Symbol:
Cln3
Name:
CLN3 lysosomal/endosomal transmembrane protein, battenin
RGD ID:
1359537
Description:
Predicted to enable calcium-dependent protein binding activity and sulfatide binding activity. Predicted to be involved in several processes, including modulation of chemical synaptic transmission; regulation of vesicle-mediated transport; and vacuole organization. Predicted to act upstream of or within several processes, including autophagosome maturation; regulation of filopodium assembly; and regulation of macromolecule metabolic process. Located in endosome. Human ortholog(s) of this gene implicated in neuronal ceroid lipofuscinosis 3. Orthologous to human CLN3 (CLN3 lysosomal/endosomal transmembrane protein, battenin); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
battenin; ceroid lipofuscinosis, neuronal 3, juvenile (Batten, Spielmeyer-Vogt disease); ceroid-lipofuscinosis, neuronal 3; CLN3, battenin; Cln3p; MGC94583
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CLN3 (CLN3 lysosomal/endosomal transmembrane protein, battenin) HGNC
EggNOG, Ensembl, Inparanoid, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Cln3 (CLN3 lysosomal/endosomal transmembrane protein, battenin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cln3 (CLN3 lysosomal/endosomal transmembrane protein, battenin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LOC117978823 (battenin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CLN3 (CLN3 lysosomal/endosomal transmembrane protein, battenin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cln3 (CLN3 lysosomal/endosomal transmembrane protein, battenin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CLN3 (CLN3 lysosomal/endosomal transmembrane protein, battenin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CLN3 (CLN3 lysosomal/endosomal transmembrane protein, battenin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cln3 (CLN3 lysosomal/endosomal transmembrane protein, battenin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
CLN3 (CLN3 lysosomal/endosomal transmembrane protein, battenin)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Cln3 (CLN3 lysosomal/endosomal transmembrane protein, battenin)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cln3 (CLN3 lysosomal/endosomal transmembrane protein, battenin)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Cln3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
YHC3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
cln-3.1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
cln-3.2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
cln-3.3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
cln3
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 190,586,649 - 190,600,034 (-) NCBI GRCr8 mRatBN7.2 1 181,156,071 - 181,169,458 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 181,156,073 - 181,167,434 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 189,507,073 - 189,518,479 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 196,693,161 - 196,704,568 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 189,360,633 - 189,371,909 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 197,986,384 - 197,999,726 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 197,986,385 - 197,997,664 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 204,965,144 - 204,978,485 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 185,713,096 - 185,724,375 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 185,862,977 - 185,874,256 (-) NCBI Celera 1 178,814,090 - 178,825,369 (-) NCBI Celera Cytogenetic Map 1 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cln3 Rat 1,2-dimethylhydrazine affects expression ISO Cln3 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine affects the expression of CLN3 mRNA CTD PMID:22206623 Cln3 Rat 17beta-estradiol decreases expression ISO CLN3 (Homo sapiens) 6480464 Estradiol results in decreased expression of CLN3 mRNA CTD PMID:31614463 Cln3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Cln3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CLN3 mRNA CTD PMID:21570461 Cln3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CLN3 mRNA CTD PMID:32109520 and PMID:33387578 Cln3 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Cln3 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of CLN3 mRNA CTD PMID:20188158 Cln3 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of CLN3 protein CTD PMID:34915118 Cln3 Rat 4,4'-diaminodiphenylmethane increases expression ISO Cln3 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of CLN3 mRNA CTD PMID:18648102 Cln3 Rat acrolein multiple interactions ISO CLN3 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of and results in increased oxidation of CLN3 