Advanced Search (OLGA)

Gene: Otoa (otoancorin) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Otoa

Name:

otoancorin

RGD ID:

1562741

Description:

Predicted to be involved in cell-matrix adhesion. Predicted to act upstream of or within sensory perception of sound and transmission of nerve impulse. Predicted to be located in apical plasma membrane. Predicted to be active in cell surface. Human ortholog(s) of this gene implicated in autosomal recessive nonsyndromic deafness 22. Orthologous to human OTOA (otoancorin); INTERACTS WITH atrazine; bisphenol A; indole-3-methanol.

Type:

protein-coding

RefSeq Status:

MODEL

Previously known as:

LOC499260; RGD1562741; similar to otoancorin

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	OTOA (otoancorin)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Otoa (otoancorin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Otoa (otoancorin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	OTOA (otoancorin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	OTOA (otoancorin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Otoa (otoancorin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	OTOA (otoancorin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	OTOA (otoancorin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Otoa (otoancorin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	OTOA (otoancorin)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Otoa (otoancorin)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:dkey-71b5.7	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	otoa	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	185,074,271 - 185,142,149 (+)	NCBI		GRCr8
mRatBN7.2	1	175,642,978 - 175,710,528 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	175,642,975 - 175,710,435 (+)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	1	191,029,861 - 191,097,524 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	191,029,861 - 191,097,290 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	197,955,647 - 198,022,686 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	179,944,477 - 180,013,040 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	173,374,030 - 173,440,021 (+)	NCBI		Celera
Cytogenetic Map	1	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Otoa	Rat	autosomal recessive nonsyndromic deafness		ISO	OTOA (Homo sapiens)	8554872	ClinVar Annotator: match by term: Deafness and autosomal recessive	ClinVar	PMID:23173898 more ...
Otoa	Rat	autosomal recessive nonsyndromic deafness 22		ISO	OTOA (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:11972037 more ...
Otoa	Rat	autosomal recessive nonsyndromic deafness 7		ISO	OTOA (Homo sapiens)	8554872	ClinVar Annotator: match by term: Deafness and autosomal recessive 7	ClinVar	PMID:35802133 and PMID:36633841
Otoa	Rat	autosomal recessive nonsyndromic deafness 9		ISO	OTOA (Homo sapiens)	8554872	ClinVar Annotator: match by term: Deafness and autosomal recessive 9	ClinVar	PMID:25741868
Otoa	Rat	genetic disease		ISO	OTOA (Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:24033266 more ...
Otoa	Rat	Hearing Loss		ISO	OTOA (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:23173898 more ...
Otoa	Rat	Nonsyndromic Sensorineural Hearing Loss		ISO	OTOA (Homo sapiens)	8554872	ClinVar Annotator: match by term: nonsyndromic sensorineural hearing loss	ClinVar	PMID:25741868
Otoa	Rat	Usher syndrome		ISO	OTOA (Homo sapiens)	8554872	ClinVar Annotator: match by term: Usher syndrome	ClinVar	PMID:23173898 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Otoa	Rat	autosomal recessive nonsyndromic deafness 22		ISO	OTOA (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Otoa	Rat	autosomal recessive nonsyndromic deafness 22		ISS	Otoa (Mus musculus)	13592920	OMIM:607039	MouseDO

