Symbol:
Cxcl13
Name:
C-X-C motif chemokine ligand 13
RGD ID:
1556887
MGI Page
MGI
Description:
Enables CXCR5 chemokine receptor binding activity and chemokine activity. Involved in several processes, including B cell chemotaxis across high endothelial venule; activation of GTPase activity; and lymph node development. Located in extracellular space. Is expressed in Peyer's patch; aorta; central nervous system; and retina. Orthologous to human CXCL13 (C-X-C motif chemokine ligand 13).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
4631412M08Rik; ANG; Angie; ANGIE2; B lymphocyte chemoattractant; BCA-; BCA-1; BL; BLC; BLR1L; C-X-C motif chemokine 13; chemokine (C-X-C motif) ligand 13; CXC chemokine BLC; hypothetical protein LOC108786; RIKEN cDNA 4631412M08 gene; Scyb1; Scyb13; small inducible cytokine subfamily B (Cys-X-Cys), member 13; small-inducible cytokine B13
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CXCL13 (C-X-C motif chemokine ligand 13) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Cxcl13 (C-X-C motif chemokine ligand 13) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cxcl13 (C-X-C motif chemokine ligand 13) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CXCL13 (C-X-C motif chemokine ligand 13) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CXCL13 (C-X-C motif chemokine ligand 13) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cxcl13 (C-X-C motif chemokine ligand 13) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CXCL13 (C-X-C motif chemokine ligand 13) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CXCL13 (C-X-C motif chemokine ligand 13) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cxcl13 (C-X-C motif chemokine ligand 13) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
CXCL13 (C-X-C motif chemokine ligand 13)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Rattus norvegicus (Norway rat):
Cxcl13 (C-X-C motif chemokine ligand 13)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 96,104,785 - 96,108,927 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 96,104,810 - 96,108,927 (+) Ensembl GRCm39 Ensembl GRCm38 5 95,956,939 - 95,961,068 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 95,956,951 - 95,961,068 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 96,385,958 - 96,390,087 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 96,197,241 - 96,201,370 (+) NCBI MGSCv36 mm8 Celera 5 93,306,539 - 93,310,668 (+) NCBI Celera Cytogenetic Map 5 E3 NCBI cM Map 5 47.29 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cxcl13 Mouse 1,2-dimethylhydrazine multiple interactions ISO Cxcl13 (Rattus norvegicus) 6480464 [APC protein affects the susceptibility to 1 and 2-Dimethylhydrazine] which results in increased expression of CXCL13 mRNA CTD PMID:27840820 Cxcl13 Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1 and 2-Dimethylhydrazine results in increased expression of CXCL13 mRNA CTD PMID:22206623 Cxcl13 Mouse 1-naphthyl isothiocyanate decreases expression ISO Cxcl13 (Rattus norvegicus) 6480464 1-Naphthylisothiocyanate results in decreased expression of CXCL13 mRNA CTD PMID:25380136 and PMID:30723492 Cxcl13 Mouse 1-nitropyrene decreases expression ISO CXCL13 (Homo sapiens) 6480464 1-nitropyrene results in decreased expression of CXCL13 mRNA CTD PMID:19428942 Cxcl13 Mouse 17beta-estradiol multiple interactions ISO Cxcl13 (Rattus norvegicus) 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of CXCL13 mRNA CTD PMID:32741896 Cxcl13 Mouse 17beta-estradiol increases expression ISO Cxcl13 (Rattus norvegicus) 6480464 Estradiol results in increased expression of CXCL13 mRNA CTD PMID:32145629 Cxcl13 Mouse 17beta-estradiol 3-benzoate multiple interactions ISO Cxcl13 (Rattus norvegicus) 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of CXCL13 mRNA CTD PMID:32741896 Cxcl13 Mouse 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Cxcl13 (Rattus norvegicus) 6480464 [3 more ... CTD PMID:16984957 Cxcl13 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO CXCL13 (Homo sapiens) 6480464 [Tetrachlorodibenzodioxin results in increased activity of AHR protein] which results in increased expression of CXCL13 mRNA and Tetrachlorodibenzodioxin promotes the reaction [[AHR protein binds to RELB protein] which binds to CXCL13 promoter] CTD PMID:17900530 Cxcl13 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Cxcl13 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of CXCL13 mRNA CTD PMID:34747641 Cxcl13 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of CXCL13 mRNA CTD PMID:26377647 and PMID:28922406 Cxcl13 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO CXCL13 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of CXCL13 mRNA CTD PMID:20106945 and PMID:26159488 Cxcl13 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO CXCL13 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of CXCL13 mRNA CTD PMID:22298810 Cxcl13 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Cxcl13 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of CXCL13 mRNA CTD PMID:21215274 Cxcl13 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Cxcl13 (Rattus norvegicus) 6480464 AHR