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of and results in increased oxidation of CLN3 mRNA CTD PMID:32699268 Cln3 Rat aflatoxin B1 increases methylation ISO CLN3 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of CLN3 intron CTD PMID:30157460 Cln3 Rat alpha-pinene multiple interactions ISO CLN3 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of and results in increased oxidation of CLN3 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of and results in increased oxidation of CLN3 mRNA CTD PMID:32699268 Cln3 Rat arsenous acid decreases response to substance ISO CLN3 (Homo sapiens) 6480464 CLN3 protein results in decreased susceptibility to Arsenic Trioxide CTD PMID:20707922 Cln3 Rat atrazine increases expression ISO CLN3 (Homo sapiens) 6480464 Atrazine results in increased expression of CLN3 mRNA CTD PMID:22378314 Cln3 Rat benzo[a]pyrene decreases expression ISO CLN3 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of CLN3 mRNA CTD PMID:20106945 Cln3 Rat bis(2-ethylhexyl) phthalate increases expression ISO Cln3 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of CLN3 mRNA CTD PMID:33754040 Cln3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CLN3 mRNA CTD PMID:25181051 Cln3 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of CLN3 gene CTD PMID:28505145 Cln3 Rat bisphenol A decreases methylation ISO Cln3 (Mus musculus) 6480464 bisphenol A results in decreased methylation of CLN3 promoter CTD PMID:27312807 Cln3 Rat caffeine decreases phosphorylation ISO CLN3 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of CLN3 protein CTD PMID:35688186 Cln3 Rat carbon nanotube decreases expression ISO Cln3 (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of CLN3 mRNA CTD PMID:25620056 Cln3 Rat CGP 52608 multiple interactions ISO CLN3 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to CLN3 gene] CTD PMID:28238834 Cln3 Rat chlorpyrifos increases expression ISO Cln3 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of CLN3 mRNA CTD PMID:37019170 Cln3 Rat cisplatin multiple interactions ISO CLN3 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of CLN3 mRNA CTD PMID:27392435 Cln3 Rat clofibrate decreases expression ISO Cln3 (Mus musculus) 6480464 Clofibrate results in decreased expression of CLN3 mRNA CTD PMID:17585979 Cln3 Rat cobalt dichloride decreases expression ISO CLN3 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of CLN3 mRNA CTD PMID:19376846 Cln3 Rat copper(II) sulfate decreases expression ISO CLN3 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of CLN3 mRNA CTD PMID:19549813 Cln3 Rat cyclosporin A decreases expression ISO CLN3 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of CLN3 mRNA CTD PMID:20106945 and PMID:25562108 Cln3 Rat diarsenic trioxide decreases response to substance ISO CLN3 (Homo sapiens) 6480464 CLN3 protein results in decreased susceptibility to Arsenic Trioxide CTD PMID:20707922 Cln3 Rat Dibutyl phosphate affects expression ISO CLN3 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of CLN3 mRNA CTD PMID:37042841 Cln3 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of CLN3 mRNA CTD PMID:21266533 Cln3 Rat dorsomorphin multiple interactions ISO CLN3 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Cln3 Rat doxorubicin decreases expression ISO CLN3 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of CLN3 mRNA CTD PMID:29803840 Cln3 Rat elemental selenium multiple interactions ISO CLN3 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in increased expression of CLN3 mRNA CTD PMID:19244175 Cln3 Rat elemental selenium increases expression ISO CLN3 (Homo sapiens) 6480464 Selenium results in increased expression of CLN3 mRNA CTD PMID:19244175 Cln3 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of CLN3 mRNA CTD PMID:29391264 Cln3 Rat epoxiconazole decreases expression ISO Cln3 (Mus musculus) 6480464 epoxiconazole results in decreased expression of CLN3 mRNA CTD PMID:35436446 Cln3 Rat fenthion decreases expression ISO Cln3 (Mus musculus) 6480464 Fenthion results in decreased expression of CLN3 mRNA CTD PMID:34813904 Cln3 Rat folic acid decreases expression ISO Cln3 (Mus musculus) 6480464 Folic Acid results in decreased expression of CLN3 mRNA CTD PMID:25629700 Cln3 Rat folic acid decreases expression ISO CLN3 (Homo sapiens) 6480464 Folic Acid results in decreased expression of CLN3 mRNA CTD PMID:21867686 Cln3 Rat ionomycin multiple interactions ISO CLN3 (Homo sapiens) 6480464 [Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in decreased expression of CLN3 mRNA and pyrrolidine dithiocarbamic acid inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in decreased expression of CLN3 mRNA] CTD PMID:15477007 Cln3 Rat ivermectin decreases expression ISO CLN3 (Homo sapiens) 6480464 Ivermectin results in decreased expression of CLN3 