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Otoa	Rat	autosomal recessive nonsyndromic deafness 22		ISO	OTOA (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Otoa	Rat	acrylamide	increases expression	ISO	Otoa (Mus musculus)	6480464	Acrylamide results in increased expression of OTOA mRNA	CTD	PMID:30807115
Otoa	Rat	aflatoxin B1	increases expression	ISO	OTOA (Homo sapiens)	6480464	Aflatoxin B1 results in increased expression of OTOA mRNA	CTD	PMID:21641981
Otoa	Rat	aflatoxin B1	increases methylation	ISO	OTOA (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of OTOA gene and Aflatoxin B1 results in increased methylation of OTOA intron	CTD	PMID:27153756 and PMID:30157460
Otoa	Rat	aristolochic acid A	increases expression	ISO	OTOA (Homo sapiens)	6480464	aristolochic acid I results in increased expression of OTOA mRNA	CTD	PMID:33212167
Otoa	Rat	atrazine	affects methylation	EXP		6480464	Atrazine affects the methylation of OTOA gene	CTD	PMID:28931070 and PMID:35440735
Otoa	Rat	benzo[a]pyrene	increases mutagenesis	ISO	OTOA (Homo sapiens)	6480464	Benzo(a)pyrene results in increased mutagenesis of OTOA gene	CTD	PMID:25435355
Otoa	Rat	benzo[a]pyrene	affects methylation	ISO	OTOA (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of OTOA exon and Benzo(a)pyrene affects the methylation of OTOA promoter	CTD	PMID:27901495
Otoa	Rat	benzo[a]pyrene	increases expression	ISO	OTOA (Homo sapiens)	6480464	Benzo(a)pyrene results in increased expression of OTOA mRNA	CTD	PMID:21871943 and PMID:22316170
Otoa	Rat	benzo[e]pyrene	increases methylation	ISO	OTOA (Homo sapiens)	6480464	benzo(e)pyrene results in increased methylation of OTOA intron	CTD	PMID:30157460
Otoa	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of OTOA mRNA	CTD	PMID:25181051
Otoa	Rat	cadmium dichloride	increases expression	ISO	OTOA (Homo sapiens)	6480464	Cadmium Chloride results in increased expression of OTOA mRNA	CTD	PMID:38568856
Otoa	Rat	CGP 52608	multiple interactions	ISO	OTOA (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to OTOA gene]	CTD	PMID:28238834
Otoa	Rat	chlorpyrifos	decreases expression	ISO	Otoa (Mus musculus)	6480464	Chlorpyrifos results in decreased expression of OTOA mRNA	CTD	PMID:37019170
Otoa	Rat	endosulfan	increases expression	ISO	OTOA (Homo sapiens)	6480464	Endosulfan results in increased expression of OTOA mRNA	CTD	PMID:26615145
Otoa	Rat	ethylparaben	decreases expression	ISO	OTOA (Homo sapiens)	6480464	ethyl-p-hydroxybenzoate results in decreased expression of OTOA mRNA	CTD	PMID:37690743
Otoa	Rat	indole-3-methanol	multiple interactions	EXP		6480464	[indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of OTOA mRNA	CTD	PMID:22129741
Otoa	Rat	methapyrilene	increases methylation	ISO	OTOA (Homo sapiens)	6480464	Methapyrilene results in increased methylation of OTOA intron	CTD	PMID:30157460
Otoa	Rat	mono(2-ethylhexyl) phthalate	increases expression	ISO	Otoa (Mus musculus)	6480464	mono-(2-ethylhexyl)phthalate results in increased expression of OTOA mRNA	CTD	PMID:22401849
Otoa	Rat	N-acetyl-L-cysteine	multiple interactions	EXP		6480464	[indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of OTOA mRNA	CTD	PMID:22129741
Otoa	Rat	N-nitrosodiethylamine	multiple interactions	EXP		6480464	[indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of OTOA mRNA	CTD	PMID:22129741
Otoa	Rat	ozone	multiple interactions	ISO	Otoa (Mus musculus)	6480464	[Air Pollutants results in increased abundance of Ozone] which results in decreased expression of OTOA mRNA	CTD	PMID:27106289
Otoa	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of OTOA mRNA	CTD	PMID:30723492
Otoa	Rat	sodium arsenite	increases expression	ISO	OTOA (Homo sapiens)	6480464	sodium arsenite results in increased expression of OTOA mRNA	CTD	PMID:38568856
Otoa	Rat	trichloroethene	decreases expression	EXP		6480464	Trichloroethylene results in decreased expression of OTOA mRNA	CTD	PMID:33387578
Otoa	Rat	urethane	decreases expression	ISO	OTOA (Homo sapiens)	6480464	Urethane results in decreased expression of OTOA mRNA	CTD	PMID:28818685

