA CTD PMID:35283115 Cxcl13 Rat lipopolysaccharide increases expression ISO Cxcl13 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of CXCL13 mRNA CTD PMID:19136613 and PMID:27339419 Cxcl13 Rat lipopolysaccharide increases expression ISO CXCL13 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of CXCL13 mRNA CTD PMID:35811015 Cxcl13 Rat lipopolysaccharide multiple interactions ISO CXCL13 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of CXCL13 mRNA CTD PMID:35811015 Cxcl13 Rat mercury atom multiple interactions ISO CXCL13 (Homo sapiens) 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in decreased expression of CXCL13 mRNA CTD PMID:32949613 Cxcl13 Rat mercury(0) multiple interactions ISO CXCL13 (Homo sapiens) 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in decreased expression of CXCL13 mRNA CTD PMID:32949613 Cxcl13 Rat metformin decreases expression EXP 6480464 Metformin results in decreased expression of CXCL13 mRNA CTD PMID:31324951 Cxcl13 Rat methylmercury chloride increases expression ISO CXCL13 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of CXCL13 mRNA CTD PMID:28001369 Cxcl13 Rat methylmercury chloride increases expression EXP 6480464 methylmercuric chloride results in increased expression of CXCL13 mRNA CTD PMID:31378766 Cxcl13 Rat mifepristone decreases expression ISO CXCL13 (Homo sapiens) 6480464 Mifepristone results in decreased expression of CXCL13 mRNA CTD PMID:17584828 Cxcl13 Rat mycotoxin increases expression ISO Cxcl13 (Mus musculus) 6480464 Mycotoxins results in increased expression of CXCL13 mRNA CTD PMID:19818335 Cxcl13 Rat N,N-diethyl-m-toluamide increases expression ISO CXCL13 (Homo sapiens) 6480464 DEET results in increased expression of CXCL13 mRNA CTD PMID:27091632 Cxcl13 Rat N-nitrosodimethylamine decreases expression EXP 6480464 Dimethylnitrosamine results in decreased expression of CXCL13 mRNA CTD PMID:25380136 Cxcl13 Rat neoechinulin A decreases expression ISO Cxcl13 (Mus musculus) 6480464 neoechinulin A results in decreased expression of CXCL13 mRNA CTD PMID:19818335 Cxcl13 Rat nickel dichloride multiple interactions ISO CXCL13 (Homo sapiens) 6480464 nickel chloride inhibits the reaction [lipopolysaccharide and E. coli O26-B6 results in increased expression of CXCL13 mRNA] CTD PMID:23090859 Cxcl13 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of CXCL13 mRNA CTD PMID:33484710 Cxcl13 Rat O-methyleugenol decreases expression ISO CXCL13 (Homo sapiens) 6480464 methyleugenol results in decreased expression of CXCL13 mRNA CTD PMID:32234424 Cxcl13 Rat ozone multiple interactions ISO Cxcl13 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of CXCL13 mRNA CTD PMID:34911549 Cxcl13 Rat paracetamol increases expression ISO CXCL13 (Homo sapiens) 6480464 Acetaminophen results in increased expression of CXCL13 mRNA CTD PMID:26690555 Cxcl13 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of CXCL13 mRNA CTD PMID:33387578 Cxcl13 Rat paracetamol decreases expression ISO CXCL13 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of CXCL13 mRNA CTD PMID:29067470 Cxcl13 Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of CXCL13 mRNA CTD PMID:35163327 Cxcl13 Rat phenobarbital decreases expression ISO Cxcl13 (Mus musculus) 6480464 Phenobarbital results in decreased expression of CXCL13 mRNA CTD PMID:19270015 Cxcl13 Rat pirinixic acid multiple interactions ISO Cxcl13 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of CXCL13 mRNA CTD PMID:19710929 Cxcl13 Rat pirinixic acid decreases expression ISO Cxcl13 (Mus musculus) 6480464 pirinixic acid results in decreased expression of CXCL13 mRNA CTD PMID:17426115 Cxcl13 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of CXCL13 mRNA CTD PMID:28374803 Cxcl13 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO CXCL13 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of CXCL13 mRNA CTD PMID:35811015 Cxcl13 Rat serpentine asbestos increases expression ISO CXCL13 (Homo sapiens) 6480464 Asbestos and Serpentine results in increased expression of CXCL13 mRNA CTD PMID:33581214 Cxcl13 Rat silicon dioxide decreases expression ISO CXCL13 (Homo sapiens) 6480464 Silicon Dioxide results in decreased expression of CXCL13 mRNA CTD PMID:19428942 Cxcl13 Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of CXCL13 mRNA CTD PMID:22431001 and PMID:32721576 Cxcl13 Rat sirolimus decreases expression EXP 6480464 Sirolimus results in decreased expression of CXCL13 mRNA CTD PMID:21865292 Cxcl13 Rat sodium arsenite decreases expression ISO Cxcl13 (Mus musculus) 6480464 sodium arsenite results in decreased expression of CXCL13 mRNA CTD PMID:21911445 Cxcl13 Rat sodium arsenite decreases expression ISO CXCL13 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of CXCL13 mRNA CTD PMID:29301061 Cxcl13 Rat sodium arsenite affects methylation ISO CXCL13 (Homo sapiens) 6480464 sodium arsenite affects the methylation of CXCL13 gene CTD PMID:28589171 Cxcl13 Rat sodium arsenite increases expression ISO Cxcl13 (Mus musculus) 6480464 sodium arsenite results in increased expression of CXCL13 mRNA CTD PMID:21911445 Cxcl13 Rat sodium arsenite increases expression ISO CXCL13 (Homo sapiens) 6480464 sodium arsenite results in increased expression of CXCL13 mRNA CTD PMID:17879257 Cxcl13 Rat sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of CXCL13 mRNA CTD PMID:25993096 Cxcl13 Rat sterigmatocystin increases expression ISO Cxcl13 (Mus musculus) 6480464 Sterigmatocystin results in increased expression of CXCL13 mRNA CTD PMID:19818335 Cxcl13 Rat succimer multiple interactions ISO CXCL13 (Homo sapiens) 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in increased expression of CXCL13 mRNA CTD PMID:26378955 Cxcl13 Rat succimer multiple interactions ISO Cxcl13 (Mus musculus) 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in increased expression of CXCL13 mRNA CTD PMID:26378955 Cxcl13 Rat sunitinib decreases expression ISO Cxcl13 (Mus musculus) 6480464 Sunitinib results in decreased expression of CXCL13 mRNA CTD PMID:27560553 Cxcl13 Rat taurocholic acid multiple interactions ISO Cxcl13 (Mus musculus) 6480464 EGR1 promotes the reaction [Taurocholic Acid results in increased expression of CXCL13 mRNA] CTD PMID:21224055 Cxcl13 Rat taurocholic acid increases expression ISO Cxcl13 (Mus musculus) 6480464 Taurocholic Acid results in increased expression of CXCL13 mRNA CTD PMID:21224055 Cxcl13 Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of CXCL13 mRNA CTD PMID:32741896 Cxcl13 Rat tetrachloromethane increases expression ISO Cxcl13 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of CXCL13 mRNA CTD PMID:27339419 Cxcl13 Rat tetraphene multiple interactions ISO Cxcl13 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of CXCL13 mRNA CTD PMID:27858113 Cxcl13 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of CXCL13 mRNA CTD PMID:34492290 Cxcl13 Rat titanium dioxide increases expression ISO Cxcl13 (Mus musculus) 6480464 titanium dioxide results in increased expression of CXCL13 mRNA CTD PMID:23131501 and PMID:23557971 Cxcl13 Rat tofacitinib decreases expression ISO CXCL13 (Homo sapiens) 6480464 tofacitinib results in decreased expression of CXCL13 mRNA CTD PMID:25398374 Cxcl13 Rat toluene 2,4-diisocyanate decreases expression ISO Cxcl13 (Mus musculus) 6480464 Toluene 2 and 4-Diisocyanate results in decreased expression of CXCL13 mRNA CTD PMID:21404309 Cxcl13 Rat tributylstannane multiple interactions ISO CXCL13 (Homo sapiens) 6480464 [tributyltin co-treated with LHB protein] results in decreased secretion of CXCL13 protein CTD PMID:38630605 Cxcl13 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of CXCL13 mRNA CTD PMID:33387578 Cxcl13 Rat trimellitic anhydride increases expression ISO Cxcl13 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of CXCL13 mRNA CTD PMID:16141432 Cxcl13 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of CXCL13 mRNA CTD PMID:23160963 Cxcl13 Rat zinc dichloride decreases expression ISO CXCL13 (Homo sapiens) 6480464 zinc chloride results in decreased expression of CXCL13 mRNA CTD PMID:19428942