protein CTD PMID:32959892 Cln3 Rat methidathion decreases expression ISO Cln3 (Mus musculus) 6480464 methidathion results in decreased expression of CLN3 mRNA CTD PMID:34813904 Cln3 Rat methotrexate affects response to substance ISO CLN3 (Homo sapiens) 6480464 CLN3 protein affects the susceptibility to Methotrexate CTD PMID:16217747 Cln3 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of CLN3 mRNA CTD PMID:22110744 Cln3 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of CLN3 mRNA CTD PMID:26720608 Cln3 Rat ozone multiple interactions ISO CLN3 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of and results in increased oxidation of CLN3 mRNA more ... CTD PMID:32699268 and PMID:35430440 Cln3 Rat p-chloromercuribenzoic acid increases expression ISO CLN3 (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in increased expression of CLN3 mRNA CTD PMID:26272509 Cln3 Rat p-chloromercuribenzoic acid multiple interactions ISO CLN3 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CLN3 mRNA CTD PMID:27188386 Cln3 Rat paracetamol decreases expression ISO CLN3 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of CLN3 mRNA CTD PMID:25704631 Cln3 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of CLN3 mRNA CTD PMID:33387578 Cln3 Rat phenylmercury acetate increases expression ISO CLN3 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of CLN3 mRNA CTD PMID:26272509 Cln3 Rat phenylmercury acetate multiple interactions ISO CLN3 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CLN3 mRNA CTD PMID:27188386 Cln3 Rat phorbol 13-acetate 12-myristate multiple interactions ISO CLN3 (Homo sapiens) 6480464 [Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in decreased expression of CLN3 mRNA and pyrrolidine dithiocarbamic acid inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in decreased expression of CLN3 mRNA] CTD PMID:15477007 Cln3 Rat pyrrolidine dithiocarbamate multiple interactions ISO CLN3 (Homo sapiens) 6480464 pyrrolidine dithiocarbamic acid inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in decreased expression of CLN3 mRNA] CTD PMID:15477007 Cln3 Rat quercetin increases phosphorylation ISO CLN3 (Homo sapiens) 6480464 Quercetin results in increased phosphorylation of CLN3 protein CTD PMID:35688186 Cln3 Rat resveratrol increases expression ISO Cln3 (Mus musculus) 6480464 resveratrol results in increased expression of CLN3 mRNA CTD PMID:22610192 Cln3 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of CLN3 mRNA CTD PMID:28374803 Cln3 Rat SB 431542 multiple interactions ISO CLN3 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Cln3 Rat selenium atom multiple interactions ISO CLN3 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in increased expression of CLN3 mRNA CTD PMID:19244175 Cln3 Rat selenium atom increases expression ISO CLN3 (Homo sapiens) 6480464 Selenium results in increased expression of CLN3 mRNA CTD PMID:19244175 Cln3 Rat sodium arsenite decreases expression ISO CLN3 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of CLN3 mRNA CTD PMID:34032870 Cln3 Rat sunitinib decreases expression ISO CLN3 (Homo sapiens) 6480464 Sunitinib results in decreased expression of CLN3 mRNA CTD PMID:31533062 Cln3 Rat tert-butyl hydroperoxide decreases expression ISO CLN3 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of CLN3 mRNA CTD PMID:15336504 Cln3 Rat testosterone increases expression ISO Cln3 (Mus musculus) 6480464 Testosterone deficiency results in increased expression of CLN3 mRNA CTD PMID:33848595 Cln3 Rat testosterone multiple interactions ISO Cln3 (Mus musculus) 6480464 1 more ... CTD PMID:33848595 Cln3 Rat tetrachloromethane decreases expression ISO Cln3 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of CLN3 mRNA CTD PMID:17484886 Cln3 Rat titanium dioxide increases expression ISO Cln3 (Mus musculus) 6480464 titanium dioxide results in increased expression of CLN3 mRNA CTD PMID:29264374 Cln3 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of CLN3 mRNA CTD PMID:33387578 Cln3 Rat triphenyl phosphate affects expression ISO CLN3 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of CLN3 mRNA CTD PMID:37042841 Cln3 Rat tunicamycin increases expression ISO CLN3 (Homo sapiens) 6480464 Tunicamycin results in increased expression of CLN3 mRNA CTD PMID:29453283 Cln3 Rat valproic acid increases methylation ISO CLN3 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of CLN3 gene CTD PMID:29154799 Cln3 Rat valproic acid increases expression ISO CLN3 (Homo sapiens) 6480464 Valproic Acid results in increased expression of CLN3 mRNA CTD PMID:23179753 Cln3 Rat valproic acid affects expression ISO CLN3 (Homo sapiens) 6480464 Valproic Acid affects the expression of CLN3 mRNA CTD PMID:25979313 Cln3 Rat vitamin E multiple interactions ISO CLN3 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in increased expression of CLN3 mRNA CTD PMID:19244175 Cln3 Rat vitamin E increases expression ISO CLN3 (Homo sapiens) 6480464 Vitamin E results in increased expression of CLN3 mRNA CTD PMID:19244175 Cln3 Rat Yessotoxin increases expression ISO CLN3 (Homo sapiens) 6480464 yessotoxin analog results in increased expression of CLN3 mRNA CTD PMID:30679557 Cln3 Rat zoledronic acid increases expression ISO CLN3 (Homo sapiens) 6480464 zoledronic acid results in increased expression of CLN3 mRNA CTD PMID:24714768
1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-diaminodiphenylmethane (ISO) acrolein (ISO) aflatoxin B1 (ISO) alpha-pinene (ISO) arsenous acid (ISO) atrazine (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) caffeine (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) cisplatin (ISO) clofibrate (ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) dorsomorphin (ISO) doxorubicin (ISO) elemental selenium (ISO) endosulfan (EXP) epoxiconazole (ISO) fenthion (ISO) folic acid (ISO) ionomycin (ISO) ivermectin (ISO) methidathion (ISO) methotrexate (ISO) nickel dichloride (EXP) nitrofen (EXP) ozone (ISO) p-chloromercuribenzoic acid (ISO) paracetamol (EXP,ISO) phenylmercury acetate (ISO) phorbol 13-acetate 12-myristate (ISO) pyrrolidine dithiocarbamate (ISO) quercetin (ISO) resveratrol (ISO) rotenone (EXP) SB 431542 (ISO) selenium atom (ISO) sodium arsenite (ISO) sunitinib (ISO) tert-butyl hydroperoxide (ISO) testosterone (ISO) tetrachloromethane (ISO) titanium dioxide (ISO) trichloroethene (EXP) triphenyl phosphate (ISO) tunicamycin (ISO) valproic acid (ISO) vitamin E (ISO) Yessotoxin (ISO) zoledronic acid (ISO)
Biological Process
actin cytoskeleton organization (IEA,ISO) action potential (IEA,ISO) amino acid transport (IEA,ISO) amyloid precursor protein catabolic process (ISO) associative learning (IEA,ISO) autophagosome maturation (IEA,ISO) autophagosome-lysosome fusion (IEA,ISO) biological_process (ND) blood vessel endothelial cell migration (IEA,ISO) endocytosis (IEA,ISO) establishment of localization in cell (IEA,ISO) glycerophospholipid biosynthetic process (ISO) glycolipid transport (ISO) Golgi to lysosome transport (ISO) intracellular water homeostasis (IEA,ISO) ionotropic glutamate receptor signaling pathway (IEA,ISO) L-arginine transmembrane transport (ISO) learning or memory (IEA,ISO) lysosomal lumen acidification (IBA,ISO) lysosomal lumen pH elevation (ISO) lysosomal protein catabolic process (IEA,ISO) lysosome organization (IBA,IEA,ISO) macroautophagy (IEA,ISO) membrane organization (IEA,ISO) negative regulation of apoptotic process (IEA,ISO) negative regulation of catalytic activity (ISO) negative regulation of neuron apoptotic process (IEA,ISO) negative regulation of proteolysis (IEA,ISO) neuromuscular process controlling balance (IEA,ISO) phagosome-lysosome docking (IEA,ISO) phagosome-lysosome fusion (IEA,ISO) plasma membrane raft organization (IEA,ISO) positive regulation of caveolin-mediated endocytosis (IEA,ISO) positive regulation of Golgi to plasma membrane protein transport (IEA,ISO) positive regulation of pinocytosis (IEA,ISO) positive regulation of protein phosphorylation (ISO) protein localization to membrane (IEA,ISO) protein localization to plasma membrane (IEA,ISO) protein phosphorylation (ISO) protein processing (IEA,ISO) receptor-mediated endocytosis (ISO) regulation of arginine biosynthetic process (IEA,ISO) regulation of autophagosome maturation (IEA,ISO) regulation of autophagosome size (IEA,ISO) regulation of autophagy (IEA,ISO) regulation of cellular response to osmotic stress (ISO) regulation of cytoskeleton organization (ISO) regulation of cytosolic calcium ion concentration (IEA,ISO) regulation of fibroblast migration (ISO) regulation of filopodium assembly (IEA,ISO) regulation of gene expression (ISO) regulation of modification of synaptic structure (IEA,ISO) regulation of phagosome maturation (IEA,ISO) regulation of protein localization to plasma membrane (IEA,ISO) regulation of protein processing (ISO) regulation of short-term neuronal synaptic plasticity (IEA,ISO) regulation of synaptic transmission, GABAergic (IEA,ISO) regulation of synaptic transmission, glutamatergic (IEA,ISO) renal potassium excretion (IEA,ISO) vesicle transport along microtubule (ISO)
Cellular Component
autolysosome (IEA,ISO) autophagosome (IEA,ISO) caveola (ISO) cytoplasm (ISO) cytoplasmic vesicle (IEA,ISO) cytosol (IEA) early endosome (IEA,ISO) early endosome membrane (ISO) endomembrane system (IEA) endoplasmic reticulum (ISO) endoplasmic reticulum membrane (ISO) endosome (IDA) Golgi apparatus (ISO) Golgi membrane (ISO) Golgi stack (ISO) late endosome (IEA,ISO) lysosomal membrane (IEA,ISO) lysosome (IBA,IEA,ISO) membrane (IEA,ISO) membrane raft (IEA,ISO) neuron projection (IEA,ISO) nucleus (ISO) plasma membrane (ISO) recycling endosome (ISO) synaptic vesicle (ISO) trans-Golgi network (IEA,ISO) vacuole (IEA)
1.
Characterization of Cln3p, the gene product responsible for juvenile neuronal ceroid lipofuscinosis, as a lysosomal integral membrane glycoprotein.
Ezaki J, etal., J Neurochem 2003 Dec;87(5):1296-308.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
4.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
5.
A galactosylceramide binding domain is involved in trafficking of CLN3 from Golgi to rafts via recycling endosomes.
Persaud-Sawin DA, etal., Pediatr Res. 2004 Sep;56(3):449-63. Epub 2004 Jul 7.
6.
GOA pipeline
RGD automated data pipeline
7.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
9.
Comprehensive gene review and curation
RGD comprehensive gene curation
10.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Cln3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 190,586,649 - 190,600,034 (-) NCBI GRCr8 mRatBN7.2 1 181,156,071 - 181,169,458 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 181,156,073 - 181,167,434 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 189,507,073 - 189,518,479 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 196,693,161 - 196,704,568 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 189,360,633 - 189,371,909 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 197,986,384 - 197,999,726 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 197,986,385 - 197,997,664 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 204,965,144 - 204,978,485 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 185,713,096 - 185,724,375 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 185,862,977 - 185,874,256 (-) NCBI Celera 1 178,814,090 - 178,825,369 (-) NCBI Celera Cytogenetic Map 1 q36 NCBI
CLN3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 28,466,653 - 28,492,082 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 28,474,111 - 28,495,575 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 28,477,974 - 28,503,403 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 28,396,101 - 28,411,124 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 28,396,101 - 28,410,717 NCBI Celera 16 27,700,143 - 27,715,170 (+) NCBI Celera Cytogenetic Map 16 p12.1 NCBI HuRef 16 26,514,259 - 26,529,549 (-) NCBI HuRef CHM1_1 16 29,500,208 - 29,515,233 (-) NCBI CHM1_1 T2T-CHM13v2.0 16 28,903,667 - 28,920,379 (+) NCBI T2T-CHM13v2.0 T2T-CHM13v2.0 16 28,747,320 - 28,747,572 (-) NCBI T2T-CHM13v2.0
Cln3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 126,170,571 - 126,184,991 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 126,170,379 - 126,184,989 (-) Ensembl GRCm39 Ensembl GRCm38 7 126,571,207 - 126,585,817 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 126,571,207 - 126,585,817 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 133,714,914 - 133,727,794 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 126,362,548 - 126,374,368 (-) NCBI MGSCv36 mm8 Celera 7 126,395,665 - 126,433,408 (-) NCBI Celera Cytogenetic Map 7 F3 NCBI cM Map 7 69.16 NCBI
Cln3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955493 6,696,241 - 6,707,849 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955493 6,696,520 - 6,707,849 (-) NCBI ChiLan1.0 ChiLan1.0
LOC117978823 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 31,065,290 - 31,097,172 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 34,996,679 - 35,011,769 (+) NCBI NHGRI_mPanPan1
CLN3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 18,252,543 - 18,266,033 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 18,254,139 - 18,266,033 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 19,832,816 - 19,844,709 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 18,390,161 - 18,402,054 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 18,390,161 - 18,402,054 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 18,189,180 - 18,201,073 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 18,104,266 - 18,116,159 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 18,420,341 - 18,432,234 (+) NCBI UU_Cfam_GSD_1.0
Cln3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 123,857,474 - 123,870,439 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936501 11,955,184 - 11,967,436 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936501 11,955,334 - 11,967,338 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CLN3
CLN3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 26,320,132 - 26,343,009 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 26,320,061 - 26,337,402 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666068 3,236,192 - 3,251,867 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cln3
.
Predicted Target Of
Count of predictions: 50 Count of miRNA genes: 44 Interacting mature miRNAs: 46 Transcripts: ENSRNOT00000025898 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1354653 Despr9 Despair related QTL 9 0.00019 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 167909849 212909849 Rat 1578770 Stresp23 Stress response QTL 23 kidney sympathetic nerve activity (VT:0004050) stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786) 1 123350408 182418476 Rat 2293673 Bss27 Bone structure and strength QTL 27 18.63 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 1 171629477 216629477 Rat 61326 Eae6 Experimental allergic encephalomyelitis QTL 6 5.3 body mass (VT:0001259) change in body weight (CMO:0002045) 1 172949660 181830018 Rat 2293677 Bss41 Bone structure and strength QTL 41 9.38 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 1 171629477 216629477 Rat 1302787 Stl25 Serum triglyceride level QTL 25 2.7 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 180359209 210702199 Rat 70160 Bw18 Body weight QTL 18 5.7 body mass (VT:0001259) body weight (CMO:0000012) 1 144267353 196383668 Rat 1549830 Bss1 Bone structure and strength QTL 1 4.8 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 172609619 217609619 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 70163 Bw20 Body weight QTL 20 5.1 body mass (VT:0001259) body weight (CMO:0000012) 1 174133260 219133260 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1558658 Bw59 Body weight QTL 59 3.5 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 1 178784622 223784622 Rat 1354636 Lmblg1 Limb length QTL 1 6.4 tibia length (VT:0004357) tibia length (CMO:0000450) 1 151162512 201278233 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 2293689 Bss47 Bone structure and strength QTL 47 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 1 171629477 216629477 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 61341 Bp26 Blood pressure QTL 26 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 169537671 214537671 Rat 1354634 Kidm12 Kidney mass QTL 12 3.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 1 151162512 201278233 Rat 4889428 Stresp24 Stress response QTL 24 0.05 heart pumping trait (VT:2000009) absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162) 1 155866514 200866514 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 61343 Bp28 Blood pressure QTL 28 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 151646613 196646613 Rat 2293693 Bss22 Bone structure and strength QTL 22 33.52 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 1 171629477 216629477 Rat 2300161 Bmd43 Bone mineral density QTL 43 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 61347 Bp197 Blood pressure QTL 197 4.2 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 1 158633083 203633083 Rat 61348 Bp30 Blood pressure QTL 30 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 144017057 197814409 Rat 8655649 Arrd1 Age-related retinal degeneration QTL 1 4.89 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 100357752 183970443 Rat 2303622 Vencon6 Ventilatory control QTL 6 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 1 154561505 199561505 Rat 631214 Bw61 Body weight QTL61 3.4 0.0001 intramuscular adipose amount (VT:0010044) intramuscular fat area (CMO:0001162) 1 173108781 218108781 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 1300158 Bp173 Blood pressure QTL 173 3.48 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 1 115540693 185145286 Rat 2300174 Bmd42 Bone mineral density QTL 42 8.4 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 1 171629477 216629477 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 737977 Bp160 Blood pressure QTL 160 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 181133855 226133855 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 2293654 Bss30 Bone structure and strength QTL 30 32.65 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 1 171629477 216629477 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 2300187 Bmd41 Bone mineral density QTL 41 8.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 1641895 Bp298 Blood pressure QTL 298 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 123350408 182418476 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358294 Bw37 Body weight QTL 37 5 0.000011 body mass (VT:0001259) body weight (CMO:0000012) 1 171310381 216310381 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 10059600 Bp378 Blood pressure QTL 378 3.08 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 176869060 221869060 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 724550 Thym3 Thymus enlargement QTL 3 7.82 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 2312558 Glom17 Glomerulus QTL 17 3.9 0.001 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 166532971 191278129 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 71118 Thym1 Thymus enlargement QTL 1 10.17 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 619613 Bp77 Blood pressure QTL 77 0.01 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 164747424 209747424 Rat 631519 Pia11 Pristane induced arthritis QTL 11 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 136830018 181830018 Rat 619614 Bp78 Blood pressure QTL 78 0.001 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 169112897 197261052 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 724562 Rends1 Renal damage susceptibility QTL 1 0.05 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 1 169537671 214537671 Rat 2292222 Bp307 Blood pressure QTL 307 3.06 0.0014 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 213533942 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 1600380 Niddm70 Non-insulin dependent diabetes mellitus QTL 70 3.1 0.0008 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 176550523 221550523 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1354620 Kidm19 Kidney mass QTL 19 4 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 201278233 Rat 1354618 Kidm15 Kidney mass QTL 15 5 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 1 156677124 201278233 Rat 6903303 Scl34 Serum cholesterol QTL 34 2.5 0.0033 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 180359209 218108781 Rat 631544 Bp84 Blood pressure QTL 84 5.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350408 181759564 Rat 152025212 Bw190 Body weight QTL 190 5.7 body mass (VT:0001259) 1 123556856 196963478 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 1358189 Cstrr1 Cold stress response QTL 1 0.0001 catecholamine amount (VT:0010543) urine norepinephrine level (CMO:0001629) 1 123350408 182418476 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1354602 Bw35 Body weight QTL 35 12.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 201278233 Rat 2325725 Eae31 Experimental allergic encephalomyelitis QTL 31 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 1 178810256 188377506 Rat 631670 Iddm10 Insulin dependent diabetes mellitus QTL 10 1.9 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 174133260 196383668 Rat
RH129744
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 181,156,170 - 181,156,350 (+) MAPPER mRatBN7.2 Rnor_6.0 1 197,986,484 - 197,986,663 NCBI Rnor6.0 Rnor_5.0 1 204,965,244 - 204,965,423 UniSTS Rnor5.0 RGSC_v3.4 1 185,713,196 - 185,713,375 UniSTS RGSC3.4 Celera 1 178,814,190 - 178,814,369 UniSTS Cytogenetic Map 1 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000025898 ⟹ ENSRNOP00000025898
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 181,156,073 - 181,167,434 (-) Ensembl Rnor_6.0 Ensembl 1 197,986,385 - 197,997,664 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000117379 ⟹ ENSRNOP00000095097
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 181,156,075 - 181,167,417 (-) Ensembl
RefSeq Acc Id:
NM_001006971 ⟹ NP_001006972
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 190,586,649 - 190,597,929 (-) NCBI mRatBN7.2 1 181,156,071 - 181,167,353 (-) NCBI Rnor_6.0 1 197,986,384 - 197,997,664 (-) NCBI Rnor_5.0 1 204,965,144 - 204,978,485 (-) NCBI RGSC_v3.4 1 185,713,096 - 185,724,375 (-) RGD Celera 1 178,814,090 - 178,825,369 (-) RGD
Sequence:
CTCTGCTGCTCTTAAAGTAGTGTACAGCAGACCGCGGAACCTGTGACTGACCACGGGGCGTTGATCCCACCTGTCCCAGACTTTCATCTGTTTTCTTGACGCTAACTCCTAACACACGCTGACTTTAG
hide sequence
RefSeq Acc Id:
XM_008759875 ⟹ XP_008758097
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 190,586,649 - 190,596,560 (-) NCBI mRatBN7.2 1 181,156,071 - 181,168,656 (-) NCBI Rnor_6.0 1 197,986,384 - 197,999,041 (-) NCBI
Sequence:
GCAGCCTGAGTGACTCAGGTCTTGTATTCACACCTCAGCCGTTTCCGTCTCCTCCAAGCCACAG
hide sequence
RefSeq Acc Id:
XM_039107240 ⟹ XP_038963168
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 190,586,649 - 190,599,547 (-) NCBI mRatBN7.2 1 181,156,076 - 181,168,971 (-) NCBI
RefSeq Acc Id:
XM_039107246 ⟹ XP_038963174
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 190,586,649 - 190,599,229 (-) NCBI mRatBN7.2 1 181,156,076 - 181,168,655 (-) NCBI
RefSeq Acc Id:
XM_039107249 ⟹ XP_038963177
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 190,586,649 - 190,600,034 (-) NCBI mRatBN7.2 1 181,156,076 - 181,169,458 (-) NCBI
RefSeq Acc Id:
XM_039107253 ⟹ XP_038963181
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 190,586,649 - 190,599,547 (-) NCBI mRatBN7.2 1 181,156,071 - 181,168,655 (-) NCBI
RefSeq Acc Id:
XM_039107263 ⟹ XP_038963191
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 190,586,649 - 190,597,464 (-) NCBI mRatBN7.2 1 181,156,071 - 181,166,888 (-) NCBI
RefSeq Acc Id:
XM_039107268 ⟹ XP_038963196
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 190,586,649 - 190,597,545 (-) NCBI mRatBN7.2 1 181,156,071 - 181,166,937 (-) NCBI
RefSeq Acc Id:
XM_039107273 ⟹ XP_038963201
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 190,586,649 - 190,597,544 (-) NCBI mRatBN7.2 1 181,156,071 - 181,166,969 (-) NCBI
RefSeq Acc Id:
XR_010065644
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 190,587,063 - 190,599,543 (-) NCBI
RefSeq Acc Id:
NP_001006972 ⟸ NM_001006971
- UniProtKB:
Q5XIH8 (UniProtKB/TrEMBL), A0A8I6ALZ9 (UniProtKB/TrEMBL)
- Sequence:
MGSSESSWRRLEDSEREETDSEPQTPPLDNLSVLWKNAVGFWILGLCNNFSYVVMLSAAHDILKQEQASGNQSHVEPGPTPMPHNSSSRFDCNSISTAAVLLADILPTLVIKLLAPLGLHLLPYSPRV
hide sequence
RefSeq Acc Id:
XP_008758097 ⟸ XM_008759875
- Peptide Label:
isoform X4
- UniProtKB:
F7F0I2 (UniProtKB/TrEMBL)
- Sequence:
MPHNSSSRFDCNSISTAAVLLADILPTLVIKLLAPLGLHLLPYSPRVLVSGVCSAGSFVLVAFS
hide sequence
Ensembl Acc Id:
ENSRNOP00000025898 ⟸ ENSRNOT00000025898
RefSeq Acc Id:
XP_038963181 ⟸ XM_039107253
- Peptide Label:
isoform X1
- UniProtKB:
Q5XIH8 (UniProtKB/TrEMBL), A0A8I6ALZ9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038963201 ⟸ XM_039107273
- Peptide Label:
isoform X3
- UniProtKB:
A6I990 (UniProtKB/TrEMBL), F7F0I2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038963196 ⟸ XM_039107268
- Peptide Label:
isoform X2
- UniProtKB:
F7F0I2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038963191 ⟸ XM_039107263
- Peptide Label:
isoform X2
- UniProtKB:
F7F0I2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038963177 ⟸ XM_039107249
- Peptide Label:
isoform X1
- UniProtKB:
Q5XIH8 (UniProtKB/TrEMBL), A0A8I6ALZ9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038963168 ⟸ XM_039107240
- Peptide Label:
isoform X1
- UniProtKB:
Q5XIH8 (UniProtKB/TrEMBL), A0A8I6ALZ9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038963174 ⟸ XM_039107246
- Peptide Label:
isoform X1
- UniProtKB:
Q5XIH8 (UniProtKB/TrEMBL), A0A8I6ALZ9 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000095097 ⟸ ENSRNOT00000117379
RGD ID: 13690401 Promoter ID: EPDNEW_R926 Type: initiation region Name: Cln3_1 Description: CLN3, battenin SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 197,997,682 - 197,997,742 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-04-10
Cln3
CLN3 lysosomal/endosomal transmembrane protein, battenin
Cln3
CLN3, battenin
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2017-07-05
Cln3
CLN3, battenin
Cln3
ceroid-lipofuscinosis, neuronal 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-09-24
Cln3
ceroid-lipofuscinosis, neuronal 3
Cln3
ceroid lipofuscinosis, neuronal 3, juvenile (Batten, Spielmeyer-Vogt disease)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Cln3
ceroid lipofuscinosis, neuronal 3, juvenile (Batten, Spielmeyer-Vogt disease)
Cln3p
Name updated
1299863 APPROVED
2005-07-29
Cln3
Cln3p
Symbol and Name status set to provisional
70820 PROVISIONAL