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Otoa	Rat	cell-matrix adhesion	acts_upstream_of_or_within	ISO	Otoa (Mus musculus)	1624291	MGI:5469411 PMID:23129639	RGD	PMID:23129639
Otoa	Rat	cell-matrix adhesion	involved_in	IBA	MGI:2149209 and PANTHER:PTN001517636	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Otoa	Rat	cell-matrix adhesion	acts_upstream_of_or_within	IEA	UniProtKB:Q8K561 and ensembl:ENSMUSP00000044177	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Otoa	Rat	multicellular organism growth	acts_upstream_of_or_within	ISO	Otoa (Mus musculus)	1624291	PMID:28511701	RGD	PMID:28511701
Otoa	Rat	multicellular organism growth	acts_upstream_of_or_within	IEA	UniProtKB:Q8K561 and ensembl:ENSMUSP00000044177	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Otoa	Rat	sensory perception of sound	acts_upstream_of_or_within	ISO	Otoa (Mus musculus)	1624291	MGI:5469411 PMID:23129639	RGD	PMID:23129639
Otoa	Rat	sensory perception of sound	acts_upstream_of_or_within	IEA	UniProtKB:Q8K561 and ensembl:ENSMUSP00000044177	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Otoa	Rat	transmission of nerve impulse	acts_upstream_of_or_within	ISO	Otoa (Mus musculus)	1624291	MGI:5469411 PMID:23129639	RGD	PMID:23129639
Otoa	Rat	transmission of nerve impulse	acts_upstream_of_or_within	IEA	UniProtKB:Q8K561 and ensembl:ENSMUSP00000044177	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Otoa	Rat	apical plasma membrane	located_in	ISO	Otoa (Mus musculus)	1624291	PMID:11972037	RGD	PMID:11972037
Otoa	Rat	apical plasma membrane	located_in	IEA	UniProtKB:Q8K561 and ensembl:ENSMUSP00000044177	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Otoa	Rat	cell surface	is_active_in	IBA	PANTHER:PTN001517636 and Msln (Rattus norvegicus)	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:11972037	PMID:23129639

Otoa
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	185,074,271 - 185,142,149 (+)	NCBI		GRCr8
mRatBN7.2	1	175,642,978 - 175,710,528 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	175,642,975 - 175,710,435 (+)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	1	191,029,861 - 191,097,524 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	191,029,861 - 191,097,290 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	197,955,647 - 198,022,686 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	179,944,477 - 180,013,040 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	173,374,030 - 173,440,021 (+)	NCBI		Celera
Cytogenetic Map	1	q36	NCBI

OTOA
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	21,663,968 - 21,760,729 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	21,663,968 - 21,761,935 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	21,675,289 - 21,772,050 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	21,597,336 - 21,679,551 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	21,623,784 - 21,679,550	NCBI
Celera	16	21,371,583 - 21,424,019 (+)	NCBI		Celera
Cytogenetic Map	16	p12.2	NCBI
HuRef	16	20,071,671 - 20,153,825 (+)	NCBI		HuRef
CHM1_1	16	22,692,724 - 22,774,996 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	16	22,456,214 - 22,552,969 (-)	NCBI		T2T-CHM13v2.0

Otoa
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	120,682,647 - 120,762,316 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	120,680,873 - 120,762,320 (+)	Ensembl		GRCm39 Ensembl
GRCm38	7	121,083,424 - 121,163,093 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	121,081,650 - 121,163,097 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	128,226,952 - 128,306,603 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	120,874,587 - 120,954,237 (+)	NCBI		MGSCv36	mm8
Celera	7	120,996,318 - 121,074,716 (+)	NCBI		Celera
Cytogenetic Map	7	F2	NCBI
cM Map	7	65.07	NCBI

Otoa
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955493	1,154,751 - 1,224,962 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955493	1,154,695 - 1,228,997 (+)	NCBI	ChiLan1.0	ChiLan1.0

OTOA
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	23,736,857 - 23,819,324 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	28,257,503 - 28,339,777 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	15,530,399 - 15,657,565 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	88,025,201 - 88,094,381 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	88,025,201 - 88,091,449 (+)	Ensembl	panpan1.1		panPan2

OTOA
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	23,106,650 - 23,175,159 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	23,106,804 - 23,168,380 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	24,602,084 - 24,670,556 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	23,245,256 - 23,313,869 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	6	23,047,697 - 23,116,225 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	22,956,980 - 23,029,406 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	23,345,518 - 23,414,053 (-)	NCBI		UU_Cfam_GSD_1.0

Otoa
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	119,288,939 - 119,358,610 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936501	7,392,616 - 7,456,677 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936501	7,383,963 - 7,456,470 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

OTOA
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	23,570,382 - 23,662,480 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	23,570,216 - 23,662,948 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	24,012,548 - 24,055,367 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

OTOA
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	20,184,525 - 20,278,438 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	20,198,412 - 20,278,433 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666068	9,587,651 - 9,667,862 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Otoa
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624782	7,854,594 - 7,915,471 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624782	7,843,907 - 7,916,259 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Otoa
545 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	59
Count of miRNA genes:	55
Interacting mature miRNAs:	59
Transcripts:	ENSRNOT00000023591
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	150700247	252085048	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
1354653	Despr9	Despair related QTL 9		0.00019	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	167909849	212909849	Rat
1578770	Stresp23	Stress response QTL 23			kidney sympathetic nerve activity (VT:0004050)	stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786)	1	123350408	182418476	Rat
2293673	Bss27	Bone structure and strength QTL 27	18.63	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	1	171629477	216629477	Rat
61326	Eae6	Experimental allergic encephalomyelitis QTL 6	5.3		body mass (VT:0001259)	change in body weight (CMO:0002045)	1	172949660	181830018	Rat
2293677	Bss41	Bone structure and strength QTL 41	9.38	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	1	171629477	216629477	Rat
70160	Bw18	Body weight QTL 18	5.7		body mass (VT:0001259)	body weight (CMO:0000012)	1	144267353	196383668	Rat
1549830	Bss1	Bone structure and strength QTL 1	4.8		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	172609619	217609619	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
70163	Bw20	Body weight QTL 20	5.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	174133260	219133260	Rat
1354636	Lmblg1	Limb length QTL 1	6.4		tibia length (VT:0004357)	tibia length (CMO:0000450)	1	151162512	201278233	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
2293689	Bss47	Bone structure and strength QTL 47	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	1	171629477	216629477	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	123556856	242907031	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	143506580	212458660	Rat
61341	Bp26	Blood pressure QTL 26			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	169537671	214537671	Rat
1354634	Kidm12	Kidney mass QTL 12	3.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	1	151162512	201278233	Rat
4889428	Stresp24	Stress response QTL 24		0.05	heart pumping trait (VT:2000009)	absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162)	1	155866514	200866514	Rat
152025232	Bw192	Body weight QTL 192	3.93		body mass (VT:0001259)		1	117917486	196963478	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	150700247	252085048	Rat
61343	Bp28	Blood pressure QTL 28			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	151646613	196646613	Rat
2293693	Bss22	Bone structure and strength QTL 22	33.52	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	1	171629477	216629477	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	90508614	180359386	Rat
2300161	Bmd43	Bone mineral density QTL 43	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
61347	Bp197	Blood pressure QTL 197	4.2		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	1	158633083	203633083	Rat
61348	Bp30	Blood pressure QTL 30	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	144017057	197814409	Rat
8655649	Arrd1	Age-related retinal degeneration QTL 1	4.89		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	100357752	183970443	Rat
