Symbol:
Ncoa4
Name:
nuclear receptor coactivator 4
RGD ID:
1563014
Description:
Predicted to enable transcription coactivator activity. Involved in response to hormone. Predicted to be located in autolysosome. Orthologous to human NCOA4 (nuclear receptor coactivator 4); PARTICIPATES IN iron homeostasis pathway; thyroid cancer pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
MGC72479
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 7,395,502 - 7,415,846 (+) NCBI GRCr8 mRatBN7.2 16 7,389,222 - 7,409,564 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 7,366,542 - 7,409,556 (+) Ensembl mRatBN7.2 Ensembl mRatBN7.2 Ensembl 16 7,366,542 - 7,409,641 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 7,401,738 - 7,422,128 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 8,546,594 - 8,566,985 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 7,399,986 - 7,420,330 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 8,302,950 - 8,323,294 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 8,302,950 - 8,323,293 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 8,219,983 - 8,240,326 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 7,642,116 - 7,662,460 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 16 7,789,196 - 7,809,198 (-) NCBI Celera Cytogenetic Map 16 p16 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ncoa4 Rat 1,2-dichloroethane increases expression ISO Ncoa4 (Mus musculus) 6480464 ethylene dichloride results in increased expression of NCOA4 mRNA CTD PMID:28960355 Ncoa4 Rat 1,2-dimethylhydrazine multiple interactions ISO Ncoa4 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of NCOA4 mRNA CTD PMID:22206623 Ncoa4 Rat 1,2-dimethylhydrazine affects expression ISO Ncoa4 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine affects the expression of NCOA4 mRNA CTD PMID:22206623 Ncoa4 Rat 17alpha-ethynylestradiol affects expression ISO Ncoa4 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of NCOA4 mRNA CTD PMID:17555576 Ncoa4 Rat 17alpha-ethynylestradiol multiple interactions ISO Ncoa4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of NCOA4 mRNA CTD PMID:17942748 Ncoa4 Rat 17alpha-ethynylestradiol increases expression ISO Ncoa4 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of NCOA4 mRNA CTD PMID:17942748 Ncoa4 Rat 17beta-estradiol increases expression ISO NCOA4 (Homo sapiens) 6480464 Estradiol results in increased expression of NCOA4 mRNA CTD PMID:23019147 Ncoa4 Rat 17beta-estradiol decreases expression ISO Ncoa4 (Mus musculus) 6480464 Estradiol results in decreased expression of NCOA4 mRNA CTD PMID:39298647 Ncoa4 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of NCOA4 mRNA CTD PMID:32145629 Ncoa4 Rat 17beta-hydroxy-5alpha-androstan-3-one multiple interactions ISO NCOA4 (Homo sapiens) 6480464 NCOA4 promotes the reaction [Dihydrotestosterone results in increased activity of AR protein] and NCOA4 protein promotes the reaction [Dihydrotestosterone results in increased activity of AR protein] CTD PMID:11751618 and PMID:19815066 Ncoa4 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Ncoa4 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Ncoa4 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Ncoa4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of NCOA4 mRNA CTD PMID:17942748 Ncoa4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of NCOA4 mRNA CTD PMID:34747641 Ncoa4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Ncoa4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of NCOA4 mRNA CTD PMID:19770486 Ncoa4 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Ncoa4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of NCOA4 mRNA CTD PMID:17942748 Ncoa4 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of NCOA4 mRNA CTD PMID:21346803 Ncoa4 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of NCOA4 mRNA CTD PMID:21346803 Ncoa4 Rat 25-hydroxycholesterol increases expression ISO NCOA4 (Homo sapiens) 6480464 25-hydroxycholesterol results in increased expression of NCOA4 protein CTD PMID:39197811 Ncoa4 Rat 3-methyladenine multiple interactions ISO Ncoa4 (Mus musculus) 6480464 3-methyladenine inhibits the reaction [Busulfan results in increased expression of NCOA4 protein] CTD PMID:38220133 Ncoa4 Rat 3-methyladenine multiple interactions EXP 6480464 3-methyladenine inhibits the reaction [erastin results in decreased expression of NCOA4 protein] CTD PMID:32937103 Ncoa4 Rat 3-methyladenine multiple interactions ISO NCOA4 (Homo sapiens) 6480464 3-methyladenine inhibits the reaction [di-n-propyldithiocarbamate results in increased expression of NCOA4 protein] CTD PMID:32687844 Ncoa4 Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of NCOA4 mRNA CTD PMID:19162173 Ncoa4 Rat 4,4'-diaminodiphenylmethane increases expression ISO Ncoa4 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of NCOA4 mRNA CTD PMID:18648102 Ncoa4 Rat 4,4'-sulfonyldiphenol multiple interactions ISO NCOA4 (Homo sapiens) 6480464 [bisphenol S binds to and affects the folding of AR protein] affects the reaction [AR protein modified form binds to NCOA4 protein modified form] CTD PMID:28751236 Ncoa4 Rat 4,4'-sulfonyldiphenol increases methylation ISO NCOA4 (Homo sapiens) 6480464 bisphenol S results in increased methylation of NCOA4 gene CTD PMID:31601247 Ncoa4 Rat 4,4'-sulfonyldiphenol decreases expression ISO Ncoa4 (Mus musculus) 6480464 bisphenol S results in decreased expression of NCOA4 mRNA CTD PMID:39298647 Ncoa4 Rat 4-hydroxyphenyl retinamide increases expression ISO Ncoa4 (Mus musculus) 6480464 Fenretinide results in increased expression of NCOA4 mRNA CTD PMID:28973697 Ncoa4 Rat 4-phenylbutyric acid multiple interactions ISO NCOA4 (Homo sapiens) 6480464 4-phenylbutyric acid inhibits the reaction [Particulate Matter results in increased expression of NCOA4 protein] CTD PMID:36700298 Ncoa4 Rat acetaldehyde increases expression ISO NCOA4 (Homo sapiens) 6480464 Acetaldehyde results in increased expression of NCOA4 mRNA CTD PMID:35595033 Ncoa4 Rat acetaldehyde multiple interactions ISO NCOA4 (Homo sapiens) 6480464 Silybin inhibits the reaction [Acetaldehyde results in increased expression of NCOA4 mRNA] CTD PMID:35595033 Ncoa4 Rat aflatoxin B1 decreases methylation ISO NCOA4 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of NCOA4 gene CTD PMID:27153756 Ncoa4 Rat all-trans-retinoic acid increases expression ISO Ncoa4 (Mus musculus) 6480464 Tretinoin results in increased expression of NCOA4 mRNA CTD PMID:36189433 Ncoa4 Rat all-trans-retinoic acid multiple interactions ISO Ncoa4 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of NCOA4 mRNA CTD PMID:36189433 Ncoa4 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of NCOA4 mRNA CTD PMID:38685447 Ncoa4 Rat Aroclor 1254 decreases expression ISO Ncoa4 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of NCOA4 mRNA CTD PMID:23650126 Ncoa4 Rat arsenite(3-) multiple interactions ISO NCOA4 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to NCOA4 mRNA] CTD PMID:32406909 Ncoa4 Rat arsenous acid increases expression ISO NCOA4 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of NCOA4 mRNA CTD PMID:20458559 Ncoa4 Rat artesunate decreases expression ISO NCOA4 (Homo sapiens) 6480464 Artesunate results in decreased expression of NCOA4 mRNA and Artesunate results in decreased expression of NCOA4 protein CTD PMID:30551460 Ncoa4 Rat artesunate multiple interactions ISO NCOA4 (Homo sapiens) 6480464 Chloroquine inhibits the reaction [Artesunate results in decreased expression of NCOA4 mRNA] CTD PMID:30551460 Ncoa4 Rat bafilomycin A1 multiple interactions ISO NCOA4 (Homo sapiens) 6480464 bafilomycin A1 affects the reaction [[PRKD2 protein affects the susceptibility to erastin] which affects the expression of NCOA4 protein] CTD PMID:37951334 Ncoa4 Rat benzo[a]pyrene increases expression ISO Ncoa4 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of NCOA4 mRNA CTD PMID:19770486 Ncoa4 Rat benzo[a]pyrene affects methylation ISO NCOA4 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of NCOA4 3' UTR more ... CTD PMID:27901495 Ncoa4 Rat beryllium sulfate multiple interactions ISO NCOA4 (Homo sapiens) 6480464 [sodium sulfide results in increased abundance of Hydrogen Sulfide] inhibits the reaction [beryllium sulfate results in increased expression of NCOA4 mRNA] more ... CTD PMID:36843388 Ncoa4 Rat beryllium sulfate increases expression ISO NCOA4 (Homo sapiens) 6480464 beryllium sulfate results in increased expression of NCOA4 mRNA and beryllium sulfate results in increased expression of NCOA4 protein CTD PMID:36843388 Ncoa4 Rat beta-lapachone affects expression ISO NCOA4 (Homo sapiens) 6480464 beta-lapachone affects the expression of NCOA4 mRNA CTD PMID:38218311 Ncoa4 Rat beta-lapachone increases expression ISO NCOA4 (Homo sapiens) 6480464 beta-lapachone results in increased expression of NCOA4 protein CTD PMID:38218311 Ncoa4 Rat bisphenol A increases expression ISO Ncoa4 (Mus musculus) 6480464 bisphenol A results in increased expression of NCOA4 mRNA CTD PMID:22687993 Ncoa4 Rat bisphenol A decreases methylation ISO NCOA4 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of NCOA4 gene CTD PMID:31601247 Ncoa4 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of NCOA4 mRNA CTD PMID:32145629 and PMID:34947998 Ncoa4 Rat bisphenol A decreases expression ISO NCOA4 (Homo sapiens) 6480464 bisphenol A results in decreased expression of NCOA4 protein CTD PMID:38103660 and PMID:38326183 Ncoa4 Rat bisphenol A affects expression ISO NCOA4 (Homo sapiens) 6480464 bisphenol A affects the expression of NCOA4 mRNA CTD PMID:30903817 Ncoa4 Rat bisphenol A multiple interactions ISO NCOA4 (Homo sapiens) 6480464 [bisphenol A binds to and affects the folding of AR protein] affects the reaction [AR protein modified form binds to NCOA4 protein modified form] more ... CTD PMID:28751236 more ... Ncoa4 Rat bisphenol AF multiple interactions ISO NCOA4 (Homo sapiens) 6480464 [bisphenol AF binds to and affects the folding of AR protein] promotes the reaction [AR protein modified form binds to NCOA4 protein modified form] CTD PMID:28751236 Ncoa4 Rat bisphenol F increases expression ISO Ncoa4 (Mus musculus) 6480464 bisphenol F results in increased expression of NCOA4 mRNA CTD PMID:38685157 Ncoa4 Rat busulfan increases expression ISO Ncoa4 (Mus musculus) 6480464 Busulfan results in increased expression of NCOA4 protein CTD PMID:38220133 Ncoa4 Rat busulfan multiple interactions ISO Ncoa4 (Mus musculus) 6480464 3-methyladenine inhibits the reaction [Busulfan results in increased expression of NCOA4 protein] CTD PMID:38220133 Ncoa4 Rat cadmium atom increases expression EXP 6480464 Cadmium results in increased expression of NCOA4 mRNA CTD PMID:39025289 Ncoa4 Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of NCOA4 promoter CTD PMID:22457795 Ncoa4 Rat cadmium dichloride decreases expression ISO NCOA4 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of NCOA4 mRNA CTD PMID:38568856 Ncoa4 Rat cadmium dichloride multiple interactions ISO NCOA4 (Homo sapiens) 6480464 NCOA4 promotes the reaction [Cadmium Chloride results in increased activity of AR protein] CTD PMID:11751618 Ncoa4 Rat carbamazepine affects expression ISO NCOA4 (Homo sapiens) 6480464 Carbamazepine affects the expression of NCOA4 mRNA CTD PMID:25979313 Ncoa4 Rat carbon nanotube increases expression ISO Ncoa4 (Mus musculus) 6480464 Nanotubes and Carbon analog results in increased expression of NCOA4 mRNA CTD PMID:25554681 Ncoa4 Rat chloropicrin increases expression ISO NCOA4 (Homo sapiens) 6480464 chloropicrin results in increased expression of NCOA4 mRNA CTD PMID:26352163 Ncoa4 Rat chloroquine increases expression ISO NCOA4 (Homo sapiens) 6480464 Chloroquine results in increased expression of NCOA4 mRNA and Chloroquine results in increased expression of NCOA4 protein CTD PMID:30551460 and PMID:36482696 Ncoa4 Rat chloroquine multiple interactions EXP 6480464 Chloroquine inhibits the reaction [erastin results in decreased expression of NCOA4 protein] CTD PMID:32937103 Ncoa4 Rat chloroquine multiple interactions ISO NCOA4 (Homo sapiens) 6480464 Chloroquine affects the reaction [[PRKD2 protein affects the susceptibility to erastin] which affects the expression of NCOA4 protein] more ... CTD PMID:30551460 more ... Ncoa4 Rat chlorpyrifos decreases expression ISO Ncoa4 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of NCOA4 mRNA CTD PMID:20350560 and PMID:37019170 Ncoa4 Rat choline multiple interactions ISO Ncoa4 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of NCOA4 gene CTD PMID:20938992 Ncoa4 Rat chromium(6+) multiple interactions ISO NCOA4 (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression of NCOA4 mRNA CTD PMID:38479592 Ncoa4 Rat ciguatoxin CTX1B affects expression ISO Ncoa4 (Mus musculus) 6480464 Ciguatoxins affects the expression of NCOA4 mRNA CTD PMID:18353800 Ncoa4 Rat cisplatin decreases expression ISO Ncoa4 (Mus musculus) 6480464 Cisplatin results in decreased expression of NCOA4 protein CTD PMID:34302894 Ncoa4 Rat clozapine increases expression ISO NCOA4 (Homo sapiens) 6480464 Clozapine results in increased expression of NCOA4 protein CTD PMID:36482696 Ncoa4 Rat copper atom multiple interactions ISO NCOA4 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of NCOA4 mRNA CTD PMID:30911355 Ncoa4 Rat copper(0) multiple interactions ISO NCOA4 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of NCOA4 mRNA CTD PMID:30911355 Ncoa4 Rat copper(II) sulfate decreases expression ISO NCOA4 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of NCOA4 mRNA CTD PMID:19549813 Ncoa4 Rat corosolic acid increases expression ISO NCOA4 (Homo sapiens) 6480464 corosolic acid results in increased expression of NCOA4 mRNA CTD PMID:37939859 Ncoa4 Rat crocidolite asbestos decreases expression ISO Ncoa4 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of NCOA4 mRNA CTD PMID:29279043 Ncoa4 Rat crocidolite asbestos affects expression ISO NCOA4 (Homo sapiens) 6480464 Asbestos and Crocidolite affects the expression of NCOA4 mRNA CTD PMID:17331233 Ncoa4 Rat cyclosporin A decreases expression ISO NCOA4 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of NCOA4 mRNA CTD PMID:20106945 and PMID:25562108 Ncoa4 Rat desferrioxamine B multiple interactions ISO NCOA4 (Homo sapiens) 6480464 Deferoxamine inhibits the reaction [beryllium sulfate results in increased expression of NCOA4 mRNA] more ... CTD PMID:32283200 more ... Ncoa4 Rat desferrioxamine B multiple interactions EXP 6480464 Deferoxamine inhibits the reaction [[lead acetate results in increased abundance of Lead] which results in increased expression of NCOA4 mRNA] and Deferoxamine inhibits the reaction [[lead acetate results in increased abundance of Lead] which results in increased expression of NCOA4 protein] CTD PMID:39276841 Ncoa4 Rat diarsenic trioxide increases expression ISO NCOA4 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of NCOA4 mRNA CTD PMID:20458559 Ncoa4 Rat dibenzo[a,l]pyrene affects expression ISO Ncoa4 (Mus musculus) 6480464 dibenzo(a and l)pyrene affects the expression of NCOA4 mRNA CTD PMID:26496743 Ncoa4 Rat dibutyl phthalate increases expression ISO Ncoa4 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of NCOA4 mRNA CTD PMID:21266533 Ncoa4 Rat dicrotophos decreases expression ISO NCOA4 (Homo sapiens) 6480464 dicrotophos results in decreased expression of NCOA4 mRNA CTD PMID:28302478 Ncoa4 Rat diquat increases expression ISO Ncoa4 (Mus musculus) 6480464 Diquat results in increased expression of NCOA4 mRNA CTD PMID:36851058 Ncoa4 Rat doxorubicin multiple interactions EXP 6480464 Doxorubicin results in decreased ubiquitination of and results in increased expression of NCOA4 protein CTD PMID:36195186 Ncoa4 Rat doxorubicin multiple interactions ISO Ncoa4 (Mus musculus) 6480464 Doxorubicin results in decreased ubiquitination of and results in increased expression of NCOA4 protein CTD PMID:36195186 Ncoa4 Rat erastin decreases expression EXP 6480464 erastin results in decreased expression of NCOA4 protein CTD PMID:32937103 Ncoa4 Rat erastin multiple interactions ISO NCOA4 (Homo sapiens) 6480464 [PRKD2 protein affects the susceptibility to erastin] which affects the expression of NCOA4 protein more ... CTD PMID:37951334 Ncoa4 Rat erastin multiple interactions EXP 6480464 3-methyladenine inhibits the reaction [erastin results in decreased expression of NCOA4 protein] and Chloroquine inhibits the reaction [erastin results in decreased expression of NCOA4 protein] CTD PMID:32937103 Ncoa4 Rat ethanol affects splicing ISO Ncoa4 (Mus musculus) 6480464 Ethanol affects the splicing of NCOA4 mRNA CTD PMID:30319688 Ncoa4 Rat ethanol multiple interactions ISO NCOA4 (Homo sapiens) 6480464 Silybin inhibits the reaction [Ethanol results in increased expression of NCOA4 mRNA] CTD PMID:35595033 Ncoa4 Rat ethanol increases expression ISO NCOA4 (Homo sapiens) 6480464 Ethanol results in increased expression of NCOA4 mRNA CTD PMID:35595033 Ncoa4 Rat ethyl methanesulfonate increases expression ISO NCOA4 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of NCOA4 mRNA CTD PMID:23649840 Ncoa4 Rat ferric ammonium citrate multiple interactions ISO NCOA4 (Homo sapiens) 6480464 ferric ammonium citrate inhibits the reaction [Palmitic Acid results in increased expression of NCOA4 protein] CTD PMID:32283200 Ncoa4 Rat ferrostatin-1 multiple interactions EXP 6480464 ferrostatin-1 inhibits the reaction [[lead acetate results in increased abundance of Lead] which results in increased expression of NCOA4 mRNA] and ferrostatin-1 inhibits the reaction [[lead acetate results in increased abundance of Lead] which results in increased expression of NCOA4 protein] CTD PMID:39276841 Ncoa4 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of NCOA4 mRNA CTD PMID:24136188 Ncoa4 Rat folic acid multiple interactions ISO Ncoa4 (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Ncoa4 Rat formaldehyde increases expression ISO NCOA4 (Homo sapiens) 6480464 Formaldehyde results in increased expression of NCOA4 mRNA CTD PMID:23649840 Ncoa4 Rat fulvestrant increases methylation ISO NCOA4 (Homo sapiens) 6480464 Fulvestrant results in increased methylation of NCOA4 gene CTD PMID:31601247 Ncoa4 Rat furan increases methylation EXP 6480464 furan results in increased methylation of NCOA4 gene CTD PMID:22079235 Ncoa4 Rat genistein increases expression ISO NCOA4 (Homo sapiens) 6480464 Genistein results in increased expression of NCOA4 mRNA CTD PMID:23019147 Ncoa4 Rat glycidyl methacrylate increases expression ISO NCOA4 (Homo sapiens) 6480464 glycidyl methacrylate results in increased expression of NCOA4 protein CTD PMID:36641056 Ncoa4 Rat hexadecanoic acid increases expression ISO NCOA4 (Homo sapiens) 6480464 Palmitic Acid results in increased expression of NCOA4 protein CTD PMID:32283200 Ncoa4 Rat hexadecanoic acid multiple interactions ISO NCOA4 (Homo sapiens) 6480464 Deferoxamine promotes the reaction [Palmitic Acid results in increased expression of NCOA4 protein] more ... CTD PMID:32283200 Ncoa4 Rat hydralazine multiple interactions ISO NCOA4 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of NCOA4 mRNA CTD PMID:17183730 Ncoa4 Rat hydrogen sulfide multiple interactions ISO NCOA4 (Homo sapiens) 6480464 [sodium sulfide results in increased abundance of Hydrogen Sulfide] inhibits the reaction [beryllium sulfate results in increased expression of NCOA4 mRNA] and [sodium sulfide results in increased abundance of Hydrogen Sulfide] inhibits the reaction [beryllium sulfate results in increased expression of NCOA4 protein] CTD PMID:36843388 Ncoa4 Rat indometacin increases expression EXP 6480464 Indomethacin results in increased expression of NCOA4 mRNA CTD PMID:36868495 Ncoa4 Rat L-methionine multiple interactions ISO Ncoa4 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of NCOA4 gene CTD PMID:20938992 Ncoa4 Rat lead diacetate multiple interactions EXP 6480464 [lead acetate results in increased abundance of Lead] which results in increased expression of NCOA4 mRNA more ... CTD PMID:39276841 Ncoa4 Rat lead(0) multiple interactions EXP 6480464 [lead acetate results in increased abundance of Lead] which results in increased expression of NCOA4 mRNA more ... CTD PMID:39276841 Ncoa4 Rat lead(0) affects methylation ISO NCOA4 (Homo sapiens) 6480464 Lead affects the methylation of NCOA4 gene CTD PMID:31636367 Ncoa4 Rat leflunomide increases expression ISO NCOA4 (Homo sapiens) 6480464 leflunomide results in increased expression of NCOA4 mRNA CTD PMID:28988120 Ncoa4 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of NCOA4 mRNA CTD PMID:30467583 Ncoa4 Rat methotrexate affects expression ISO Ncoa4 (Mus musculus) 6480464 Methotrexate affects the expression of NCOA4 mRNA CTD PMID:18502557 Ncoa4 Rat methyl methanesulfonate increases expression ISO NCOA4 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of NCOA4 mRNA CTD PMID:23649840 Ncoa4 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Ncoa4 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of NCOA4 mRNA CTD PMID:36189433 Ncoa4 Rat N-acetyl-L-cysteine multiple interactions ISO NCOA4 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [di-n-propyldithiocarbamate results in increased expression of NCOA4 protein] CTD PMID:32687844 Ncoa4 Rat nickel atom affects expression ISO NCOA4 (Homo sapiens) 6480464 Nickel affects the expression of NCOA4 mRNA CTD PMID:14575637 Ncoa4 Rat nickel atom multiple interactions ISO NCOA4 (Homo sapiens) 6480464 trichostatin A inhibits the reaction [Nickel affects the expression of NCOA4 mRNA] CTD PMID:14575637 Ncoa4 Rat nickel dichloride decreases expression ISO Ncoa4 (Mus musculus) 6480464 nickel chloride results in decreased expression of NCOA4 mRNA and nickel chloride results in decreased expression of NCOA4 protein CTD PMID:34921910 Ncoa4 Rat nickel sulfate decreases expression ISO NCOA4 (Homo sapiens) 6480464 nickel sulfate results in decreased expression of NCOA4 mRNA CTD PMID:16780908 Ncoa4 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of NCOA4 mRNA CTD PMID:33484710 Ncoa4 Rat penconazole decreases expression ISO NCOA4 (Homo sapiens) 6480464 penconazole results in decreased expression of NCOA4 mRNA CTD PMID:23811263 Ncoa4 Rat pifithrin-alpha hydrobromide decreases expression ISO NCOA4 (Homo sapiens) 6480464 pifithrin results in decreased expression of NCOA4 protein CTD PMID:32687844 Ncoa4 Rat pifithrin-alpha hydrobromide multiple interactions ISO NCOA4 (Homo sapiens) 6480464 pifithrin inhibits the reaction [di-n-propyldithiocarbamate results in increased expression of NCOA4 protein] CTD PMID:32687844 Ncoa4 Rat progesterone decreases expression ISO NCOA4 (Homo sapiens) 6480464 Progesterone results in decreased expression of NCOA4 mRNA CTD PMID:18037150 Ncoa4 Rat propiconazole increases expression ISO Ncoa4 (Mus musculus) 6480464 propiconazole results in increased expression of NCOA4 mRNA CTD PMID:21278054 Ncoa4 Rat quercetin decreases expression ISO NCOA4 (Homo sapiens) 6480464 Quercetin results in decreased expression of NCOA4 mRNA CTD PMID:21632981 Ncoa4 Rat raloxifene multiple interactions ISO NCOA4 (Homo sapiens) 6480464 [Raloxifene Hydrochloride co-treated with ESR2 protein] results in decreased expression of NCOA4 mRNA CTD PMID:19059307 Ncoa4 Rat raloxifene affects expression ISO NCOA4 (Homo sapiens) 6480464 Raloxifene Hydrochloride affects the expression of NCOA4 mRNA CTD PMID:14699072 Ncoa4 Rat resveratrol decreases expression ISO NCOA4 (Homo sapiens) 6480464 resveratrol results in decreased expression of NCOA4 mRNA and resveratrol results in decreased expression of NCOA4 protein CTD PMID:10606230 Ncoa4 Rat silibinin multiple interactions ISO NCOA4 (Homo sapiens) 6480464 Silybin inhibits the reaction [Acetaldehyde results in increased expression of NCOA4 mRNA] and Silybin inhibits the reaction [Ethanol results in increased expression of NCOA4 mRNA] CTD PMID:35595033 Ncoa4 Rat sodium arsenite increases expression ISO NCOA4 (Homo sapiens) 6480464 sodium arsenite results in increased expression of NCOA4 mRNA CTD PMID:38568856 Ncoa4 Rat sodium fluoride increases expression ISO Ncoa4 (Mus musculus) 6480464 Sodium Fluoride results in increased expression of NCOA4 mRNA CTD PMID:37245782 Ncoa4 Rat sodium sulfide (anhydrous) multiple interactions ISO NCOA4 (Homo sapiens) 6480464 [sodium sulfide results in increased abundance of Hydrogen Sulfide] inhibits the reaction [beryllium sulfate results in increased expression of NCOA4 mRNA] and [sodium sulfide results in increased abundance of Hydrogen Sulfide] inhibits the reaction [beryllium sulfate results in increased expression of NCOA4 protein] CTD PMID:36843388 Ncoa4 Rat tamoxifen affects expression ISO NCOA4 (Homo sapiens) 6480464 Tamoxifen affects the expression of NCOA4 mRNA CTD PMID:14699072 Ncoa4 Rat tamoxifen affects expression ISO Ncoa4 (Mus musculus) 6480464 Tamoxifen affects the expression of NCOA4 mRNA CTD PMID:17555576 Ncoa4 Rat tamoxifen multiple interactions ISO NCOA4 (Homo sapiens) 6480464 [Tamoxifen co-treated with ESR2 protein] results in decreased expression of NCOA4 mRNA CTD PMID:19059307 Ncoa4 Rat testosterone decreases expression ISO Ncoa4 (Mus musculus) 6480464 Testosterone deficiency results in decreased expression of NCOA4 mRNA CTD PMID:33848595 Ncoa4 Rat thapsigargin multiple interactions ISO NCOA4 (Homo sapiens) 6480464 Thapsigargin inhibits the reaction [NCOA4 protein inhibits the reaction [Palmitic Acid inhibits the reaction [INS1 protein results in increased uptake of 2-(N-(7-nitrobenz-2-oxa-1 and 3-diazol-4-yl)amino)-2-deoxyglucose]]] CTD PMID:32283200 Ncoa4 Rat titanium dioxide decreases methylation ISO Ncoa4 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of NCOA4 promoter CTD PMID:35295148 Ncoa4 Rat toosendanin affects expression ISO NCOA4 (Homo sapiens) 6480464 toosendanin affects the expression of NCOA4 mRNA CTD PMID:36801351 Ncoa4 Rat toosendanin increases expression ISO Ncoa4 (Mus musculus) 6480464 toosendanin results in increased expression of NCOA4 protein CTD PMID:36801351 Ncoa4 Rat toosendanin increases expression ISO NCOA4 (Homo sapiens) 6480464 toosendanin results in increased expression of NCOA4 protein CTD PMID:36801351 Ncoa4 Rat trichostatin A multiple interactions ISO NCOA4 (Homo sapiens) 6480464 trichostatin A inhibits the reaction [Nickel affects the expression of NCOA4 mRNA] CTD PMID:14575637 Ncoa4 Rat triphenyl phosphate affects expression ISO NCOA4 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of NCOA4 mRNA CTD PMID:37042841 Ncoa4 Rat triptonide affects expression ISO Ncoa4 (Mus musculus) 6480464 triptonide affects the expression of NCOA4 mRNA CTD PMID:33045310 Ncoa4 Rat valproic acid multiple interactions ISO NCOA4 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of NCOA4 mRNA CTD PMID:17183730 Ncoa4 Rat wortmannin multiple interactions ISO NCOA4 (Homo sapiens) 6480464 Wortmannin inhibits the reaction [Palmitic Acid results in increased expression of NCOA4 protein] CTD PMID:32283200
Imported Annotations - KEGG (archival)
1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 25-hydroxycholesterol (ISO) 3-methyladenine (EXP,ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 4-phenylbutyric acid (ISO) acetaldehyde (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) Aroclor 1254 (ISO) arsenite(3-) (ISO) arsenous acid (ISO) artesunate (ISO) bafilomycin A1 (ISO) benzo[a]pyrene (ISO) beryllium sulfate (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (ISO) busulfan (ISO) cadmium atom (EXP) cadmium dichloride (EXP,ISO) carbamazepine (ISO) carbon nanotube (ISO) chloropicrin (ISO) chloroquine (EXP,ISO) chlorpyrifos (ISO) choline (ISO) chromium(6+) (ISO) ciguatoxin CTX1B (ISO) cisplatin (ISO) clozapine (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) corosolic acid (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) desferrioxamine B (EXP,ISO) diarsenic trioxide (ISO) dibenzo[a,l]pyrene (ISO) dibutyl phthalate (ISO) dicrotophos (ISO) diquat (ISO) doxorubicin (EXP,ISO) erastin (EXP,ISO) ethanol (ISO) ethyl methanesulfonate (ISO) ferric ammonium citrate (ISO) ferrostatin-1 (EXP) flutamide (EXP) folic acid (ISO) formaldehyde (ISO) fulvestrant (ISO) furan (EXP) genistein (ISO) glycidyl methacrylate (ISO) hexadecanoic acid (ISO) hydralazine (ISO) hydrogen sulfide (ISO) indometacin (EXP) L-methionine (ISO) lead diacetate (EXP) lead(0) (EXP,ISO) leflunomide (ISO) methapyrilene (EXP) methotrexate (ISO) methyl methanesulfonate (ISO) mono(2-ethylhexyl) phthalate (ISO) N-acetyl-L-cysteine (ISO) nickel atom (ISO) nickel dichloride (ISO) nickel sulfate (ISO) nitrofen (EXP) penconazole (ISO) pifithrin-alpha hydrobromide (ISO) progesterone (ISO) propiconazole (ISO) quercetin (ISO) raloxifene (ISO) resveratrol (ISO) silibinin (ISO) sodium arsenite (ISO) sodium fluoride (ISO) sodium sulfide (anhydrous) (ISO) tamoxifen (ISO) testosterone (ISO) thapsigargin (ISO) titanium dioxide (ISO) toosendanin (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) triptonide (ISO) valproic acid (ISO) wortmannin (ISO)
1.
Regulators of Iron Homeostasis: New Players in Metabolism, Cell Death, and Disease.
Bogdan AR, etal., Trends Biochem Sci. 2016 Mar;41(3):274-86. doi: 10.1016/j.tibs.2015.11.012. Epub 2015 Dec 23.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Functional domain and motif analyses of androgen receptor coregulator ARA70 and its differential expression in prostate cancer.
Hu YC, etal., J Biol Chem. 2004 Aug 6;279(32):33438-46. Epub 2004 May 27.
4.
Loss of androgen receptor associated protein 70 (ARA70) expression in a subset of HER2-positive breast cancers.
Kollara A, etal., Breast Cancer Res Treat. 2001 Jun;67(3):245-53.
5.
Cellular iron uptake, trafficking and metabolism: Key molecules and mechanisms and their roles in disease.
Lane DJ, etal., Biochim Biophys Acta. 2015 May;1853(5):1130-44. doi: 10.1016/j.bbamcr.2015.01.021. Epub 2015 Feb 4.
6.
Heterogeneous expression and functions of androgen receptor co-factors in primary prostate cancer.
Li P, etal., Am J Pathol. 2002 Oct;161(4):1467-74.
7.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
8.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
9.
Evaluation of steroid receptors, coregulators, and molecules associated with uterine receptivity in secretory endometria from untreated women with polycystic ovary syndrome.
Quezada S, etal., Fertil Steril. 2006 Apr;85(4):1017-26. Epub 2006 Mar 9.
10.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
Comprehensive gene review and curation
RGD comprehensive gene curation
13.
Activation of androgen receptor-associated protein 70 (ARA70) mRNA expression in ovarian cancer.
Shaw PA, etal., Gynecol Oncol. 2001 Feb;80(2):132-8.
14.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
15.
Direct regulation of androgen receptor-associated protein 70 by thyroid hormone and its receptors.
Tai PJ, etal., Endocrinology. 2007 Jul;148(7):3485-95. Epub 2007 Apr 5.
Ncoa4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 7,395,502 - 7,415,846 (+) NCBI GRCr8 mRatBN7.2 16 7,389,222 - 7,409,564 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 7,366,542 - 7,409,556 (+) Ensembl mRatBN7.2 Ensembl mRatBN7.2 Ensembl 16 7,366,542 - 7,409,641 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 7,401,738 - 7,422,128 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 8,546,594 - 8,566,985 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 7,399,986 - 7,420,330 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 8,302,950 - 8,323,294 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 8,302,950 - 8,323,293 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 8,219,983 - 8,240,326 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 7,642,116 - 7,662,460 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 16 7,789,196 - 7,809,198 (-) NCBI Celera Cytogenetic Map 16 p16 NCBI
NCOA4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 46,005,088 - 46,030,623 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 46,005,088 - 46,030,623 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 51,565,199 - 51,590,734 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 51,242,373 - 51,260,738 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 51,242,372 - 51,260,738 NCBI Celera 10 42,865,707 - 42,891,332 (+) NCBI Celera Cytogenetic Map 10 q11.22 NCBI HuRef 10 45,675,105 - 45,698,057 (+) NCBI HuRef CHM1_1 10 51,847,046 - 51,872,689 (+) NCBI CHM1_1 T2T-CHM13v2.0 10 46,885,972 - 46,911,498 (-) NCBI T2T-CHM13v2.0
Ncoa4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 31,881,884 - 31,901,210 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 31,881,822 - 31,901,812 (+) Ensembl GRCm39 Ensembl GRCm38 14 32,159,879 - 32,179,855 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 32,159,865 - 32,179,855 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 32,973,078 - 32,992,549 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 30,988,901 - 31,008,372 (+) NCBI MGSCv36 mm8 Celera 14 28,418,721 - 28,438,204 (+) NCBI Celera Cytogenetic Map 14 B NCBI cM Map 14 19.4 NCBI
Ncoa4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955556 392,398 - 412,166 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955556 392,412 - 413,643 (+) NCBI ChiLan1.0 ChiLan1.0
NCOA4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 58,884,053 - 58,909,606 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 58,889,371 - 58,914,924 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 43,159,014 - 43,184,558 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 46,420,952 - 46,446,479 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 46,420,952 - 46,443,223 (-) Ensembl panpan1.1 panPan2
NCOA4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 28 1,801,655 - 1,867,705 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 28 1,802,678 - 1,825,020 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 28 2,036,132 - 2,102,171 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 28 1,979,010 - 2,045,152 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 28 1,979,034 - 2,044,626 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 28 1,776,104 - 1,842,163 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 28 1,812,773 - 1,879,059 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 28 1,945,148 - 2,011,231 (-) NCBI UU_Cfam_GSD_1.0
Ncoa4
NCOA4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 90,505,110 - 90,531,118 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 90,505,614 - 90,531,302 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 98,548,146 - 98,573,846 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NCOA4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 41,813,018 - 41,836,974 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 41,826,320 - 41,837,505 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 1,522,166 - 1,546,119 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ncoa4
.
Predicted Target Of
Count of predictions: 310 Count of miRNA genes: 113 Interacting mature miRNAs: 141 Transcripts: ENSRNOT00000026803, ENSRNOT00000066062 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
631561 Hcuc2 Hepatic copper content QTL 2 2.8 liver copper amount (VT:0003065) liver total copper weight (CMO:0001507) 16 1 39533949 Rat 1582235 Insul8 Insulin level QTL 8 3.3 0.0063 blood insulin amount (VT:0001560) calculated serum insulin level (CMO:0000359) 16 1 26727669 Rat 2307172 Activ4 Activity QTL 4 3.71 0.00023 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 16 1 33418960 Rat 1354584 Despr6 Despair related QTL 6 3.1 0.0067 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 16 1 39533930 Rat 1357403 Slep4 Serum leptin concentration QTL 4 3.91 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 1 9639137 Rat 2302380 Slep6 Serum leptin concentration QTL 6 3.36 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 1 32139025 Rat 737819 Hcas4 Hepatocarcinoma susceptibility QTL 4 4.43 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 16 4227609 46975965 Rat 9590151 Scort8 Serum corticosterone level QTL 8 8.45 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 16 1 30836262 Rat 1354625 Despr7 Despair related QTL 7 3.16 0.016 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 16 1 44977551 Rat 61338 Bp23 Blood pressure QTL 23 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 16 4227609 49227609 Rat 61405 Niddm6 Non-insulin dependent diabetes mellitus QTL 6 3.66 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 16 4227609 48972724 Rat 631830 Alc7 Alcohol consumption QTL 7 2.9 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 16 1 26727669 Rat 7411664 Foco30 Food consumption QTL 30 11 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 16 1 44588133 Rat 1600378 Arunc4 Aerobic running capacity QTL 4 0.03 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 16 380245 80345693 Rat 70183 BpQTLcluster13 Blood pressure QTL cluster 13 3.654 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 16 4227609 43025077 Rat 1600369 Hcas8 Hepatocarcinoma susceptibility QTL 8 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 16 1 22477621 Rat 737826 Alc11 Alcohol consumption QTL 11 3.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 16 4227609 60252231 Rat 737825 Alc13 Alcohol consumption QTL 13 4.5 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 16 4227609 16039848 Rat 2303566 Bw90 Body weight QTL 90 2 body mass (VT:0001259) body weight (CMO:0000012) 16 1 39533930 Rat 2312663 Slep9 Serum leptin concentration QTL 9 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 832236 59492508 Rat 2306902 Bp339 Blood pressure QTL 339 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 16 3380150 43025077 Rat 1300133 Rf24 Renal function QTL 24 3.64 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 16 3380150 21361552 Rat 2312660 Bw95 Body weight QTL 95 0.05 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 16 832236 59492508 Rat 2312666 Insul16 Insulin level QTL 16 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 16 832236 59492508 Rat 634355 Rends4 Renal damage susceptibility QTL 4 0.05 kidney blood vessel morphology trait (VT:0000530) organ lesion measurement (CMO:0000677) 16 1 26727669 Rat 61372 Bp40 Blood pressure QTL 40 2.2 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 16 4227730 17696785 Rat 2293343 Glom16 Glomerulus QTL 16 7.4 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 16 832236 46053497 Rat 2301406 Kidm39 Kidney mass QTL 39 0.002 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 16 2851709 15884239 Rat 6903319 Bw114 Body weight QTL 114 2.7 0.0037 body mass (VT:0001259) body weight (CMO:0000012) 16 1 43534949 Rat 2312669 Stl23 Serum triglyceride level QTL 23 0.01 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 16 832236 59492508 Rat
D12Got38
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 7,396,808 - 7,396,980 (+) MAPPER mRatBN7.2 Rnor_6.0 16 8,310,539 - 8,310,710 NCBI Rnor6.0 Rnor_5.0 16 8,227,571 - 8,227,742 UniSTS Rnor5.0 RGSC_v3.4 16 7,649,704 - 7,649,876 RGD RGSC3.4 RGSC_v3.4 16 7,649,705 - 7,649,876 UniSTS RGSC3.4 RGSC_v3.1 16 7,649,702 - 7,649,874 RGD Celera 16 7,801,780 - 7,801,951 UniSTS Cytogenetic Map 16 p16 UniSTS
RH132366
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 16 7,411,540 - 7,411,754 (+) Marker Load Pipeline mRatBN7.2 16 7,405,258 - 7,405,472 (+) MAPPER mRatBN7.2 Rnor_6.0 16 8,318,989 - 8,319,202 NCBI Rnor6.0 Rnor_5.0 16 8,236,021 - 8,236,234 UniSTS Rnor5.0 RGSC_v3.4 16 7,658,155 - 7,658,368 UniSTS RGSC3.4 Celera 16 7,793,288 - 7,793,501 UniSTS RH 3.4 Map 16 65.3 UniSTS Cytogenetic Map 16 p16 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000026803 ⟹ ENSRNOP00000026803
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 7,366,542 - 7,409,556 (+) Ensembl Rnor_6.0 Ensembl 16 8,309,239 - 8,323,293 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000066062 ⟹ ENSRNOP00000061299
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 7,366,542 - 7,409,556 (+) Ensembl Rnor_6.0 Ensembl 16 8,302,950 - 8,323,293 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000095475 ⟹ ENSRNOP00000085149
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 7,398,798 - 7,409,641 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000117357 ⟹ ENSRNOP00000085575
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 7,395,642 - 7,409,556 (+) Ensembl
RefSeq Acc Id:
NM_001034007 ⟹ NP_001029179
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 7,401,791 - 7,415,846 (+) NCBI mRatBN7.2 16 7,395,509 - 7,409,564 (+) NCBI Rnor_6.0 16 8,309,239 - 8,323,294 (+) NCBI Rnor_5.0 16 8,219,983 - 8,240,326 (+) NCBI RGSC_v3.4 16 7,642,116 - 7,662,460 (+) RGD Celera 16 7,789,196 - 7,803,251 (-) NCBI
Sequence:
GCATGTTCACGCAGCAGTTTTCGTCGCGGGGTCGCACCACCCGGAACAGTGAGCAGAATGAATACATCCCTGGAGCAGAGTGGCTGCTGCAGTAGTAGAGAGACACTTCTGAGGTGCAGTGATGCAAG
hide sequence
RefSeq Acc Id:
NM_001034008 ⟹ NP_001029180
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 7,395,502 - 7,415,846 (+) NCBI mRatBN7.2 16 7,389,222 - 7,409,564 (+) NCBI Rnor_6.0 16 8,302,950 - 8,323,294 (+) NCBI Rnor_5.0 16 8,219,983 - 8,240,326 (+) NCBI RGSC_v3.4 16 7,642,116 - 7,662,460 (+) RGD Celera 16 7,789,196 - 7,809,198 (-) RGD
Sequence:
TCTGCCTTCAGGGTCCGGCTCCTTCCGTGGCTGAGTGTCTGGGTCGGTCCAAGGTCCGCTCGGA
hide sequence
RefSeq Acc Id:
XM_006252660 ⟹ XP_006252722
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 7,401,806 - 7,415,841 (+) NCBI mRatBN7.2 16 7,395,590 - 7,409,564 (+) NCBI Rnor_6.0 16 8,309,306 - 8,323,289 (+) NCBI Rnor_5.0 16 8,219,983 - 8,240,326 (+) NCBI
Sequence:
AGACTGCGCATGCGTGCGGGAAGCCCTGGGAGACCGATTTCACCAGCTGCTCCCGGAAAGGGCA
hide sequence
RefSeq Acc Id:
NP_001029180 ⟸ NM_001034008
- UniProtKB:
B1H215 (UniProtKB/TrEMBL), A6KFW8 (UniProtKB/TrEMBL), A0A8I6A3B1 (UniProtKB/TrEMBL), F7FLG1 (UniProtKB/TrEMBL)
- Sequence:
MNTSLEQSGCCSSRETLLRCSDARRELELAIGGVLRAEQQMKDNLREVKAQIHSCISRHLECLRSREVWLNEQVDLIYQLKEETLQQQAQQLYWLMGQFNCLIHQLEITQNKDLANQVALCLERLGSL
hide sequence
RefSeq Acc Id:
NP_001029179 ⟸ NM_001034007
- UniProtKB:
B1H215 (UniProtKB/TrEMBL), A6KFW8 (UniProtKB/TrEMBL), A0A8I6A3B1 (UniProtKB/TrEMBL), F7FLG1 (UniProtKB/TrEMBL)
- Sequence:
MNTSLEQSGCCSSRETLLRCSDARRELELAIGGVLRAEQQMKDNLREVKAQIHSCISRHLECLRSREVWLNEQVDLIYQLKEETLQQQAQQLYWLMGQFNCLIHQLEITQNKDLANQVALCLERLGSL
hide sequence
RefSeq Acc Id:
XP_006252722 ⟸ XM_006252660
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6A1Q3 (UniProtKB/TrEMBL), A0A8I6A3B1 (UniProtKB/TrEMBL)
- Sequence:
MAQGTVSRMNTSLEQSGCCSSRETLLRCSDARRELELAIGGVLRAEQQMKDNLREVKAQIHSCISRHLECLRSREVWLNEQVDLIYQLKEETLQQQAQQLYWLMGQFNCLIHQLEITQNKDLANQVAL
hide sequence
Ensembl Acc Id:
ENSRNOP00000026803 ⟸ ENSRNOT00000026803
Ensembl Acc Id:
ENSRNOP00000061299 ⟸ ENSRNOT00000066062
Ensembl Acc Id:
ENSRNOP00000085575 ⟸ ENSRNOT00000117357
Ensembl Acc Id:
ENSRNOP00000085149 ⟸ ENSRNOT00000095475
RGD ID: 13699938 Promoter ID: EPDNEW_R10461 Type: initiation region Name: Ncoa4_1 Description: nuclear receptor coactivator 4 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R10462 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 16 8,303,011 - 8,303,071 EPDNEW
RGD ID: 13699939 Promoter ID: EPDNEW_R10462 Type: single initiation site Name: Ncoa4_2 Description: nuclear receptor coactivator 4 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R10461 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 16 8,309,251 - 8,309,311 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Ncoa4
nuclear receptor coactivator 4
Ncoa4_predicted
nuclear receptor coactivator 4 (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-07
Ncoa4_predicted
nuclear receptor coactivator 4 (predicted)
Ncoa4
nuclear receptor coactivator 4
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
Ncoa4
nuclear receptor coactivator 4
Symbol and Name status set to provisional
70820 PROVISIONAL