protein alternative form affects the reaction [Tetrachlorodibenzodioxin results in decreased expression of CXCL13 mRNA] CTD PMID:21215274 Cxcl13 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CXCL13 mRNA CTD PMID:19770486 more ... Cxcl13 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to CXCL13 promoter] CTD PMID:19654925 Cxcl13 Mouse 2,4,6-trinitrobenzenesulfonic acid increases expression EXP 6480464 Trinitrobenzenesulfonic Acid results in increased expression of CXCL13 mRNA CTD PMID:15973123 Cxcl13 Mouse 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression EXP 6480464 2 more ... CTD PMID:38648751 Cxcl13 Mouse 3,3',4,4',5-pentachlorobiphenyl multiple interactions ISO Cxcl13 (Rattus norvegicus) 6480464 [3 more ... CTD PMID:16984957 Cxcl13 Mouse 3,3',4,4',5-pentachlorobiphenyl decreases expression ISO Cxcl13 (Rattus norvegicus) 6480464 3 more ... CTD PMID:23196670 Cxcl13 Mouse 3-chloropropane-1,2-diol increases expression ISO Cxcl13 (Rattus norvegicus) 6480464 alpha-Chlorohydrin results in increased expression of CXCL13 mRNA CTD PMID:20409345 Cxcl13 Mouse 3-chloropropane-1,2-diol decreases expression ISO Cxcl13 (Rattus norvegicus) 6480464 alpha-Chlorohydrin results in decreased expression of CXCL13 mRNA CTD PMID:28522335 Cxcl13 Mouse 4,4'-diaminodiphenylmethane decreases expression ISO Cxcl13 (Rattus norvegicus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of CXCL13 mRNA CTD PMID:25380136 Cxcl13 Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of CXCL13 mRNA CTD PMID:39298647 Cxcl13 Mouse 7,12-dimethyltetraphene affects expression EXP 6480464 9 more ... CTD PMID:21785161 Cxcl13 Mouse acrylamide decreases expression ISO Cxcl13 (Rattus norvegicus) 6480464 Acrylamide results in decreased expression of CXCL13 mRNA CTD PMID:28959563 Cxcl13 Mouse aflatoxin B1 increases expression ISO Cxcl13 (Rattus norvegicus) 6480464 Aflatoxin B1 results in increased expression of CXCL13 mRNA CTD PMID:23630614 more ... Cxcl13 Mouse aflatoxin B1 decreases expression ISO CXCL13 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of CXCL13 mRNA CTD PMID:32234424 Cxcl13 Mouse alpha-Zearalanol increases expression ISO Cxcl13 (Rattus norvegicus) 6480464 Zeranol results in increased expression of CXCL13 mRNA CTD PMID:35163327 Cxcl13 Mouse andrographolide multiple interactions EXP 6480464 [andrographolide co-treated with beta-Naphthoflavone] results in decreased expression of CXCL13 mRNA CTD PMID:19737545 Cxcl13 Mouse antirheumatic drug decreases expression ISO CXCL13 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of CXCL13 mRNA CTD PMID:24449571 Cxcl13 Mouse asperentin increases expression EXP 6480464 cladosporin results in increased expression of CXCL13 mRNA CTD PMID:19818335 Cxcl13 Mouse benzo[a]pyrene decreases expression ISO CXCL13 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of CXCL13 mRNA CTD PMID:20106945 Cxcl13 Mouse benzo[a]pyrene increases methylation ISO CXCL13 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of CXCL13 promoter CTD PMID:27901495 Cxcl13 Mouse benzo[a]pyrene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of CXCL13 mRNA CTD PMID:27858113 Cxcl13 Mouse benzo[a]pyrene decreases expression ISO Cxcl13 (Rattus norvegicus) 6480464 Benzo(a)pyrene results in decreased expression of CXCL13 mRNA CTD PMID:21839799 Cxcl13 Mouse benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of CXCL13 mRNA CTD PMID:19770486 Cxcl13 Mouse benzo[b]fluoranthene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of CXCL13 mRNA CTD PMID:27858113 Cxcl13 Mouse Benzo[k]fluoranthene increases expression EXP 6480464 benzo(k)fluoranthene results in increased expression of CXCL13 mRNA CTD PMID:26377693 Cxcl13 Mouse beta-naphthoflavone multiple interactions EXP 6480464 [andrographolide co-treated with beta-Naphthoflavone] results in decreased expression of CXCL13 mRNA CTD PMID:19737545 Cxcl13 Mouse bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of CXCL13 mRNA CTD PMID:28085963 and PMID:35550907 Cxcl13 Mouse bis(2-ethylhexyl) phthalate multiple interactions ISO CXCL13 (Homo sapiens) 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in decreased expression of CXCL13 mRNA CTD PMID:32949613 Cxcl13 Mouse bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate] affects the expression of and affects the secretion of CXCL13 protein CTD PMID:38954831 Cxcl13 Mouse bisphenol A decreases expression ISO Cxcl13 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of CXCL13 mRNA CTD PMID:25181051 Cxcl13 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CXCL13 mRNA CTD PMID:32156529 and PMID:38701888 Cxcl13 Mouse bisphenol A increases expression ISO Cxcl13 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of CXCL13 mRNA CTD PMID:33296240 Cxcl13 Mouse bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of CXCL13 mRNA CTD PMID:38685157 Cxcl13 Mouse bleomycin A2 affects expression EXP 6480464 Bleomycin affects the expression of CXCL13 mRNA CTD PMID:26345256 Cxcl13 Mouse Brevianamide A increases expression EXP 6480464 brevianamide A results in increased expression of CXCL13 mRNA CTD PMID:19818335 Cxcl13 Mouse bromobenzene decreases expression ISO Cxcl13 (Rattus norvegicus) 6480464 bromobenzene results in decreased expression of CXCL13 mRNA CTD PMID:32479839 Cxcl13 Mouse Butylbenzyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate] affects the expression of and affects the secretion of CXCL13 protein CTD PMID:38954831 Cxcl13 Mouse Butylbenzyl phthalate multiple interactions ISO CXCL13 (Homo sapiens) 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in decreased expression of CXCL13 mRNA CTD PMID:32949613 Cxcl13 Mouse cadmium dichloride decreases expression ISO Cxcl13 (Rattus norvegicus) 6480464 Cadmium Chloride results in decreased expression of CXCL13 mRNA CTD PMID:25993096 Cxcl13 Mouse carbamazepine affects expression ISO CXCL13 (Homo sapiens) 6480464 Carbamazepine affects the expression of CXCL13 mRNA CTD PMID:25979313 Cxcl13 Mouse carbon nanotube increases expression EXP 6480464 Nanotubes and Carbon results in increased expression of CXCL13 mRNA CTD PMID:25554681 and PMID:25620056 Cxcl13 Mouse carbon nanotube increases expression ISO CXCL13 (Homo sapiens) 6480464 Nanotubes and Carbon results in increased expression of CXCL13 mRNA CTD PMID:29348435 Cxcl13 Mouse carbon nanotube affects expression EXP 6480464 Nanotubes and Carbon analog affects the expression of CXCL13 mRNA CTD PMID:25554681 Cxcl13 Mouse cefaloridine increases expression ISO Cxcl13 (Rattus norvegicus) 6480464 Cephaloridine results in increased expression of CXCL13 mRNA CTD PMID:18500788 Cxcl13 Mouse CGP 52608 multiple interactions ISO CXCL13 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to CXCL13 gene] CTD PMID:28238834 Cxcl13 Mouse choline multiple interactions EXP 6480464 [Dietary Fats co-treated with Choline deficiency] results in increased expression of CXCL13 protein and PANX1 gene mutant form inhibits the reaction [[Dietary Fats co-treated with Choline deficiency] results in increased expression of CXCL13 protein] CTD PMID:29246445 Cxcl13 Mouse chrysene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of CXCL13 mRNA CTD PMID:27858113 Cxcl13 Mouse ciguatoxin CTX1B affects expression EXP 6480464 Ciguatoxins affects the expression of CXCL13 mRNA CTD PMID:18353800 Cxcl13 Mouse cyclosporin A decreases expression ISO CXCL13 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of CXCL13 mRNA CTD PMID:20106945 Cxcl13 Mouse cyclosporin A increases expression ISO Cxcl13 (Rattus norvegicus) 6480464 Cyclosporine results in increased expression of CXCL13 mRNA CTD PMID:21865292 Cxcl13 Mouse decabromodiphenyl ether decreases expression ISO Cxcl13 (Rattus norvegicus) 6480464 decabromobiphenyl ether results in decreased expression of CXCL13 mRNA CTD PMID:23640034 Cxcl13 Mouse dextran sulfate increases expression EXP 6480464 Dextran Sulfate results in increased expression of CXCL13 mRNA CTD PMID:23894361 and PMID:35093514 Cxcl13 Mouse dibutyl phthalate affects expression ISO Cxcl13 (Rattus norvegicus) 6480464 Dibutyl Phthalate affects the expression of CXCL13 mRNA CTD PMID:30934153 Cxcl13 Mouse dibutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate] affects the expression of and affects the secretion of CXCL13 protein CTD PMID:38954831 Cxcl13 Mouse dibutylstannane multiple interactions ISO CXCL13 (Homo sapiens) 6480464 [di-n-butyltin co-treated with LHB protein] results in decreased secretion of CXCL13 protein CTD PMID:38630605 Cxcl13 Mouse diclofenac increases expression EXP 6480464 Diclofenac results in increased expression of CXCL13 mRNA CTD PMID:26934552 Cxcl13 Mouse diethyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate] affects the expression of and affects the secretion of CXCL13 protein CTD PMID:38954831 Cxcl13 Mouse diisobutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate] affects the expression of and affects the secretion of CXCL13 protein CTD PMID:38954831 Cxcl13 Mouse diisononyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate] affects the expression of and affects the secretion of CXCL13 protein CTD PMID:38954831 Cxcl13 Mouse diisononyl phthalate multiple interactions ISO CXCL13 (Homo sapiens) 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in decreased expression of CXCL13 mRNA CTD PMID:32949613 Cxcl13 Mouse doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of CXCL13 mRNA CTD PMID:28608983 Cxcl13 Mouse epoxiconazole increases expression EXP 6480464 epoxiconazole results in increased expression of CXCL13 mRNA CTD PMID:35436446 Cxcl13 Mouse fentanyl increases expression ISO Cxcl13 (Rattus norvegicus) 6480464 Fentanyl results in increased expression of CXCL13 mRNA CTD PMID:36032789 Cxcl13 Mouse furan increases expression ISO Cxcl13 (Rattus norvegicus) 6480464 furan results in increased expression of CXCL13 mRNA CTD PMID:27387713 Cxcl13 Mouse genistein increases expression EXP 6480464 Genistein results in increased expression of CXCL13 mRNA CTD PMID:32186404 Cxcl13 Mouse gentamycin decreases expression ISO Cxcl13 (Rattus norvegicus) 6480464 Gentamicins results in decreased expression of CXCL13 mRNA CTD PMID:33387578 Cxcl13 Mouse graphene oxide increases expression EXP 6480464 graphene oxide results in increased expression of CXCL13 mRNA CTD PMID:33227293 Cxcl13 Mouse iron(2+) sulfate (anhydrous) decreases expression ISO CXCL13 (Homo sapiens) 6480464 ferrous sulfate results in decreased expression of CXCL13 mRNA CTD PMID:19428942 Cxcl13 Mouse isoprenaline increases expression EXP 6480464 Isoproterenol results in increased expression of CXCL13 mRNA CTD PMID:20003209 Cxcl13 Mouse lead nitrate multiple interactions ISO CXCL13 (Homo sapiens) 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in decreased expression of CXCL13 mRNA CTD PMID:32949613 Cxcl13 Mouse lidocaine decreases expression ISO Cxcl13 (Rattus norvegicus) 6480464 Lidocaine results in decreased expression of CXCL13 mRNA CTD PMID:35283115 Cxcl13 Mouse lipopolysaccharide increases expression EXP 6480464 Lipopolysaccharides results in increased expression of CXCL13 mRNA CTD PMID:19136613 and PMID:27339419 Cxcl13 Mouse lipopolysaccharide increases expression ISO CXCL13 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of CXCL13 mRNA CTD PMID:35811015 Cxcl13 Mouse lipopolysaccharide multiple interactions ISO CXCL13 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of CXCL13 mRNA CTD PMID:35811015 Cxcl13 Mouse mercury atom multiple interactions ISO CXCL13 (Homo sapiens) 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in decreased expression of CXCL13 mRNA CTD PMID:32949613 Cxcl13 Mouse mercury(0) multiple interactions ISO CXCL13 (Homo sapiens) 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in decreased expression of CXCL13 mRNA CTD PMID:32949613 Cxcl13 Mouse metformin decreases expression ISO Cxcl13 (Rattus norvegicus) 6480464 Metformin results in decreased expression of CXCL13 mRNA CTD PMID:31324951 Cxcl13 Mouse methylmercury chloride increases expression ISO CXCL13 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of CXCL13 mRNA CTD PMID:28001369 Cxcl13 Mouse methylmercury chloride increases expression ISO Cxcl13 (Rattus norvegicus) 6480464 methylmercuric chloride results in increased expression of CXCL13 mRNA CTD PMID:31378766 Cxcl13 Mouse mifepristone decreases expression ISO CXCL13 (Homo sapiens) 6480464 Mifepristone results in decreased expression of CXCL13 mRNA CTD PMID:17584828 Cxcl13 Mouse mycotoxin increases expression EXP 6480464 Mycotoxins results in increased expression of CXCL13 mRNA CTD PMID:19818335 Cxcl13 Mouse N,N-diethyl-m-toluamide increases expression ISO CXCL13 (Homo sapiens) 6480464 DEET results in increased expression of CXCL13 mRNA CTD PMID:27091632 Cxcl13 Mouse N-nitrosodimethylamine decreases expression ISO Cxcl13 (Rattus norvegicus) 6480464 Dimethylnitrosamine results in decreased expression of CXCL13 mRNA CTD PMID:25380136 Cxcl13 Mouse neoechinulin A decreases expression EXP 6480464 neoechinulin A results in decreased expression of CXCL13 mRNA CTD PMID:19818335 Cxcl13 Mouse nickel dichloride multiple interactions ISO CXCL13 (Homo sapiens) 6480464 nickel chloride inhibits the reaction [lipopolysaccharide and E. coli O26-B6 results in increased expression of CXCL13 mRNA] CTD PMID:23090859 Cxcl13 Mouse nitrofen increases expression ISO Cxcl13 (Rattus norvegicus) 6480464 nitrofen results in increased expression of CXCL13 mRNA CTD PMID:33484710 Cxcl13 Mouse O-methyleugenol decreases expression ISO CXCL13 (Homo sapiens) 6480464 methyleugenol results in decreased expression of CXCL13 mRNA CTD PMID:32234424 Cxcl13 Mouse okadaic acid decreases expression ISO CXCL13 (Homo sapiens) 6480464 Okadaic Acid results in decreased expression of CXCL13 mRNA CTD PMID:38832940 Cxcl13 Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of CXCL13 mRNA CTD PMID:34911549 Cxcl13 Mouse paracetamol increases expression ISO CXCL13 (Homo sapiens) 6480464 Acetaminophen results in increased expression of CXCL13 mRNA CTD PMID:26690555 Cxcl13 Mouse paracetamol decreases expression ISO Cxcl13 (Rattus norvegicus) 6480464 Acetaminophen results in decreased expression of CXCL13 mRNA CTD PMID:33387578 Cxcl13 Mouse paracetamol decreases expression ISO CXCL13 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of CXCL13 mRNA CTD PMID:29067470 Cxcl13 Mouse perfluorooctanoic acid increases expression ISO Cxcl13 (Rattus norvegicus) 6480464 perfluorooctanoic acid results in increased expression of CXCL13 mRNA CTD PMID:35163327 Cxcl13 Mouse phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of CXCL13 mRNA CTD PMID:19270015 Cxcl13 Mouse pirinixic acid multiple interactions EXP 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of CXCL13 mRNA CTD PMID:19710929 Cxcl13 Mouse pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of CXCL13 mRNA CTD PMID:17426115 Cxcl13 Mouse rotenone decreases expression ISO Cxcl13 (Rattus norvegicus) 6480464 Rotenone results in decreased expression of CXCL13 mRNA CTD PMID:28374803 Cxcl13 Mouse S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO CXCL13 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of CXCL13 mRNA CTD PMID:35811015 Cxcl13 Mouse serpentine asbestos increases expression ISO CXCL13 (Homo sapiens) 6480464 Asbestos and Serpentine results in increased expression of CXCL13 mRNA CTD PMID:33581214 Cxcl13 Mouse silicon dioxide decreases expression ISO CXCL13 (Homo sapiens) 6480464 Silicon Dioxide results in decreased expression of CXCL13 mRNA CTD PMID:19428942 Cxcl13 Mouse silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of CXCL13 mRNA CTD PMID:38811393 Cxcl13 Mouse silicon dioxide increases expression ISO Cxcl13 (Rattus norvegicus) 6480464 Silicon Dioxide results in increased expression of CXCL13 mRNA CTD PMID:22431001 and PMID:32721576 Cxcl13 Mouse sirolimus decreases expression ISO Cxcl13 (Rattus norvegicus) 6480464 Sirolimus results in decreased expression of CXCL13 mRNA CTD PMID:21865292 Cxcl13 Mouse sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of CXCL13 mRNA CTD PMID:21911445 Cxcl13 Mouse sodium arsenite decreases expression ISO CXCL13 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of CXCL13 mRNA CTD PMID:29301061 Cxcl13 Mouse sodium arsenite affects methylation ISO CXCL13 (Homo sapiens) 6480464 sodium arsenite affects the methylation of CXCL13 gene CTD PMID:28589171 Cxcl13 Mouse sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of CXCL13 mRNA CTD PMID:21911445 Cxcl13 Mouse sodium arsenite increases expression ISO CXCL13 (Homo sapiens) 6480464 sodium arsenite results in increased expression of CXCL13 mRNA CTD PMID:17879257 Cxcl13 Mouse sodium dichromate decreases expression ISO Cxcl13 (Rattus norvegicus) 6480464 sodium bichromate results in decreased expression of CXCL13 mRNA CTD PMID:25993096 Cxcl13 Mouse sterigmatocystin increases expression EXP 6480464 Sterigmatocystin results in increased expression of CXCL13 mRNA CTD PMID:19818335 Cxcl13 Mouse succimer multiple interactions ISO CXCL13 (Homo sapiens) 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in increased expression of CXCL13 mRNA CTD PMID:26378955 Cxcl13 Mouse succimer multiple interactions EXP 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in increased expression of CXCL13 mRNA CTD PMID:26378955 Cxcl13 Mouse sunitinib decreases expression EXP 6480464 Sunitinib results in decreased expression of CXCL13 mRNA CTD PMID:27560553 Cxcl13 Mouse taurocholic acid multiple interactions EXP 6480464 EGR1 promotes the reaction [Taurocholic Acid results in increased expression of CXCL13 mRNA] CTD PMID:21224055 Cxcl13 Mouse taurocholic acid increases expression EXP 6480464 Taurocholic Acid results in increased expression of CXCL13 mRNA CTD PMID:21224055 Cxcl13 Mouse testosterone multiple interactions ISO Cxcl13 (Rattus norvegicus) 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of CXCL13 mRNA CTD PMID:32741896 Cxcl13 Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of CXCL13 mRNA CTD PMID:27339419 Cxcl13 Mouse tetraphene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of CXCL13 mRNA CTD PMID:27858113 Cxcl13 Mouse thioacetamide decreases expression ISO Cxcl13 (Rattus norvegicus) 6480464 Thioacetamide results in decreased expression of CXCL13 mRNA CTD PMID:34492290 Cxcl13 Mouse titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of CXCL13 mRNA CTD PMID:23131501 and PMID:23557971 Cxcl13 Mouse tofacitinib decreases expression ISO CXCL13 (Homo sapiens) 6480464 tofacitinib results in decreased expression of CXCL13 mRNA CTD PMID:25398374 Cxcl13 Mouse toluene 2,4-diisocyanate decreases expression EXP 6480464 Toluene 2 and 4-Diisocyanate results in decreased expression of CXCL13 mRNA CTD PMID:21404309 Cxcl13 Mouse tributylstannane multiple interactions ISO CXCL13 (Homo sapiens) 6480464 [tributyltin co-treated with LHB protein] results in decreased secretion of CXCL13 protein CTD PMID:38630605 Cxcl13 Mouse trichloroethene decreases expression ISO Cxcl13 (Rattus norvegicus) 6480464 Trichloroethylene results in decreased expression of CXCL13 mRNA CTD PMID:33387578 Cxcl13 Mouse trimellitic anhydride increases expression EXP 6480464 trimellitic anhydride results in increased expression of CXCL13 mRNA CTD PMID:16141432 Cxcl13 Mouse vinclozolin decreases expression ISO Cxcl13 (Rattus norvegicus) 6480464 vinclozolin results in decreased expression of CXCL13 mRNA CTD PMID:23160963 Cxcl13 Mouse zinc dichloride decreases expression ISO CXCL13 (Homo sapiens) 6480464 zinc chloride results in decreased expression of CXCL13 mRNA CTD PMID:19428942
1,2-dimethylhydrazine (EXP,ISO) 1-naphthyl isothiocyanate (ISO) 1-nitropyrene (ISO) 17beta-estradiol (ISO) 17beta-estradiol 3-benzoate (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrobenzenesulfonic acid (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3-chloropropane-1,2-diol (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (EXP) 7,12-dimethyltetraphene (EXP) acrylamide (ISO) aflatoxin B1 (ISO) alpha-Zearalanol (ISO) andrographolide (EXP) antirheumatic drug (ISO) asperentin (EXP) benzo[a]pyrene (EXP,ISO) benzo[b]fluoranthene (EXP) Benzo[k]fluoranthene (EXP) beta-naphthoflavone (EXP) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) bleomycin A2 (EXP) Brevianamide A (EXP) bromobenzene (ISO) Butylbenzyl phthalate (EXP,ISO) cadmium dichloride (ISO) carbamazepine (ISO) carbon nanotube (EXP,ISO) cefaloridine (ISO) CGP 52608 (ISO) choline (EXP) chrysene (EXP) ciguatoxin CTX1B (EXP) cyclosporin A (ISO) decabromodiphenyl ether (ISO) dextran sulfate (EXP) dibutyl phthalate (EXP,ISO) dibutylstannane (ISO) diclofenac (EXP) diethyl phthalate (EXP) diisobutyl phthalate (EXP) diisononyl phthalate (EXP,ISO) doxorubicin (EXP) epoxiconazole (EXP) fentanyl (ISO) furan (ISO) genistein (EXP) gentamycin (ISO) graphene oxide (EXP) iron(2+) sulfate (anhydrous) (ISO) isoprenaline (EXP) lead nitrate (ISO) lidocaine (ISO) lipopolysaccharide (EXP,ISO) mercury atom (ISO) mercury(0) (ISO) metformin (ISO) methylmercury chloride (ISO) mifepristone (ISO) mycotoxin (EXP) N,N-diethyl-m-toluamide (ISO) N-nitrosodimethylamine (ISO) neoechinulin A (EXP) nickel dichloride (ISO) nitrofen (ISO) O-methyleugenol (ISO) okadaic acid (ISO) ozone (EXP) paracetamol (ISO) perfluorooctanoic acid (ISO) phenobarbital (EXP) pirinixic acid (EXP) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) serpentine asbestos (ISO) silicon dioxide (EXP,ISO) sirolimus (ISO) sodium arsenite (EXP,ISO) sodium dichromate (ISO) sterigmatocystin (EXP) succimer (EXP,ISO) sunitinib (EXP) taurocholic acid (EXP) testosterone (ISO) tetrachloromethane (EXP) tetraphene (EXP) thioacetamide (ISO) titanium dioxide (EXP) tofacitinib (ISO) toluene 2,4-diisocyanate (EXP) tributylstannane (ISO) trichloroethene (ISO) trimellitic anhydride (EXP) vinclozolin (ISO) zinc dichloride (ISO)
Cxcl13 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 96,104,785 - 96,108,927 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 96,104,810 - 96,108,927 (+) Ensembl GRCm39 Ensembl GRCm38 5 95,956,939 - 95,961,068 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 95,956,951 - 95,961,068 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 96,385,958 - 96,390,087 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 96,197,241 - 96,201,370 (+) NCBI MGSCv36 mm8 Celera 5 93,306,539 - 93,310,668 (+) NCBI Celera Cytogenetic Map 5 E3 NCBI cM Map 5 47.29 NCBI
CXCL13 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 77,511,753 - 77,611,834 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 77,511,753 - 77,611,834 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 78,432,907 - 78,532,988 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 78,651,931 - 78,752,010 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 78,790,084 - 78,890,165 NCBI Celera 4 75,734,287 - 75,834,362 (+) NCBI Celera Cytogenetic Map 4 q21.1 NCBI HuRef 4 74,184,783 - 74,284,964 (+) NCBI HuRef CHM1_1 4 78,409,854 - 78,509,941 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 80,852,591 - 80,952,672 (+) NCBI T2T-CHM13v2.0
Cxcl13 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 13,912,858 - 13,917,920 (-) NCBI GRCr8 mRatBN7.2 14 13,608,894 - 13,613,965 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 13,608,902 - 13,613,933 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 13,576,171 - 13,581,214 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 14,876,016 - 14,881,059 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 13,592,498 - 13,597,541 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 15,253,146 - 15,258,221 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 15,253,125 - 15,258,207 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 15,193,472 - 15,198,546 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 15,126,332 - 15,131,368 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 14 13,649,303 - 13,654,347 (-) NCBI Celera Cytogenetic Map 14 p22 NCBI
Cxcl13 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955433 2,123,190 - 2,129,119 (+) NCBI ChiLan1.0 ChiLan1.0
CXCL13 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 52,453,375 - 52,460,491 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 52,639,881 - 52,646,923 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 46,583,759 - 46,589,865 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 52,428,702 - 52,434,803 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 52,428,702 - 52,434,803 (-) Ensembl panpan1.1 panPan2
CXCL13 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 32 2,047,277 - 2,053,277 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 32 2,047,315 - 2,052,833 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 32 39,837,784 - 39,843,805 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 32 2,073,585 - 2,079,610 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 32 2,073,621 - 2,081,627 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 32 2,071,444 - 2,077,479 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 32 2,019,776 - 2,025,803 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 32 38,148,529 - 38,154,567 (-) NCBI UU_Cfam_GSD_1.0
Cxcl13 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405285 10,191,903 - 10,197,633 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936676 1,309,625 - 1,313,933 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936676 1,309,625 - 1,314,532 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CXCL13
CXCL13 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 26,101,489 - 26,108,430 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 26,102,714 - 26,108,690 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 4,454,575 - 4,460,831 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cxcl13
.
Predicted Target Of
Count of predictions: 210 Count of miRNA genes: 181 Interacting mature miRNAs: 195 Transcripts: ENSMUST00000023840 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
4140990 Lgq6_m late growth QTL 6 (mouse) Not determined 32133234 100777931 Mouse 1301010 ahl2_m age related hearing loss 2 (mouse) Not determined 5 62650568 96650688 Mouse 1301399 Cpfd3_m cerebellum pattern fissures (mouse) Not determined 5 87386871 121387065 Mouse 12910784 Pwgrq15_m post-weaning growth rate QTL 15 (mouse) 5 77175823 97658215 Mouse 1301524 Lmb2_m lupus in MRL and B6 F2 cross (mouse) Not determined 5 37581488 112465722 Mouse 25314315 Mlh1fc4_m MLH1 foci count 4 (mouse) 5 74460661 132528839 Mouse 1357725 Eae39_m experimental allergic encephalomyelitis 39 (mouse) Not determined 5 89418876 118864028 Mouse 10045972 Tir5_m trypanosome infection response 5 (mouse) Not determined 5 63705442 104387065 Mouse 1300993 Hycdc_m hypercapnic duty cycle (mouse) Not determined 5 90561006 124561151 Mouse 1301126 Bwem1_m body weight day 30 males 1 (mouse) Not determined 5 87386871 121387065 Mouse 4141219 W10q16_m weight 10 weeks QTL 16 (mouse) Not determined 32133234 100777931 Mouse 12910816 Ogrq2_m overall growth rate QTL 2 (mouse) 5 77175823 97658215 Mouse 1301691 Cdcs10_m cytokine deficiency colitis susceptibility 10 (mouse) Not determined 5 76280786 110280917 Mouse 10402486 Dipa1_m drug induced psychomotor activation 1 (mouse) Not determined 5 95465549 129465722 Mouse 11041665 Lmr24_m leishmaniasis resistance 24 (mouse) 5 52694462 107321041 Mouse 10043958 Chldq12_m cholesterol and HDL QTL 12 (mouse) Not determined 5 87386871 121387065 Mouse 26884395 Humsd2_m humerus midshaft diameter 2, 10 week (mouse) 5 70057343 132528839 Mouse 11252124 Modvl6_m modifier of vacuolated lens 6 (mouse) 5 62650568 96650688 Mouse 1301419 Cypr3_m cytokine production 3 (mouse) Not determined 5 81019649 115019803 Mouse 11341716 Rvfs3_m Rift Valley fever susceptibility 3 (mouse) 5 26441234 138455402 Mouse 13506928 Recrq8_m recombination rate in male meiosis QTL 8 (mouse) 5 74460661 132528839 Mouse 10043993 Hbnr10_m Heligmosomoides bakeri nematode resistance 10 (mouse) Not determined 5 72418876 106419011 Mouse 27226719 Tibw6_m tibia width 6, proximal, 16 week (mouse) 5 72857343 139985755 Mouse 10401246 Bglu13_m blood glucose level 13 (mouse) Not determined 5 79539640 113539786 Mouse 4141438 Skmw13_m skeletal muscle weight 13 (mouse) Not determined 5 76190263 110190479 Mouse 1301713 Dbsty2_m diabesity 2 (mouse) Not determined 5 76445064 110445225 Mouse 1301457 Cfsw2_m cystic fibrosis survival to weaning 2 (mouse) Not determined 5 90561006 124561151 Mouse 11041899 Lmr24a_m leishmaniasis resistance 24a (mouse) 5 52694462 107321041 Mouse 10401245 Bglu18_m blood glucose level 18 (mouse) Not determined 5 82838468 116838597 Mouse 1301974 Chab7_m cholesterol absorption 7 (mouse) Not determined 5 95233214 129233330 Mouse 4142064 Tmc1m4_m Tmc1 modifier 4 (mouse) Not determined 5 54500177 127001072 Mouse 1300931 Cocrb6_m cocaine related behavior 6 (mouse) Not determined 5 76445064 110445225 Mouse 4142317 Rgcs1_m retinal ganglion cell susceptible 1 (mouse) Not determined 55388334 108762627 Mouse 1300801 Drb2_m dopamine receptor binding 2 (mouse) Not determined 5 87386871 121387065 Mouse 1301829 Thyls2_m thymic lymphoma susceptibility 2 (mouse) Not determined 5 76445064 110445225 Mouse 9587780 Afw16_m abdominal fat weight QTL 16 (mouse) Not determined 5 92830166 126830285 Mouse 1357644 Egrd1_m early growth rate, direct effect 1 (mouse) Not determined 5 95434580 129434786 Mouse 12904740 M1fscn2_m modifier 1 of Fscn2 (mouse) 5 66529661 100529661 Mouse 10755524 Mono1_m monocyte differential 1 (mouse) 5 80849259 114849259 Mouse 1301362 Prnr1_m prion resistance 1 (mouse) Not determined 5 89418876 146787935 Mouse 1558774 Lith17_m lithogenic gene 17 (mouse) Not determined 5 95465549 129465722 Mouse 4142428 Modvl1_m modifier of vacuolated lens 1 (mouse) Not determined 62650568 96650688 Mouse 1357431 Cia27_m collagen induced arthritis 27 (mouse) Not determined 5 75315348 120018629 Mouse 12904739 M2fscn2_m modifier 2 of FSCN2 (mouse) 5 66529661 100529661 Mouse 1301243 Bmd2_m bone mineral density 2 (mouse) Not determined 5 55388334 100455525 Mouse 1300986 Hdlq2_m HDL QTL 2 (mouse) Not determined 5 76280786 110280917 Mouse 11049560 Lmr24d_m leishmaniasis resistance 24d (mouse) 5 64374877 98374996 Mouse 11049562 Lmr24f_m leishmaniasis resistance 24f (mouse) 5 90320962 124321041 Mouse 13464249 Ahl16_m age related hearing loss, early onset 16 (mouse) 5 76445064 110445225 Mouse 13464250 Ahl15_m age related hearing loss, early onset 15 (mouse) 5 62650568 96650688 Mouse 13464244 Ahl19_m age related hearing loss, early onset 19 (mouse) 5 95465549 129465722 Mouse 4141124 Dshv2_m dorsal hippocampal volume 2 (mouse) Not determined 5 75315348 98019803 Mouse 1300968 Skts4_m skin tumor susceptibility 4 (mouse) Not determined 5 89418876 124238239 Mouse 13464241 Ahl18_m age related hearing loss, early onset 18 (mouse) 5 87386871 121387065 Mouse 4141505 Chlq14_m circulating hormone level QTL 14 (mouse) Not determined 5 76280786 110280917 Mouse 13464242 Ahl17_m age related hearing loss, early onset 17 (mouse) 5 82838468 116838597 Mouse
BB222854
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 5 95,960,803 - 95,960,952 UniSTS GRCm38 MGSCv37 5 96,389,822 - 96,389,971 UniSTS GRCm37 Celera 5 93,310,403 - 93,310,552 UniSTS Cytogenetic Map 5 E3 UniSTS Whitehead/MRC_RH 5 1154.15 UniSTS
PMC152071P3
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 5 95,959,917 - 95,960,276 UniSTS GRCm38 MGSCv37 5 96,388,936 - 96,389,295 UniSTS GRCm37 Celera 5 93,309,517 - 93,309,876 UniSTS Cytogenetic Map 5 E3 UniSTS
PMC27130P1
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 5 95,958,635 - 95,958,730 UniSTS GRCm38 MGSCv37 5 96,387,654 - 96,387,749 UniSTS GRCm37 Celera 5 93,308,235 - 93,308,330 UniSTS Cytogenetic Map 5 E3 UniSTS cM Map 5 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000023840 ⟹ ENSMUSP00000023840
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 96,104,810 - 96,108,927 (+) Ensembl GRCm38.p6 Ensembl 5 95,956,951 - 95,961,068 (+) Ensembl
RefSeq Acc Id:
NM_018866 ⟹ NP_061354
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 5 96,104,785 - 96,108,927 (+) NCBI GRCm38 5 95,956,939 - 95,961,068 (+) ENTREZGENE MGSCv37 5 96,385,958 - 96,390,087 (+) RGD Celera 5 93,306,539 - 93,310,668 (+) RGD cM Map 5 ENTREZGENE
Sequence:
GAGCTAAAGGTTGAACTCCACCTCCAGGCAGAATGAGGCTCAGCACAGCAACGCTGCTTCTCCTCCTGGCCAGCTGCCTCTCTCCAGGCCACGGTATTCTGGAAGCCCATTACACAAACTTAAAATGT
hide sequence
RefSeq Acc Id:
NP_061354 ⟸ NM_018866
- Peptide Label:
precursor
- UniProtKB:
O55038 (UniProtKB/Swiss-Prot), Q3U1E8 (UniProtKB/TrEMBL)
- Sequence:
MRLSTATLLLLLASCLSPGHGILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQAPVSKRRAA
hide sequence
Ensembl Acc Id:
ENSMUSP00000023840 ⟸ ENSMUST00000023840
RGD ID: 6887218 Promoter ID: EPDNEW_M7060 Type: multiple initiation site Name: Cxcl13_1 Description: Mus musculus chemokine (C-X-C motif) ligand 13 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 5 95,956,926 - 95,956,986 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2023-06-27
Cxcl13
C-X-C motif chemokine ligand 13
Cxcl13
chemokine (C-X-C motif) ligand 13
Symbol and/or name change
5135510 APPROVED
2016-04-05
Cxcl13
chemokine (C-X-C motif) ligand 13
4631412M08Rik
RIKEN cDNA 4631412M08 gene
Data merged from RGD:1609487
737654 PROVISIONAL