2303622	Vencon6	Ventilatory control QTL 6		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	1	154561505	199561505	Rat
631214	Bw61	Body weight QTL61	3.4	0.0001	intramuscular adipose amount (VT:0010044)	intramuscular fat area (CMO:0001162)	1	173108781	218108781	Rat
7771612	Cm80	Cardiac mass QTL 80	8.4		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	1	149448574	221264292	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642644	214537671	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118944897	199050459	Rat
1300158	Bp173	Blood pressure QTL 173	3.48		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	1	115540693	185145286	Rat
2300174	Bmd42	Bone mineral density QTL 42	8.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	1	171629477	216629477	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	144267353	222987745	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	94494440	198211706	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	151162766	225824951	Rat
1331751	Bp199	Blood pressure QTL 199	3.60022		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	94494440	181830018	Rat
2293654	Bss30	Bone structure and strength QTL 30	32.65	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	1	171629477	216629477	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	150700142	252085212	Rat
2300187	Bmd41	Bone mineral density QTL 41	8.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
737974	Bp161	Blood pressure QTL 161		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	164747558	181133855	Rat
1641895	Bp298	Blood pressure QTL 298			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	123350408	182418476	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	94494440	198324465	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	156677124	256448636	Rat
1358294	Bw37	Body weight QTL 37	5	0.000011	body mass (VT:0001259)	body weight (CMO:0000012)	1	171310381	216310381	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
2312420	Pur17	Proteinuria QTL 17	7.1	0.0001	urine protein amount (VT:0005160)	urine total protein excretion rate (CMO:0000756)	1	156677124	218753816	Rat
6893347	Bw98	Body weight QTL 98	0.2	0.53	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	102813953	201278233	Rat
724550	Thym3	Thymus enlargement QTL 3	7.82	0.001	thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	136829932	181829932	Rat
2312558	Glom17	Glomerulus QTL 17	3.9	0.001	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	166532971	191278129	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
71118	Thym1	Thymus enlargement QTL 1	10.17	0.001	thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	136829932	181829932	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
619613	Bp77	Blood pressure QTL 77		0.01	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	164747424	209747424	Rat
631519	Pia11	Pristane induced arthritis QTL 11	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	136830018	181830018	Rat
619614	Bp78	Blood pressure QTL 78		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	169112897	197261052	Rat
6893361	Bw104	Body weight QTL 104	0.59	0.27	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
724562	Rends1	Renal damage susceptibility QTL 1		0.05	kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	1	169537671	214537671	Rat
2292222	Bp307	Blood pressure QTL 307	3.06	0.0014	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	213533942	Rat
2292220	Bp306	Blood pressure QTL 306	3.47	0.00087	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	243914901	Rat
1558645	Bw55	Body weight QTL 55	3.2	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	102813953	201278233	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1354620	Kidm19	Kidney mass QTL 19	4		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	201278233	Rat
1354618	Kidm15	Kidney mass QTL 15	5		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	1	156677124	201278233	Rat
631544	Bp84	Blood pressure QTL 84	5.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350408	181759564	Rat
152025212	Bw190	Body weight QTL 190	5.7		body mass (VT:0001259)		1	123556856	196963478	Rat
631549	Bp89	Blood pressure QTL 89	5.7		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350581	201284552	Rat
631548	Bp88	Blood pressure QTL 88	5	0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	156677124	176484451	Rat
1358189	Cstrr1	Cold stress response QTL 1		0.0001	catecholamine amount (VT:0010543)	urine norepinephrine level (CMO:0001629)	1	123350408	182418476	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	102813953	218753816	Rat
1354602	Bw35	Body weight QTL 35	12.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	201278233	Rat
631670	Iddm10	Insulin dependent diabetes mellitus QTL 10	1.9		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	174133260	196383668	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
7	5	19	109	35	35	13	9	13	6	101	45	91	32	53	22


RefSeq Transcripts	XM_006223495	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006230180	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC103221	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473956	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000023591 ⟹ ENSRNOP00000023591

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	175,642,975 - 175,710,435 (+)	Ensembl
Rnor_6.0 Ensembl	1	191,029,861 - 191,097,290 (+)	Ensembl

RefSeq Acc Id:

XM_006230180 ⟹ XP_006230242

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	185,074,271 - 185,142,149 (+)	NCBI
mRatBN7.2	1	175,642,978 - 175,710,528 (+)	NCBI
Rnor_6.0	1	191,029,861 - 191,097,524 (+)	NCBI
Rnor_5.0	1	197,955,647 - 198,022,686 (+)	NCBI

Sequence:

show sequence

ATGTCTCAGGAACCTAGGATGTACTCCCTTCTCCTGGTCCTCTTCCTGAGCCATGGAGGTGCATGTCAGAGAGAGCCAAGCTCCAGGCAGGATTTACATCCATTGTTGCAGAAAATGGCGGAAGAAAT
AATAGAGGGAAGCTATCTGAATGCGTTACTGGATCTCGCACTGTTTGAAAGCTCCCATGTCTGGACTGCCGACCTGTCCCACAGAGTCCTTGCCTATCTGAACTCACGGAACGTGGCCTTCACCATTC
CCAGCCTGCAGGCAGTCATGGAAACCCATCTGGAACAGTATCTGTACCAACCGCAGAAGCTGCTGGAGGACCTGAGGGCCACTGATGCTCAGCAGTTCCACACCGCCATGAAATGCCTTCTGGAAGAC
AAGTGGGGCCACCTGGACTTGGAGGACATCGTCATCAACTTGGGAGACATTCGGGACGAGGCCCTTCAGAGCCCTGGTGTGAACCGCAGCCTGTTTCTCATCACACTGGAACGGTGTTTCCAGGTGCT
GAATGCCTTGGAGTGTGTAGAGGTCCTGGGCAAGGTGCTCAGAGGGTCCTCCGGCAGCTTCCTGCAGCCAGACATCACAGACAGGCTACCCCAGGACCTGCACGAAGATGCCTTTAAGAACCTGTCTG
CAGTGTTCAAAGATCTCTATGACCAGACTTCAGCTCACACCCAGAGAGCTCTCTACTCATGGATGACGGGGATCCTGAGGACACCTTTCAACGTCACTGATGGCTCAATTTCATGGGTCAGTGCAGAA
AAATTATGGATTTTGGGCAGATACATGGTTCACCTATCATTTGAAGAAATTATGAACATTAGTCCTATAGAAATCGGGCTGTTTATCAGCTATGACAACGCGACCAAGCAGCTGGATATGGTGTATGA
TGTCACTCCAGAACTGGCCCAGGCATTTCTGGAGAGGATCCGCGGTTCCAGCTTTGACATGAGGAACATCTCTACCATCCACAGGTTGGGGCTGTTGGTTTGTTTCTATGATGGTCTGGAGCTGCTGG
ATGCCGCCCTAGCCCAAGTCCTTCTCCACCAGATGCTCAAGTGTAGCCGCCTCCGGGGCTTCCAGGCTGGCGTCCAGAAGCTCAAGGCCAACCTCCTGGACATTGCTACAGAGAACCAGACCCTCAAC
GAGACCCTAGGCTCTCTGTCAGATGCGGTTGTAGGTCTGACCAGCACTCAGCTGGAATCCCTCTCCTCCGACGCAGTGCACAGCGCCATCTCTACCCTCAACCAGGTTACAGGCTGGGGCAGAAGCCA
GATCGTCATCTTATCTGCCAAATACTTGGCTCAGGAAAAGGTGCTGTCCTTCTACAGTGTCAGCCAGATGGGCGTGCTGCTGGCAGGGGTGGGCACACAAGCCTTCTACAGCATGGACCACAAAGATC
TCTGGCAGGTGCTGAGAAGCCCTCTTTCCCAGGATATGTCTGACTTGTCACCTGTCCAGCATCAAGGTGTCCTCAGCAAGCTGATGGAAGCAGAAGATGCTGCTTCGGGCATCGTGGAGGTACCGAGA
GCTCTTTTTAAGGAGGTGTCTCTCTATGATTTATGGAAAGGACCTGGATTCAATGCTACAGTCCTGAAGGAAAAGGAGCTTCGAAGGAGCCAGGCCCTGTTCCTGTATGAGCTTCTGGAAAAGACCAC
TGAAAGGCCCGAGGAACTCCTGAGCTCCCGGCAGCTGGTGAAGGGCGTACAGTGCTCACACATCGATGCCATGAGTGCCCACGTCTTTCTGGCCCTCTTCCAGCATTTTGAGAATAACTTCTCCCTGC
TTTCTCCAGATCAGGTCAATTGCTTGGCATGGAAATACTGGGAGGTTTCAAGGTCCTCCATGCCGCCATTCCTCTTGGCCACTCTCCCGTCCCGATTCCTGGCTTCAGTTCCCCCCTCTCGCTGTGTG
CGTTTTCTGATCAGCCTGGGTAAGAGGCACTTGGATACCTTGGTTTTAGATTCTGACAAAAGGAGTTTGGTCATCAGGAAAGTGCAACAGTGTTTGGATGGTGTCATTGCTGATGAATACACTGTGGA
CATTGTGGGAAACCTCCTGTGCCACTTGCCAGCTTCCTTCATTGAGAGAGGGATCTCACCCAGAGCCTGGGCCACTGCTCTGCATGGTCTCAGAAGCTGTAGAGCTCTCAGTTCCGGGCAGAAGGCCG
CAGTGAGGTTCAGGCTCTTGGAGCAGTGGGGACCTCCTCAGAACTGGACAGCAGAGACAACCAAGGACTTGGCACCTTTCTTAGCTTTTTTCTCAGGAGATGAACTGCACACCGTTGCCACAAAGTTT
CCTGAAATCCTTCAACAAACAGCTTCCAAGATGGTTGGTACGTTGCTTCCTAAGGAATTTCTCTGGGCTGTCTTTGAGTCTGTTCGGAATAGCAGTAATGAGAGCCCCGGCTCTGACCCCACCTTCGG
TTGTCATGGAGTTGTGACTCCATCTTCAGATGATATCGTCAAGTTAGCTGAAGCCAATGCCTGCTGGGACCCCGAGGTCCTTCTCTGCATGGAGGAGGACACTTTCATCAGGAATGTGGAGCTGCTGG
GGGCTGTGAAGGGGTTCAGCCGACCTCAACTGATGGCCCTGAAGGAGAAGGCAATCCAGGTTTGGGACTTGCCCTCCCACTGGAAAGAACACCATGTTGTCTCCCTGGGGCGCATTGCTTTGGCTCTT
AATGAGAGTGAGTTGGAGCAGTTGGACCTCAGCTCCATAGACACCGTGGCATCCCTGGGCCAGCAGACAGAATGGACCCCAGGACAGGCTAAATCCATTCTGCAGGAATTCCTTGAAGATTCAGGCTG
TGGTATCCAAGATCTGAAGAGCTTCCATTTGGTTGGGCTTGGCCCTACTCTATGTGCCATGGACCCCACTGAAATACCACTTATTAAGACCTCAGAATTCAGGGCAGTGGTAGCTAGAATTGGTACAC
TGCTCTGCAGCACCCCTGTCTTGGCTGGATTTAAGAAGAAAGCAGAAGTTGTATTTGGGAGACCCACCGAGTGGACCAGCTCCATCTTGCAGGAGCTTGGGACCATTGCAGCTGGGCTAACGAAGGCA
GAGCTCCGAATGCTTGACAAAGAACTGATGCCGTATTTCCAGCCATGGGCCATAAGATGCCTGCCTGGTGAGGTATTCAAAGAGCTGTCCACTGAGCAGATCGCTTCCCTGGGTCCTCAGAATGCAGC
CTTTGTAACCCACTCCCAGCGCCTGCAGCTCAGCTCCTCACAGCTGCAGAGCCTCCAGAGGGCAGTAGATGGCGCCAAGACTCACTTCTGGCAGATCGATCCAATGAGTTCCAGCCCTACCTGGCCAG
CCTCCACTGGGTCCCCAACAGGAGAGCCCACCTTCCAGGCTCTTTGGCTTGGCTGTCCCCTGCTGCTTCTGATGGCCAAATCCTGATGCCCAGTGGCCTGTTTAATGTTGTGAGAAGCTGTTGAAAGT
GTGGAGAGACAGAAGCTGCTTTCAGACCGGGGGAGACCTTTACCTGAGGAGCCTCAGGGAGGGCAGGAAGATCACAGGGTCTTGGAAAGATAATTATTAAAAACCATCTTGCATTCTTAAGCCAGCCT
GTCTCCCTGGTGGGTATTTTTTTTCCATTCCATGTTGACTTGGAGACAGAGAAGCTGCGGTGAC

hide sequence


Protein RefSeqs	XP_006230242	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM17588	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000023591
	ENSRNOP00000023591.4

RefSeq Acc Id:

XP_006230242 ⟸ XM_006230180

- UniProtKB:

D4A6R6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSQEPRMYSLLLVLFLSHGGACQREPSSRQDLHPLLQKMAEEIIEGSYLNALLDLALFESSHVWTADLSHRVLAYLNSRNVAFTIPSLQAVMETHLEQYLYQPQKLLEDLRATDAQQFHTAMKCLLED
KWGHLDLEDIVINLGDIRDEALQSPGVNRSLFLITLERCFQVLNALECVEVLGKVLRGSSGSFLQPDITDRLPQDLHEDAFKNLSAVFKDLYDQTSAHTQRALYSWMTGILRTPFNVTDGSISWVSAE
KLWILGRYMVHLSFEEIMNISPIEIGLFISYDNATKQLDMVYDVTPELAQAFLERIRGSSFDMRNISTIHRLGLLVCFYDGLELLDAALAQVLLHQMLKCSRLRGFQAGVQKLKANLLDIATENQTLN
ETLGSLSDAVVGLTSTQLESLSSDAVHSAISTLNQVTGWGRSQIVILSAKYLAQEKVLSFYSVSQMGVLLAGVGTQAFYSMDHKDLWQVLRSPLSQDMSDLSPVQHQGVLSKLMEAEDAASGIVEVPR
ALFKEVSLYDLWKGPGFNATVLKEKELRRSQALFLYELLEKTTERPEELLSSRQLVKGVQCSHIDAMSAHVFLALFQHFENNFSLLSPDQVNCLAWKYWEVSRSSMPPFLLATLPSRFLASVPPSRCV
RFLISLGKRHLDTLVLDSDKRSLVIRKVQQCLDGVIADEYTVDIVGNLLCHLPASFIERGISPRAWATALHGLRSCRALSSGQKAAVRFRLLEQWGPPQNWTAETTKDLAPFLAFFSGDELHTVATKF
PEILQQTASKMVGTLLPKEFLWAVFESVRNSSNESPGSDPTFGCHGVVTPSSDDIVKLAEANACWDPEVLLCMEEDTFIRNVELLGAVKGFSRPQLMALKEKAIQVWDLPSHWKEHHVVSLGRIALAL
NESELEQLDLSSIDTVASLGQQTEWTPGQAKSILQEFLEDSGCGIQDLKSFHLVGLGPTLCAMDPTEIPLIKTSEFRAVVARIGTLLCSTPVLAGFKKKAEVVFGRPTEWTSSILQELGTIAAGLTKA
ELRMLDKELMPYFQPWAIRCLPGEVFKELSTEQIASLGPQNAAFVTHSQRLQLSSSQLQSLQRAVDGAKTHFWQIDPMSSSPTWPASTGSPTGEPTFQALWLGCPLLLLMAKS

hide sequence

Ensembl Acc Id:

ENSRNOP00000023591 ⟸ ENSRNOT00000023591

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A6R6-F1-model_v2	AlphaFold	D4A6R6	1-1137	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-57581	BioCyc
Ensembl Genes	ENSRNOG00000017487	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000023591	ENTREZGENE
	ENSRNOT00000023591.5	UniProtKB/TrEMBL
InterPro	Stereocilin_related	UniProtKB/TrEMBL
NCBI Gene	499260	ENTREZGENE
PANTHER	PTHR23412	UniProtKB/TrEMBL
	PTHR23412:SF18	UniProtKB/TrEMBL
PhenoGen	Otoa	PhenoGen
RatGTEx	ENSRNOG00000017487	RatGTEx
UniProt	D4A6R6	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-29	Otoa	otoancorin	RGD1562741_predicted	similar to otoancorin (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1562741_predicted	similar to otoancorin (predicted)	LOC499260	similar to otoancorin	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC499260	similar to otoancorin			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM