Advanced Search (OLGA)

Gene: Cfap77 (cilia and flagella associated protein 77) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Cfap77

Name:

cilia and flagella associated protein 77

RGD ID:

1564114

Description:

Predicted to be involved in flagellated sperm motility. Predicted to be located in axonemal microtubule. Predicted to be active in axonemal B tubule inner sheath. Orthologous to human CFAP77 (cilia and flagella associated protein 77); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; acrylamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

cilia- and flagella-associated protein 77; hypothetical protein LOC499765; LOC100909960; LOC499765; RGD1564114; similar to FLJ46082 protein; uncharacterized LOC100909960; uncharacterized protein C9orf171 homolog; uncharacterized protein C9orf171-like; uncharacterized protein LOC499765

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	32,656,410 - 32,779,261 (-)	NCBI		GRCr8
mRatBN7.2	3	12,258,453 - 12,381,319 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	12,258,453 - 12,381,319 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	15,331,516 - 15,454,277 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	23,916,487 - 24,039,252 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	22,170,933 - 22,293,704 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	7,508,500 - 7,632,311 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	7,508,496 - 7,632,345 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	12,858,726 - 12,980,874 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	7,934,968 - 8,059,535 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	7,037,739 - 7,160,534 (-)	NCBI		Celera
Cytogenetic Map	3	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cfap77	Rat	developmental and epileptic encephalopathy		ISO	RGD:1604151	8554872	ClinVar Annotator: match by term: Developmental and epileptic encephalopathy	ClinVar	PMID:28492532
Cfap77	Rat	developmental and epileptic encephalopathy 14		ISO	RGD:1604151	8554872	ClinVar Annotator: match by term: Developmental and epileptic encephalopathy, 14	ClinVar	PMID:28492532
Cfap77	Rat	early infantile epileptic encephalopathy		ISO	RGD:1604151	8554872	ClinVar Annotator: match by term: Early infantile epileptic encephalopathy	ClinVar	PMID:28492532
Cfap77	Rat	Ehlers-Danlos syndrome classic type 1		ISO	RGD:1604151	8554872	ClinVar Annotator: match by term: Ehlers-Danlos syndrome, classic type	ClinVar	PMID:28492532
Cfap77	Rat	Leigh disease		ISO	RGD:1604151	8554872	ClinVar Annotator: match by term: Leigh syndrome	ClinVar	PMID:28492532
Cfap77	Rat	primary coenzyme Q10 deficiency 7		ISO	RGD:1604151	8554872	ClinVar Annotator: match by term: Neonatal encephalomyopathy-cardiomyopathy-respiratory distress syndrome	ClinVar	PMID:28492532
Cfap77	Rat	Rafiq syndrome		ISO	RGD:1604151	8554872	ClinVar Annotator: match by term: Rafiq syndrome	ClinVar	PMID:28492532
Cfap77	Rat	tuberous sclerosis 1		ISO	RGD:1604151	8554872	ClinVar Annotator: match by term: Tuberous sclerosis 1	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cfap77	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of CFAP77 mRNA	CTD	PMID:33387578
Cfap77	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:1620452	6480464	bisphenol S results in increased expression of CFAP77 mRNA	CTD	PMID:30951980
Cfap77	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of CFAP77 mRNA	CTD	PMID:24780913
Cfap77	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of CFAP77 mRNA	CTD	PMID:25825206
Cfap77	Rat	acrylamide	decreases expression	EXP		6480464	Acrylamide results in decreased expression of CFAP77 mRNA	CTD	PMID:28959563
Cfap77	Rat	aflatoxin B1	increases methylation	ISO	RGD:1604151	6480464	Aflatoxin B1 results in increased methylation of CFAP77 exon; Aflatoxin B1 results in increased methylation more ...	CTD	PMID:30157460
Cfap77	Rat	Aflatoxin B2 alpha	increases methylation	ISO	RGD:1604151	6480464	aflatoxin B2 results in increased methylation of CFAP77 intron	CTD	PMID:30157460
Cfap77	Rat	atrazine	affects methylation	EXP		6480464	Atrazine affects the methylation of CFAP77 gene	CTD	PMID:35440735