Imported Annotations - KEGG (archival)
1,2-dimethylhydrazine (EXP,ISO) 1-naphthyl isothiocyanate (EXP) 1-nitropyrene (ISO) 17beta-estradiol (EXP) 17beta-estradiol 3-benzoate (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrobenzenesulfonic acid (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3-chloropropane-1,2-diol (EXP) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 7,12-dimethyltetraphene (ISO) acrylamide (EXP) aflatoxin B1 (EXP,ISO) alpha-Zearalanol (EXP) andrographolide (ISO) antirheumatic drug (ISO) asperentin (ISO) benzo[a]pyrene (EXP,ISO) benzo[b]fluoranthene (ISO) Benzo[k]fluoranthene (ISO) beta-naphthoflavone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bleomycin A2 (ISO) Brevianamide A (ISO) bromobenzene (EXP) Butylbenzyl phthalate (ISO) cadmium dichloride (EXP) carbamazepine (ISO) carbon nanotube (ISO) cefaloridine (EXP) CGP 52608 (ISO) choline (ISO) chrysene (ISO) ciguatoxin CTX1B (ISO) cyclosporin A (EXP,ISO) decabromodiphenyl ether (EXP) dextran sulfate (ISO) dibutyl phthalate (EXP,ISO) dibutylstannane (ISO) diclofenac (ISO) diethyl phthalate (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) doxorubicin (ISO) epoxiconazole (ISO) fentanyl (EXP) furan (EXP) genistein (ISO) gentamycin (EXP) graphene oxide (ISO) iron(2+) sulfate (anhydrous) (ISO) isoprenaline (ISO) lead nitrate (ISO) lidocaine (EXP) lipopolysaccharide (ISO) mercury atom (ISO) mercury(0) (ISO) metformin (EXP) methylmercury chloride (EXP,ISO) mifepristone (ISO) mycotoxin (ISO) N,N-diethyl-m-toluamide (ISO) N-nitrosodimethylamine (EXP) neoechinulin A (ISO) nickel dichloride (ISO) nitrofen (EXP) O-methyleugenol (ISO) ozone (ISO) paracetamol (EXP,ISO) perfluorooctanoic acid (EXP) phenobarbital (ISO) pirinixic acid (ISO) rotenone (EXP) S-(1,2-dichlorovinyl)-L-cysteine (ISO) serpentine asbestos (ISO) silicon dioxide (EXP,ISO) sirolimus (EXP) sodium arsenite (ISO) sodium dichromate (EXP) sterigmatocystin (ISO) succimer (ISO) sunitinib (ISO) taurocholic acid (ISO) testosterone (EXP) tetrachloromethane (ISO) tetraphene (ISO) thioacetamide (EXP) titanium dioxide (ISO) tofacitinib (ISO) toluene 2,4-diisocyanate (ISO) tributylstannane (ISO) trichloroethene (EXP) trimellitic anhydride (ISO) vinclozolin (EXP) zinc dichloride (ISO)
Cxcl13 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 13,912,858 - 13,917,920 (-) NCBI GRCr8 mRatBN7.2 14 13,608,894 - 13,613,965 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 13,608,902 - 13,613,933 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 13,576,171 - 13,581,214 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 14,876,016 - 14,881,059 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 13,592,498 - 13,597,541 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 15,253,146 - 15,258,221 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 15,253,125 - 15,258,207 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 15,193,472 - 15,198,546 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 15,126,332 - 15,131,368 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 14 13,649,303 - 13,654,347 (-) NCBI Celera Cytogenetic Map 14 p22 NCBI
CXCL13 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 77,511,753 - 77,611,834 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 77,511,753 - 77,611,834 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 78,432,907 - 78,532,988 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 78,651,931 - 78,752,010 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 78,790,084 - 78,890,165 NCBI Celera 4 75,734,287 - 75,834,362 (+) NCBI Celera Cytogenetic Map 4 q21.1 NCBI HuRef 4 74,184,783 - 74,284,964 (+) NCBI HuRef CHM1_1 4 78,409,854 - 78,509,941 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 80,852,591 - 80,952,672 (+) NCBI T2T-CHM13v2.0
Cxcl13 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 96,104,785 - 96,108,927 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 96,104,810 - 96,108,927 (+) Ensembl GRCm39 Ensembl GRCm38 5 95,956,939 - 95,961,068 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 95,956,951 - 95,961,068 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 96,385,958 - 96,390,087 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 96,197,241 - 96,201,370 (+) NCBI MGSCv36 mm8 Celera 5 93,306,539 - 93,310,668 (+) NCBI Celera Cytogenetic Map 5 E3 NCBI cM Map 5 47.29 NCBI
Cxcl13 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955433 2,123,190 - 2,129,119 (+) NCBI ChiLan1.0 ChiLan1.0
CXCL13 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 52,453,375 - 52,460,491 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 52,639,881 - 52,646,923 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 46,583,759 - 46,589,865 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 52,428,702 - 52,434,803 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 52,428,702 - 52,434,803 (-) Ensembl panpan1.1 panPan2
CXCL13 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 32 2,047,277 - 2,053,277 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 32 2,047,315 - 2,052,833 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 32 39,837,784 - 39,843,805 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 32 2,073,585 - 2,079,610 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 32 2,073,621 - 2,081,627 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 32 2,071,444 - 2,077,479 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 32 2,019,776 - 2,025,803 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 32 38,148,529 - 38,154,567 (-) NCBI UU_Cfam_GSD_1.0
Cxcl13 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405285 10,191,903 - 10,197,633 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936676 1,309,625 - 1,313,933 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936676 1,309,625 - 1,314,532 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CXCL13
CXCL13 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 26,101,489 - 26,108,430 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 26,102,714 - 26,108,690 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 4,454,575 - 4,460,831 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cxcl13
.
Predicted Target Of
Count of predictions: 91 Count of miRNA genes: 71 Interacting mature miRNAs: 83 Transcripts: ENSRNOT00000039383 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
1300114 Srn2 Serum renin concentration QTL 2 3.27 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 14 3813074 21217635 Rat 2293089 Iddm31 Insulin dependent diabetes mellitus QTL 31 4.7 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 14 3813074 18274691 Rat 1581500 Renag1 Renal agenesis QTL 1 kidney development trait (VT:0000527) percentage of study population developing unilateral renal agenesis during a period of time (CMO:0000940) 14 8170668 68298175 Rat 731183 Pia20 Pristane induced arthritis QTL 20 3.55 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 14 9088978 39057237 Rat 631212 Bw5 Body weight QTL5 5.43 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 14 11030812 30320092 Rat 2302277 Gluco38 Glucose level QTL 38 5.8 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 11030622 28035204 Rat 1331740 Bw26 Body weight QTL 26 3.028 body mass (VT:0001259) body weight (CMO:0000012) 14 3813074 30767156 Rat 619619 Rf4 Renal disease susceptibility QTL 4 4.1 0.002 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 14 1 32754612 Rat 1358296 Ael3 Aortic elastin QTL 3 3.7 0.00051 aorta elastin amount (VT:0003905) aortic elastin 14 8267090 53267090 Rat 70195 Mcs8 Mammary carcinoma susceptibility QTL 8 4.28 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 14 3813074 24531477 Rat 2300183 Bmd60 Bone mineral density QTL 60 5.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 14 1 26541967 Rat 631839 Niddm37 Non-insulin dependent diabetes mellitus QTL 37 3.37 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 11030622 95876975 Rat 634352 Apr6 Acute phase response QTL 6 3.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 14 1 41131407 Rat 2300159 Bmd61 Bone mineral density QTL 61 5.3 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 14 1 26541967 Rat 70204 Niddm20 Non-insulin dependent diabetes mellitus QTL 20 5.1 0.000008 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 14 1217606 16960180 Rat 2302045 Pia39 Pristane induced arthritis QTL 39 4.9 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G2a level (CMO:0002116) 14 8267090 53267090 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
43
105
91
90
59
25
59
6
212
91
85
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000039383 ⟹ ENSRNOP00000034304
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 13,608,902 - 13,613,933 (-) Ensembl Rnor_6.0 Ensembl 14 15,253,125 - 15,258,207 (-) Ensembl
RefSeq Acc Id:
NM_001017496 ⟹ NP_001017496
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 13,912,858 - 13,917,920 (-) NCBI mRatBN7.2 14 13,608,894 - 13,613,956 (-) NCBI Rnor_6.0 14 15,253,149 - 15,258,185 (-) NCBI Rnor_5.0 14 15,193,472 - 15,198,546 (-) NCBI RGSC_v3.4 14 15,126,332 - 15,131,368 (-) RGD Celera 14 13,649,303 - 13,654,347 (-) RGD
Sequence:
GTGAACTCCACCTCCAGGCAGAATGAGGCTCTGCACCGCAGCCCTGCTTCTTCTACTGGCCATCTGCCTCCCTCCAGGCCACGGTATTCTGGAGACCCATTACACAAACTTGAAATGTAGGTGTTCCA
hide sequence
RefSeq Acc Id:
NM_001419199 ⟹ NP_001406128
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 13,912,858 - 13,917,920 (-) NCBI mRatBN7.2 14 13,608,894 - 13,613,956 (-) NCBI
RefSeq Acc Id:
NP_001017496 ⟸ NM_001017496
- Peptide Label:
isoform 2 precursor
- UniProtKB:
Q5I0J6 (UniProtKB/TrEMBL)
- Sequence:
MRLCTAALLLLLAICLPPGHGILETHYTNLKCRCSKVSSTFINLILVDWIQVIRPGNGCPKTEIIFWTKAKKAICVNPTARWLPKVLKFVRRSITSTPQAPVSKKRAA
hide sequence
Ensembl Acc Id:
ENSRNOP00000034304 ⟸ ENSRNOT00000039383
RefSeq Acc Id:
NP_001406128 ⟸ NM_001419199
- Peptide Label:
isoform 1 precursor
- UniProtKB:
F7F7W7 (UniProtKB/TrEMBL), A6K673 (UniProtKB/TrEMBL)
RGD ID: 13699204 Promoter ID: EPDNEW_R9729 Type: single initiation site Name: Cxcl13_1 Description: C-X-C motif chemokine ligand 13 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 14 15,258,208 - 15,258,268 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-08
Cxcl13
C-X-C motif chemokine ligand 13
Cxcl13
chemokine (C-X-C motif) ligand 13
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-05
Cxcl13
chemokine (C-X-C motif) ligand 13
LOC498335
similar to Small inducible cytokine B13 precursor (CXCL13) (B lymphocyte chemoattractant) (CXC chemokine BLC)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-02-09
LOC498335
similar to Small inducible cytokine B13 precursor (CXCL13) (B lymphocyte chemoattractant) (CXC chemokine BLC)
Symbol and Name status set to provisional
70820 PROVISIONAL