Cfap77	Rat	benzo[a]pyrene	decreases methylation	ISO	RGD:1604151	6480464	Benzo(a)pyrene results in decreased methylation of CFAP77 promoter	CTD	PMID:27901495
Cfap77	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of CFAP77 mRNA	CTD	PMID:25181051
Cfap77	Rat	bisphenol A	decreases methylation	ISO	RGD:1604151	6480464	bisphenol A results in decreased methylation of CFAP77 gene	CTD	PMID:31601247
Cfap77	Rat	bisphenol A	multiple interactions	ISO	RGD:1604151	6480464	[bisphenol A co-treated with Fulvestrant] results in increased methylation of CFAP77 gene	CTD	PMID:31601247
Cfap77	Rat	bisphenol A	increases expression	ISO	RGD:1620452	6480464	bisphenol A results in increased expression of CFAP77 mRNA	CTD	PMID:30951980
Cfap77	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of CFAP77 gene	CTD	PMID:28505145
Cfap77	Rat	bisphenol F	increases expression	ISO	RGD:1620452	6480464	bisphenol F results in increased expression of CFAP77 mRNA	CTD	PMID:30951980
Cfap77	Rat	buta-1,3-diene	decreases expression	ISO	RGD:1620452	6480464	1,3-butadiene results in decreased expression of CFAP77 mRNA	CTD	PMID:29038090
Cfap77	Rat	chlorpyrifos	decreases expression	ISO	RGD:1620452	6480464	Chlorpyrifos results in decreased expression of CFAP77 mRNA	CTD	PMID:37019170
Cfap77	Rat	cisplatin	decreases expression	EXP		6480464	Cisplatin results in decreased expression of CFAP77 mRNA	CTD	PMID:22023808
Cfap77	Rat	Cuprizon	increases expression	EXP		6480464	Cuprizone results in increased expression of CFAP77 mRNA	CTD	PMID:26577399
Cfap77	Rat	dibutyl phthalate	increases expression	EXP		6480464	Dibutyl Phthalate results in increased expression of CFAP77 mRNA	CTD	PMID:21266533
Cfap77	Rat	endosulfan	decreases expression	EXP		6480464	Endosulfan results in decreased expression of CFAP77 mRNA	CTD	PMID:29391264
Cfap77	Rat	fulvestrant	multiple interactions	ISO	RGD:1604151	6480464	[bisphenol A co-treated with Fulvestrant] results in increased methylation of CFAP77 gene	CTD	PMID:31601247
Cfap77	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of CFAP77 mRNA	CTD	PMID:33387578
Cfap77	Rat	glycidyl methacrylate	increases expression	ISO	RGD:1604151	6480464	glycidyl methacrylate results in increased expression of CFAP77 protein	CTD	PMID:36641056
Cfap77	Rat	lead diacetate	decreases expression	EXP		6480464	lead acetate results in decreased expression of CFAP77 mRNA	CTD	PMID:22641619
Cfap77	Rat	linezolid	decreases expression	EXP		6480464	Linezolid results in decreased expression of CFAP77 mRNA	CTD	PMID:21296123
Cfap77	Rat	methoxychlor	affects methylation	EXP		6480464	Methoxychlor affects the methylation of CFAP77 gene	CTD	PMID:35440735
Cfap77	Rat	N,N-diethyl-m-toluamide	multiple interactions	EXP		6480464	[Permethrin co-treated with DEET] results in decreased methylation of CFAP77 gene	CTD	PMID:33148267
Cfap77	Rat	paracetamol	decreases expression	ISO	RGD:1604151	6480464	Acetaminophen results in decreased expression of CFAP77 mRNA	CTD	PMID:22230336
Cfap77	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of CFAP77 mRNA	CTD	PMID:33387578
Cfap77	Rat	permethrin	multiple interactions	EXP		6480464	[Permethrin co-treated with DEET] results in decreased methylation of CFAP77 gene	CTD	PMID:33148267
Cfap77	Rat	permethrin	increases expression	ISO	RGD:1604151	6480464	Permethrin results in increased expression of CFAP77 mRNA	CTD	PMID:37047231
Cfap77	Rat	sodium arsenite	affects expression	ISO	RGD:1604151	6480464	sodium arsenite affects the expression of CFAP77 mRNA	CTD	PMID:29319823
Cfap77	Rat	tetrachloromethane	decreases expression	EXP		6480464	Carbon Tetrachloride results in decreased expression of CFAP77 mRNA	CTD	PMID:31150632
Cfap77	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of CFAP77 mRNA	CTD	PMID:33387578
Cfap77	Rat	triptonide	increases expression	ISO	RGD:1620452	6480464	triptonide results in increased expression of CFAP77 mRNA	CTD	PMID:33045310
Cfap77	Rat	valproic acid	increases methylation	ISO	RGD:1604151	6480464	Valproic Acid results in increased methylation of CFAP77 gene	CTD	PMID:29154799
Cfap77	Rat	vinclozolin	increases expression	EXP		6480464	vinclozolin results in increased expression of CFAP77 mRNA	CTD	PMID:20566332

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cfap77	Rat	flagellated sperm motility	involved_in	IEA	UniProtKB:A0A087WRI3\|ensembl:ENSMUSP00000140645	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cfap77	Rat	axonemal B tubule inner sheath	is_active_in	ISO	RGD:1620452	1624291	PMID:37295417	RGD	PMID:37295417
Cfap77	Rat	axonemal B tubule inner sheath	is_active_in	IEA	UniProtKB:A0A087WRI3\|ensembl:ENSMUSP00000140645	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cfap77	Rat	axonemal microtubule	located_in	ISO	RGD:1604151	1624291	PMID:36191189	RGD	PMID:36191189
Cfap77	Rat	axonemal microtubule	located_in	IEA	UniProtKB:Q6ZQR2\|ensembl:ENSP00000376909	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cfap77	Rat	sperm flagellum	is_active_in	IEA	UniProtKB:A0A087WRI3\|ensembl:ENSMUSP00000140645	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cfap77	Rat	protein binding	enables	ISO	RGD:1604151	1624291	UniProtKB:P15884 PMID:25416956	RGD	PMID:25416956

#	Reference Title	Reference Citation
1.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932

Cfap77
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	32,656,410 - 32,779,261 (-)	NCBI		GRCr8
mRatBN7.2	3	12,258,453 - 12,381,319 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	12,258,453 - 12,381,319 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	15,331,516 - 15,454,277 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	23,916,487 - 24,039,252 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	22,170,933 - 22,293,704 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	7,508,500 - 7,632,311 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	7,508,496 - 7,632,345 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	12,858,726 - 12,980,874 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	7,934,968 - 8,059,535 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	7,037,739 - 7,160,534 (-)	NCBI		Celera
Cytogenetic Map	3	p12	NCBI

CFAP77
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	132,410,211 - 132,573,319 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	132,410,043 - 132,573,319 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	135,285,598 - 135,448,706 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	134,275,432 - 134,438,496 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	9	105,827,436 - 105,990,419 (+)	NCBI		Celera
Cytogenetic Map	9	q34.13	NCBI
HuRef	9	104,778,926 - 104,942,484 (+)	NCBI		HuRef
CHM1_1	9	135,435,625 - 135,599,048 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	144,624,655 - 144,784,525 (+)	NCBI		T2T-CHM13v2.0

Cfap77
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	28,845,493 - 28,945,078 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	28,816,961 - 28,945,078 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	28,955,481 - 29,055,066 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	28,926,949 - 29,055,066 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	28,811,001 - 28,910,586 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	28,777,382 - 28,877,075 (-)	NCBI		MGSCv36	mm8
Celera	2	28,661,281 - 28,761,310 (-)	NCBI		Celera
Cytogenetic Map	2	A3	NCBI
cM Map	2	19.38	NCBI

Cfap77
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955513	1,834,388 - 1,953,638 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955513	1,834,654 - 1,951,827 (+)	NCBI	ChiLan1.0	ChiLan1.0

CFAP77
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	6,785,813 - 6,947,699 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	6,788,151 - 6,950,036 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	103,528,991 - 103,690,634 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	132,162,008 - 132,322,666 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	132,162,008 - 132,322,666 (+)	Ensembl	panpan1.1		panPan2

CFAP77
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	51,721,893 - 51,852,212 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	51,721,839 - 51,852,453 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	50,986,563 - 51,116,854 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	52,614,914 - 52,745,256 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	52,614,913 - 52,745,594 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	51,394,796 - 51,525,164 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	51,719,276 - 51,849,618 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	51,799,032 - 51,935,926 (-)	NCBI		UU_Cfam_GSD_1.0

Cfap77
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	199,218,290 - 199,335,241 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936487	18,986,966 - 19,103,044 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936487	18,986,966 - 19,103,044 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CFAP77
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	272,217,072 - 272,361,733 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	272,216,581 - 272,362,321 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	306,244,364 - 306,394,538 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CFAP77
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	5,566,994 - 5,731,619 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666079	9,890,199 - 10,071,860 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cfap77
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624760	3,779,492 - 3,890,851 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624760	3,780,678 - 3,890,265 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Cfap77
937 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	101
Count of miRNA genes:	75
Interacting mature miRNAs:	92
Transcripts:	ENSRNOT00000049889
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1558647	Cm46	Cardiac mass QTL 46	5.4	0.0000055	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	10778823	30356773	Rat
1358357	Srcrtb1	Stress Responsive Cort Basal QTL 1	6.36	0.002	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	8658162	27494778	Rat
6893355	Bw101	Body weight QTL 101	0.4	0.38	body mass (VT:0001259)	body weight (CMO:0000012)	3	10778704	30357018	Rat
4889966	Bss95	Bone structure and strength QTL 95	4.4		tibia area (VT:1000281)	tibia-fibula cross-sectional area (CMO:0001718)	3	1	36847613	Rat
1558654	Bw56	Body weight QTL 56	4.5	0.0000171	body mass (VT:0001259)	body weight (CMO:0000012)	3	10778704	30357018	Rat
10401810	Kidm53	Kidney mass QTL 53			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	8227194	47233430	Rat
1298526	Arunc3	Aerobic running capacity QTL 3	2.2		exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	8227194	33703538	Rat
8693641	Alc30	Alcohol consumption QTL 30	2	0.739	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	3	10434306	24512004	Rat
1558650	Cm48	Cardiac mass QTL 48	4	0.0001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	3	10778823	30356773	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	10861912	89878372	Rat
70191	BpQTLcluster4	Blood pressure QTL cluster 4	3		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	3	10778704	50302886	Rat
631545	Bp85	Blood pressure QTL 85	3.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	1	33278763	Rat
631679	Cm10	Cardiac mass QTL 10	7.34	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	1	31158234	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
1558657	Cm43	Cardiac mass QTL 43	6.6	3e-08	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	10778823	30356773	Rat
631568	Bp92	Blood pressure QTL 92	2.2	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	1	39874793	Rat
70203	Gcr2	Gastric cancer resistance QTL 2	2.6		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	3	8658162	27494778	Rat
6893363	Bw105	Body weight QTL 105	2.6	0.0036	body mass (VT:0001259)	body weight (CMO:0000012)	3	10778704	30357018	Rat
70202	Alc19	Alcohol consumption QTL 19	2.5		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	3	1	27494778	Rat
2312664	Scl62	Serum cholesterol level QTL 62		0.05	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	1	38710544	Rat
61468	Bp15	Blood pressure QTL 15	4.4		blood pressure trait (VT:0000183)	pulse pressure (CMO:0000292)	3	1	33278763	Rat
631831	Alc8	Alcohol consumption QTL 8	2.7		consumption behavior trait (VT:0002069)	calculated ethanol drink intake rate (CMO:0001615)	3	1	33230976	Rat

RH133252

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	12,258,504 - 12,258,697 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	7,508,552 - 7,508,744	NCBI	Rnor6.0
Rnor_5.0	3	12,858,778 - 12,858,970	UniSTS	Rnor5.0
RGSC_v3.4	3	7,935,020 - 7,935,212	UniSTS	RGSC3.4
Celera	3	7,037,791 - 7,037,983	UniSTS
RH 3.4 Map	3	28.5	UniSTS
Cytogenetic Map	3	p12	UniSTS

AU047988

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	12,308,175 - 12,308,454 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	7,558,217 - 7,558,495	NCBI	Rnor6.0
Rnor_6.0	3	10,916,483 - 10,916,761	NCBI	Rnor6.0
Rnor_5.0	3	12,908,443 - 12,908,721	UniSTS	Rnor5.0
Rnor_5.0	3	16,270,713 - 16,270,991	UniSTS	Rnor5.0
RGSC_v3.4	3	7,984,684 - 7,984,962	UniSTS	RGSC3.4
Celera	3	7,087,441 - 7,087,719	UniSTS
Cytogenetic Map	3	p12	UniSTS

UniSTS:224561

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	12,366,671 - 12,366,891 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	7,617,019 - 7,617,238	NCBI	Rnor6.0
Rnor_5.0	3	12,966,728 - 12,966,947	UniSTS	Rnor5.0
RGSC_v3.4	3	8,044,960 - 8,045,179	UniSTS	RGSC3.4
Celera	3	7,146,085 - 7,146,304	UniSTS
Cytogenetic Map	3	p12	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	1	29	112	86	85	54	25	54	5	179	71	93	44	60	31


RefSeq Transcripts	NM_001127563	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC166521	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000049889 ⟹ ENSRNOP00000050516

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	12,258,453 - 12,381,319 (-)	Ensembl
Rnor_6.0 Ensembl	3	7,508,496 - 7,632,345 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000073625 ⟹ ENSRNOP00000065618

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	12,258,453 - 12,381,288 (-)	Ensembl

RefSeq Acc Id:

NM_001127563 ⟹ NP_001121035

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	32,656,410 - 32,779,261 (-)	NCBI
mRatBN7.2	3	12,258,453 - 12,381,319 (-)	NCBI
Rnor_6.0	3	7,508,500 - 7,632,311 (-)	NCBI
Rnor_5.0	3	12,858,726 - 12,980,874 (-)	NCBI
RGSC_v3.4	3	7,934,968 - 8,059,535 (-)	RGD
Celera	3	7,037,739 - 7,160,534 (-)	RGD

Sequence:

show sequence

CAGCCAGGGTCTGATCCCGGAGACCCCCAGGATGCCTGACCCGGGGAAACCCCGGAAAGACCTCTCGCGATGGAAGAAGAAGAAGCAGCCCGTGCACCGCACGGTCAGCCAGATCTGCCCGCCGCCCC
GACGGCCGCTGACGGTGGTCGACATCCGCCCGGGCATGGAGAACGAAAGGCTGGGGGTCGTGCGTGACTCCATGTTTCAGAACCCGCTCATTGTCAAGGCAGAACTTGGCAAGCCCAGGGAGAGAAGC
TGCAGCCTGCCTGGCGTCGACTTTAATTATGGACTCTACATCCAAGGGATAGATGGAGGGGTTCCTGAAGCCATTGGGCACTGGAATGTGTTTAAGCAGCAACCCACCTGTCCCCATGAGCTGACCCG
GAACTATATTGCCATGAACCGAGGGGCAGTCAAAGCTGGCCTGGTGACTGCCCGGGAAAACATGCTCTATCGTGAACTGAATGACATTCGAATCAATGACCAGGAAGACCGGCGACAGAAGGAGCCGC
CCTCCATCCCTCCCAACATGACCTTTGGCATCCGTTCACGGCCCTCAACACCCTTCTTTGACCTGTTACAACATCGGTACCAGCAGCTATGGATACAGGAGCAGAAGGCCACTCAGCAAGCCATCAAA
ATGGAGAAGAAACAGAAGGTAATCCTGGGAAAGCTGTATGAGACGAGGAGCAGTCAGCTGAGGAAGTACAAGCCTCCTGTGAAGCTGGATACTCTCTGGCACATGCCTCACTTCAAGAAGGCGGTTTC
CCATCTTGATACGTTCCCTACGGATGCCGCTCGCCAGAGGGCTCTCAAAGCCCACAAGGAAGAGCATGCTGTACGCCAGGGCACCCTACGAATGGGCAACTACACCCACCCCTAGCCTCCTCACAGGG
GGAGCCTCCTAGATGCGCTGGGAAAAAAATCCCCAAAGAGCTCAGTTTTCTCCCCCAGACCCCAGGATGACAGTCCTACACTTTGACACAACCCTTTGCCACAGGGACCTCAGATTCAAGTCTTAGGT
TGCTTATTTTCTTTATAAGAACCCCGACCCACACACACCCTTTTGTTACACAACACCAGTCCTGTCTTTCCTCTAGTTTCCCTTTGCCTAGAAACCACCATCCTCCTCAAAATTCTTTTCCCCTTCTC
CTCACCCCTTCCTCTCTTCTTCCCTTTCTCTTTCTATTTTACCCCCTCCTCCTTCAGGAGACCCACTCTGCCTCTTTGCAAGTCTTACTTTACAAGATAAACCAAAAATACAAGGCAGTTCTTTAAAA
AAAAAATATCCAGGCTAAGAGTCAGCTTCACTGCCTATGCCTGTGCACTTCCACAAGGCGTAGCGCCAGTAGGCGTTGGAAGCACTCATTTCTTATTCCAAACACGAGTTTTAATTGCCCTTCTGGGC
ACGGCTGGGGTCTCAACACAGCAGGAGTCTCTCTCTGGGACCCCTGACAGTAGGAAGAACCCGCGGTTCATTACTCAGAGGTAGGCCCCGCCCTCAGTGCTGTGGCCCTGTCAATCAGACAGACCCGC
CTGGACTTCTTAAGACTATCTGGATGTGGTTCACTCTTCCAAAGGAGAATGCCTTGTGGTGGGCAGGTGGCAGCCGTGGACTATCTCTTGATTCATACCTTTCTCTGGTGTCTTTGGCTTCTCTCCAC
AAATTACAAAGGGATTTATTTTAAATATAAAAAGATGACTTGCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_001121035	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI66521	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000050516
	ENSRNOP00000050516.2
	ENSRNOP00000065618.2

RefSeq Acc Id:

NP_001121035 ⟸ NM_001127563

- UniProtKB:

B2GV45 (UniProtKB/TrEMBL), M0R828 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPDPGKPRKDLSRWKKKKQPVHRTVSQICPPPRRPLTVVDIRPGMENERLGVVRDSMFQNPLIVKAELGKPRERSCSLPGVDFNYGLYIQGIDGGVPEAIGHWNVFKQQPTCPHELTRNYIAMNRGAV
KAGLVTARENMLYRELNDIRINDQEDRRQKEPPSIPPNMTFGIRSRPSTPFFDLLQHRYQQLWIQEQKATQQAIKMEKKQKVILGKLYETRSSQLRKYKPPVKLDTLWHMPHFKKAVSHLDTFPTDAA
RQRALKAHKEEHAVRQGTLRMGNYTHP

hide sequence

Ensembl Acc Id:

ENSRNOP00000050516 ⟸ ENSRNOT00000049889

Ensembl Acc Id:

ENSRNOP00000065618 ⟸ ENSRNOT00000073625

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B2GV45-F1-model_v2	AlphaFold	B2GV45	1-283	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13691940

Promoter ID:

EPDNEW_R2465

Type:

multiple initiation site

Name:

Cfap77_1

Description:

cilia and flagella associated protein 77

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	7,632,330 - 7,632,390	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-50265	BioCyc
Ensembl Genes	ENSRNOG00000028805	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000049889	ENTREZGENE
	ENSRNOT00000049889.4	UniProtKB/TrEMBL
	ENSRNOT00000073625.2	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7133997	IMAGE-MGC_LOAD
InterPro	DUF4483	UniProtKB/TrEMBL
KEGG Report	rno:499765	UniProtKB/TrEMBL
MGC_CLONE	MGC:188104	IMAGE-MGC_LOAD
NCBI Gene	499765	ENTREZGENE
PANTHER	CILIA- AND FLAGELLA-ASSOCIATED PROTEIN 77	UniProtKB/TrEMBL
	PTHR28617	UniProtKB/TrEMBL
Pfam	DUF4483	UniProtKB/TrEMBL
PhenoGen	Cfap77	PhenoGen
RatGTEx	ENSRNOG00000028805	RatGTEx
UniProt	B2GV45	ENTREZGENE, UniProtKB/TrEMBL
	M0R828	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Cfap77	cilia and flagella associated protein 77	LOC100909960	uncharacterized LOC100909960	Data merged from RGD:6501108	737654	PROVISIONAL
2015-10-26	Cfap77	cilia and flagella associated protein 77	RGD1564114	similar to FLJ46082 protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-07-05	LOC100909960	uncharacterized LOC100909960			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-04-30	RGD1564114	similar to FLJ46082 protein	RGD1564114_predicted	similar to FLJ46082 protein (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-07	RGD1564114_predicted	similar to FLJ46082 protein (predicted)	LOC499765	similar to FLJ46082 protein	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC499765	similar to FLJ46082 protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar