Symbol:
Acat2
Name:
acetyl-CoA acetyltransferase 2
RGD ID:
1359366
Description:
Enables acetyl-CoA C-acetyltransferase activity. Involved in several processes, including cellular response to fatty acid; ketone body catabolic process; and liver development. Predicted to be located in cytoplasm. Human ortholog(s) of this gene implicated in coronary artery disease. Orthologous to human ACAT2 (acetyl-CoA acetyltransferase 2); PARTICIPATES IN alendronate pharmacodynamics pathway; cholesterol biosynthetic pathway; cholesterol ester storage disease pathway; INTERACTS WITH 1-(3-(trifluoromethyl)phenyl)piperazine; 1-benzylpiperazine; 1-naphthyl isothiocyanate.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Ab2-076; Acat3; acetyl-CoA acetyltransferase, cytosolic; acetyl-Coenzyme A acetyltransferase 2; acetyl-Coenzyme A acetyltransferase 3; cytosolic acetoacetyl-CoA thiolase; LOC678796; MGC95138; similar to acetyl CoA transferase-like; similar to acetyl-Coenzyme A acetyltransferase 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 50,100,840 - 50,118,886 (+) NCBI GRCr8 mRatBN7.2 1 47,695,833 - 47,713,879 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 47,695,788 - 47,752,821 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 48,244,680 - 48,262,723 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 54,232,698 - 54,250,748 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 48,320,196 - 48,338,239 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 47,972,399 - 47,992,654 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 47,972,399 - 47,992,653 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 51,757,961 - 51,776,935 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 41,922,020 - 41,940,074 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 41,924,964 - 41,943,018 (+) NCBI Celera 1 43,380,977 - 43,399,019 (+) NCBI Celera Cytogenetic Map 1 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Acat2 Rat (-)-epigallocatechin 3-gallate increases expression ISO ACAT2 (Homo sapiens) 6480464 epigallocatechin gallate results in increased expression of ACAT2 mRNA CTD PMID:32512070 Acat2 Rat 1,2-dimethylhydrazine multiple interactions ISO Acat2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ACAT2 mRNA CTD PMID:22206623 Acat2 Rat 1-(3-(trifluoromethyl)phenyl)piperazine increases expression EXP 6480464 1-(3-trifluoromethylphenyl)piperazine results in increased expression of ACAT2 mRNA CTD PMID:26821219 Acat2 Rat 1-benzylpiperazine increases expression EXP 6480464 N-benzylpiperazine results in increased expression of ACAT2 mRNA CTD PMID:26821219 Acat2 Rat 1-chloro-2,4-dinitrobenzene affects binding ISO ACAT2 (Homo sapiens) 6480464 Dinitrochlorobenzene binds to ACAT2 protein CTD PMID:32991956 Acat2 Rat 1-naphthyl isothiocyanate affects expression ISO Acat2 (Mus musculus) 6480464 1-Naphthylisothiocyanate affects the expression of ACAT2 mRNA CTD PMID:28549656 Acat2 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of ACAT2 mRNA CTD PMID:30723492 Acat2 Rat 1-naphthyl isothiocyanate multiple interactions ISO Acat2 (Mus musculus) 6480464 18alpha-glycyrrhetinic acid affects the reaction [1-Naphthylisothiocyanate affects the expression of ACAT2 mRNA] and Glycyrrhizic Acid affects the reaction [1-Naphthylisothiocyanate affects the expression of ACAT2 mRNA] CTD PMID:28549656 Acat2 Rat 17alpha-ethynylestradiol affects expression ISO Acat2 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of ACAT2 mRNA CTD PMID:17555576 Acat2 Rat 17alpha-ethynylestradiol multiple interactions ISO Acat2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ACAT2 mRNA CTD PMID:17942748 Acat2 Rat 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of ACAT2 mRNA CTD PMID:17351261 Acat2 Rat 17alpha-ethynylestradiol increases expression ISO Acat2 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of ACAT2 mRNA CTD PMID:17942748 Acat2 Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of ACAT2 mRNA CTD PMID:32145629 Acat2 Rat 17beta-estradiol increases expression ISO Acat2 (Mus musculus) 6480464 Estradiol results in increased expression of ACAT2 mRNA CTD PMID:39298647 Acat2 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Acat2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:28433925 Acat2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Acat2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ACAT2 mRNA CTD PMID:21570461 Acat2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ACAT2 mRNA CTD PMID:33387578 Acat2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ACAT2 mRNA CTD PMID:32109520 Acat2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Acat2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:17942748 and PMID:28433925 Acat2 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Acat2 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of ACAT2 mRNA CTD PMID:21346803 Acat2 Rat 2,6-dimethoxyphenol multiple interactions ISO ACAT2 (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in decreased expression of ACAT2 protein CTD PMID:38598786 Acat2 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of ACAT2 mRNA CTD PMID:21346803 Acat2 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:23196670 Acat2 Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of ACAT2 mRNA CTD PMID:19162173 Acat2 Rat 4,4'-sulfonyldiphenol increases expression ISO ACAT2 (Homo sapiens) 6480464 bisphenol S results in increased expression of ACAT2 mRNA and bisphenol S results in increased expression of ACAT2 protein CTD PMID:27685785 and PMID:34186270 Acat2 Rat 4,4'-sulfonyldiphenol increases expression ISO Acat2 (Mus musculus) 6480464 bisphenol S results in increased expression of ACAT2 mRNA CTD PMID:39298647 Acat2 Rat 5-aza-2'-deoxycytidine affects expression ISO ACAT2 (Homo sapiens) 6480464 Decitabine affects the expression of ACAT2 mRNA CTD PMID:23300844 Acat2 Rat 6-(4-chlorophenyl)imidazo[2,1-b][1,3]thiazole-5-carbaldehyde O-(3,4-dichlorobenzyl)oxime multiple interactions ISO ACAT2 (Homo sapiens) 6480464 [6-(4-chlorophenyl)imidazo(2 more ... CTD PMID:30611723 Acat2 Rat 8-Br-cAMP increases expression ISO ACAT2 (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in increased expression of ACAT2 mRNA CTD PMID:22079614 Acat2 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of ACAT2 mRNA CTD PMID:31881176 Acat2 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of ACAT2 mRNA CTD PMID:28959563 Acat2 Rat acrylamide decreases expression ISO ACAT2 (Homo sapiens) 6480464 Acrylamide results in decreased expression of ACAT2 mRNA CTD PMID:32763439 Acat2 Rat actinomycin D multiple interactions ISO ACAT2 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of ACAT2 protein CTD PMID:38460933 Acat2 Rat aflatoxin B1 decreases methylation ISO ACAT2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of ACAT2 gene CTD PMID:27153756 Acat2 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of ACAT2 mRNA CTD PMID:33354967 Acat2 Rat aflatoxin B1 decreases expression ISO ACAT2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of ACAT2 mRNA CTD PMID:27153756 Acat2 Rat all-trans-retinoic acid decreases expression ISO ACAT2 (Homo sapiens) 6480464 Tretinoin results in decreased expression of ACAT2 mRNA CTD PMID:23724009 Acat2 Rat all-trans-retinoic acid increases expression ISO ACAT2 (Homo sapiens) 6480464 Tretinoin results in increased expression of ACAT2 mRNA CTD PMID:33167477 Acat2 Rat alpha-hexachlorocyclohexane increases expression EXP 6480464 alpha-hexachlorocyclohexane results in increased expression of ACAT2 mRNA CTD PMID:17785943 Acat2 Rat amiodarone increases expression EXP 6480464 Amiodarone results in increased expression of ACAT2 mRNA CTD PMID:32084307 Acat2 Rat ampicillin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of ACAT2 protein CTD PMID:30545405 Acat2 Rat Archazolid B increases expression ISO ACAT2 (Homo sapiens) 6480464 archazolid B results in increased expression of ACAT2 mRNA CTD PMID:25218289 Acat2 Rat arsane multiple interactions ISO ACAT2 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ACAT2 mRNA CTD PMID:39836092 Acat2 Rat arsenic atom multiple interactions ISO ACAT2 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ACAT2 mRNA CTD PMID:39836092 Acat2 Rat arsenous acid decreases expression ISO ACAT2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of ACAT2 mRNA CTD PMID:19128835 Acat2 Rat avobenzone increases expression ISO ACAT2 (Homo sapiens) 6480464 avobenzone results in increased expression of ACAT2 mRNA CTD PMID:31016361 Acat2 Rat azathioprine decreases expression ISO ACAT2 (Homo sapiens) 6480464 Azathioprine results in decreased expression of ACAT2 mRNA CTD PMID:22623647 Acat2 Rat azoxystrobin increases expression ISO ACAT2 (Homo sapiens) 6480464 azoxystrobin results in increased expression of ACAT2 mRNA CTD PMID:33512557 Acat2 Rat beauvericin multiple interactions ISO ACAT2 (Homo sapiens) 6480464 [beauvericin co-treated with enniatins] results in decreased expression of ACAT2 protein CTD PMID:32407736 Acat2 Rat benzo[a]pyrene decreases expression ISO Acat2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of ACAT2 mRNA CTD PMID:22228805 Acat2 Rat benzo[a]pyrene affects methylation ISO ACAT2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of ACAT2 promoter CTD PMID:27901495 Acat2 Rat benzo[a]pyrene decreases expression ISO ACAT2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of ACAT2 mRNA CTD PMID:21632981 more ... Acat2 Rat beta-naphthoflavone decreases expression ISO Acat2 (Mus musculus) 6480464 beta-Naphthoflavone results in decreased expression of ACAT2 mRNA CTD PMID:22234961 Acat2 Rat beta-naphthoflavone decreases expression ISO ACAT2 (Homo sapiens) 6480464 beta-Naphthoflavone results in decreased expression of ACAT2 mRNA CTD PMID:31225620 Acat2 Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of ACAT2 mRNA CTD PMID:18164116 Acat2 Rat beta-naphthoflavone multiple interactions ISO Acat2 (Mus musculus) 6480464 AHR protein affects the reaction [beta-Naphthoflavone results in decreased expression of ACAT2 mRNA] CTD PMID:22234961 Acat2 Rat bis(2-ethylhexyl) phthalate increases expression ISO Acat2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of ACAT2 mRNA CTD PMID:19850644 and PMID:35550907 Acat2 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Acat2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:28433925 Acat2 Rat bisphenol A increases expression ISO Acat2 (Mus musculus) 6480464 bisphenol A results in increased expression of ACAT2 mRNA CTD PMID:25270620 Acat2 Rat bisphenol A decreases expression ISO ACAT2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of ACAT2 mRNA and bisphenol A results in decreased expression of ACAT2 protein CTD PMID:34186270 more ... Acat2 Rat bisphenol A multiple interactions ISO ACAT2 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of ACAT2 gene CTD PMID:31601247 Acat2 Rat bisphenol A affects expression ISO ACAT2 (Homo sapiens) 6480464 bisphenol A affects the expression of ACAT2 mRNA CTD PMID:30903817 Acat2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ACAT2 mRNA CTD PMID:30816183 more ... Acat2 Rat bisphenol A multiple interactions ISO Acat2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:28433925 Acat2 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ACAT2 mRNA CTD PMID:25181051 and PMID:32145629 Acat2 Rat bisphenol AF increases expression ISO ACAT2 (Homo sapiens) 6480464 bisphenol AF results in increased expression of ACAT2 protein CTD PMID:34186270 Acat2 Rat Bisphenol B increases expression ISO ACAT2 (Homo sapiens) 6480464 bisphenol B results in increased expression of ACAT2 protein CTD PMID:34186270 Acat2 Rat bisphenol F increases expression ISO ACAT2 (Homo sapiens) 6480464 bisphenol F results in increased expression of ACAT2 protein CTD PMID:34186270 Acat2 Rat bromobenzene decreases expression EXP 6480464 bromobenzene results in decreased expression of ACAT2 mRNA CTD PMID:32479839 Acat2 Rat butyric acid increases expression ISO ACAT2 (Homo sapiens) 6480464 Butyric Acid results in increased expression of ACAT2 protein CTD PMID:34581912 Acat2 Rat cadmium atom multiple interactions ISO ACAT2 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of ACAT2 protein CTD PMID:33040242 Acat2 Rat cadmium dichloride multiple interactions ISO ACAT2 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of ACAT2 protein CTD PMID:33040242 Acat2 Rat cadmium dichloride increases expression ISO ACAT2 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of ACAT2 protein CTD PMID:24527689 Acat2 Rat caffeine decreases expression ISO ACAT2 (Homo sapiens) 6480464 Caffeine results in decreased expression of ACAT2 mRNA CTD PMID:11793227 Acat2 Rat captan increases expression ISO Acat2 (Mus musculus) 6480464 Captan results in increased expression of ACAT2 mRNA CTD PMID:31558096 Acat2 Rat carbon nanotube increases expression ISO Acat2 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Acat2 Rat carbon nanotube decreases expression ISO Acat2 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Acat2 Rat chlorpyrifos decreases methylation EXP 6480464 Chlorpyrifos results in decreased methylation of ACAT2 gene CTD PMID:32905263 Acat2 Rat chlorpyrifos increases expression ISO Acat2 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of ACAT2 mRNA CTD PMID:37019170 Acat2 Rat cisplatin affects expression ISO ACAT2 (Homo sapiens) 6480464 Cisplatin affects the expression of ACAT2 mRNA CTD PMID:23300844 Acat2 Rat cisplatin multiple interactions ISO ACAT2 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of ACAT2 mRNA CTD PMID:27392435 Acat2 Rat cisplatin increases expression ISO ACAT2 (Homo sapiens) 6480464 Cisplatin results in increased expression of ACAT2 mRNA CTD PMID:27392435 Acat2 Rat clozapine increases expression ISO ACAT2 (Homo sapiens) 6480464 Clozapine results in increased expression of ACAT2 mRNA CTD PMID:17052361 Acat2 Rat copper atom multiple interactions ISO ACAT2 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of ACAT2 mRNA CTD PMID:20971185 Acat2 Rat copper(0) multiple interactions ISO ACAT2 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of ACAT2 mRNA CTD PMID:20971185 Acat2 Rat copper(II) chloride decreases expression ISO ACAT2 (Homo sapiens) 6480464 cupric chloride results in decreased expression of ACAT2 mRNA CTD PMID:34921933 and PMID:38568856 Acat2 Rat copper(II) sulfate decreases expression ISO ACAT2 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of ACAT2 mRNA CTD PMID:19549813 Acat2 Rat coumestrol increases expression ISO ACAT2 (Homo sapiens) 6480464 Coumestrol results in increased expression of ACAT2 mRNA CTD PMID:19167446 Acat2 Rat coumestrol multiple interactions ISO ACAT2 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of ACAT2 mRNA CTD PMID:19167446 Acat2 Rat cyclosporin A decreases expression ISO Acat2 (Mus musculus) 6480464 Cyclosporine results in decreased expression of ACAT2 mRNA CTD PMID:23830897 Acat2 Rat cyclosporin A decreases expression ISO ACAT2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of ACAT2 mRNA CTD PMID:20106945 more ... Acat2 Rat cyproconazole multiple interactions EXP 6480464 [cyproconazole co-treated with epoxiconazole] results in increased expression of ACAT2 mRNA CTD PMID:29038839 Acat2 Rat dexamethasone increases expression ISO ACAT2 (Homo sapiens) 6480464 Dexamethasone results in increased expression of ACAT2 mRNA CTD PMID:25047013 Acat2 Rat diarsenic trioxide decreases expression ISO ACAT2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of ACAT2 mRNA CTD PMID:19128835 Acat2 Rat Dibutyl phosphate affects expression ISO ACAT2 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of ACAT2 mRNA CTD PMID:37042841 Acat2 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of ACAT2 mRNA CTD PMID:21266533 Acat2 Rat dicrotophos decreases expression ISO ACAT2 (Homo sapiens) 6480464 dicrotophos results in decreased expression of ACAT2 mRNA CTD PMID:28302478 Acat2 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of ACAT2 mRNA CTD PMID:21551480 Acat2 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of ACAT2 mRNA CTD PMID:29391264 Acat2 Rat endosulfan affects expression EXP 6480464 Endosulfan affects the expression of ACAT2 mRNA CTD PMID:29391264 Acat2 Rat enniatin multiple interactions ISO ACAT2 (Homo sapiens) 6480464 [beauvericin co-treated with enniatins] results in decreased expression of ACAT2 protein CTD PMID:32407736 Acat2 Rat Enterolactone multiple interactions ISO ACAT2 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of ACAT2 mRNA CTD PMID:19167446 Acat2 Rat entinostat decreases expression ISO ACAT2 (Homo sapiens) 6480464 entinostat results in decreased expression of ACAT2 mRNA CTD PMID:27188386 Acat2 Rat enzyme inhibitor multiple interactions ISO ACAT2 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of ACAT2 protein CTD PMID:23301498 Acat2 Rat epoxiconazole multiple interactions EXP 6480464 [cyproconazole co-treated with epoxiconazole] results in increased expression of ACAT2 mRNA CTD PMID:29038839 Acat2 Rat ethanol increases expression ISO Acat2 (Mus musculus) 6480464 Ethanol results in increased expression of ACAT2 mRNA CTD PMID:19167417 Acat2 Rat farnesol increases expression ISO ACAT2 (Homo sapiens) 6480464 Farnesol analog results in increased expression of ACAT2 mRNA CTD PMID:30611723 Acat2 Rat fenvalerate decreases expression EXP 6480464 fenvalerate results in decreased expression of ACAT2 protein CTD PMID:33656234 Acat2 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of ACAT2 mRNA and Flutamide results in increased expression of ACAT2 protein CTD PMID:17311803 and PMID:21525395 Acat2 Rat folic acid multiple interactions ISO Acat2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ACAT2 mRNA CTD PMID:22206623 Acat2 Rat folpet increases expression ISO Acat2 (Mus musculus) 6480464 folpet results in increased expression of ACAT2 mRNA CTD PMID:31558096 Acat2 Rat formaldehyde decreases expression ISO ACAT2 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of ACAT2 mRNA CTD PMID:23649840 Acat2 Rat fulvestrant multiple interactions ISO ACAT2 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of ACAT2 gene CTD PMID:31601247 Acat2 Rat furfural multiple interactions ISO ACAT2 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of ACAT2 protein CTD PMID:38598786 Acat2 Rat gentamycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of ACAT2 protein CTD PMID:30545405 Acat2 Rat glycyrrhetinate multiple interactions ISO Acat2 (Mus musculus) 6480464 18alpha-glycyrrhetinic acid affects the reaction [1-Naphthylisothiocyanate affects the expression of ACAT2 mRNA] CTD PMID:28549656 Acat2 Rat glycyrrhetinic acid multiple interactions ISO Acat2 (Mus musculus) 6480464 18alpha-glycyrrhetinic acid affects the reaction [1-Naphthylisothiocyanate affects the expression of ACAT2 mRNA] CTD PMID:28549656 Acat2 Rat glycyrrhizinic acid multiple interactions ISO Acat2 (Mus musculus) 6480464 Glycyrrhizic Acid affects the reaction [1-Naphthylisothiocyanate affects the expression of ACAT2 mRNA] CTD PMID:28549656 Acat2 Rat GW 4064 increases expression ISO Acat2 (Mus musculus) 6480464 GW 4064 results in increased expression of ACAT2 mRNA CTD PMID:26655953 Acat2 Rat GW 4064 multiple interactions ISO ACAT2 (Homo sapiens) 6480464 [GW 4064 co-treated with Oleic Acid] results in decreased expression of ACAT2 mRNA CTD PMID:30611723 Acat2 Rat hyaluronic acid multiple interactions EXP 6480464 Hyaluronic Acid analog inhibits the reaction [Hydrogen Peroxide results in decreased expression of ACAT2 protein] CTD PMID:23178681 Acat2 Rat hyaluronic acid decreases expression EXP 6480464 Hyaluronic Acid analog results in decreased expression of ACAT2 protein CTD PMID:23178681 Acat2 Rat hydralazine multiple interactions ISO ACAT2 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of ACAT2 mRNA CTD PMID:17183730 Acat2 Rat hydrogen peroxide multiple interactions ISO ACAT2 (Homo sapiens) 6480464 [isoquercitrin co-treated with Hydrogen Peroxide] results in increased expression of ACAT2 mRNA CTD PMID:18032389 Acat2 Rat hydrogen peroxide decreases expression EXP 6480464 Hydrogen Peroxide results in decreased expression of ACAT2 protein CTD PMID:23178681 Acat2 Rat hydrogen peroxide multiple interactions EXP 6480464 Hyaluronic Acid analog inhibits the reaction [Hydrogen Peroxide results in decreased expression of ACAT2 protein] CTD PMID:23178681 Acat2 Rat hydrogen sulfide increases expression ISO Acat2 (Mus musculus) 6480464 Hydrogen Sulfide results in increased expression of ACAT2 protein CTD PMID:29932956 Acat2 Rat indometacin increases expression EXP 6480464 Indomethacin results in increased expression of ACAT2 mRNA CTD PMID:36868495 Acat2 Rat inulin multiple interactions ISO Acat2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of ACAT2 mRNA CTD PMID:36331819 Acat2 Rat isotretinoin decreases expression ISO ACAT2 (Homo sapiens) 6480464 Isotretinoin results in decreased expression of ACAT2 mRNA CTD PMID:20436886 Acat2 Rat ivermectin decreases expression ISO ACAT2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of ACAT2 protein CTD PMID:32959892 Acat2 Rat ketamine decreases expression EXP 6480464 Ketamine results in decreased expression of ACAT2 mRNA CTD PMID:20080153 Acat2 Rat lead diacetate decreases expression ISO Acat2 (Mus musculus) 6480464 lead acetate results in decreased expression of ACAT2 mRNA CTD PMID:21829687 Acat2 Rat manganese atom decreases expression ISO Acat2 (Mus musculus) 6480464 Manganese results in decreased expression of ACAT2 mRNA CTD PMID:23499988 Acat2 Rat manganese(0) decreases expression ISO Acat2 (Mus musculus) 6480464 Manganese results in decreased expression of ACAT2 mRNA CTD PMID:23499988 Acat2 Rat menadione affects expression ISO ACAT2 (Homo sapiens) 6480464 Vitamin K 3 affects the expression of ACAT2 mRNA CTD PMID:20044591 Acat2 Rat metformin increases expression EXP 6480464 Metformin results in increased expression of ACAT2 mRNA CTD PMID:31324951 Acat2 Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of ACAT2 mRNA CTD PMID:30467583 Acat2 Rat methylazoxymethanol increases expression ISO Acat2 (Mus musculus) 6480464 methylazoxymethanol results in increased expression of ACAT2 mRNA CTD PMID:17107856 Acat2 Rat metronidazole multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of ACAT2 protein CTD PMID:30545405 Acat2 Rat microcystin-LR affects expression ISO Acat2 (Mus musculus) 6480464 cyanoginosin LR affects the expression of ACAT2 protein CTD PMID:26984711 Acat2 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of ACAT2 mRNA CTD PMID:18164116 Acat2 Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of ACAT2 mRNA CTD PMID:19638242 Acat2 Rat neomycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of ACAT2 protein CTD PMID:30545405 Acat2 Rat nickel atom decreases expression ISO ACAT2 (Homo sapiens) 6480464 Nickel results in decreased expression of ACAT2 mRNA CTD PMID:24768652 Acat2 Rat Nutlin-3 multiple interactions ISO ACAT2 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of ACAT2 protein CTD PMID:38460933 Acat2 Rat O-methyleugenol decreases expression ISO ACAT2 (Homo sapiens) 6480464 methyleugenol results in decreased expression of ACAT2 mRNA CTD PMID:32234424 Acat2 Rat octocrylene increases expression ISO ACAT2 (Homo sapiens) 6480464 octocrylene results in increased expression of ACAT2 mRNA CTD PMID:34864131 Acat2 Rat oleic acid multiple interactions ISO ACAT2 (Homo sapiens) 6480464 [6-(4-chlorophenyl)imidazo(2 more ... CTD PMID:30611723 Acat2 Rat paracetamol decreases expression ISO ACAT2 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of ACAT2 mRNA CTD PMID:11793227 and PMID:29067470 Acat2 Rat paracetamol affects expression ISO Acat2 (Mus musculus) 6480464 Acetaminophen affects the expression of ACAT2 mRNA CTD PMID:17562736 Acat2 Rat perfluorohexanesulfonic acid increases expression ISO Acat2 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of ACAT2 mRNA CTD PMID:21705711 and PMID:37995155 Acat2 Rat perfluorononanoic acid multiple interactions ISO Acat2 (Mus musculus) 6480464 [Dietary Fats co-treated with perfluoro-n-nonanoic acid] results in decreased expression of ACAT2 mRNA CTD PMID:33483757 Acat2 Rat perfluorononanoic acid decreases expression ISO ACAT2 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of ACAT2 mRNA CTD PMID:32588087 Acat2 Rat perfluorooctane-1-sulfonic acid increases expression ISO Acat2 (Mus musculus) 6480464 perfluorooctane sulfonic acid results in increased expression of ACAT2 mRNA CTD PMID:20936131 Acat2 Rat perfluorooctane-1-sulfonic acid decreases expression ISO ACAT2 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of ACAT2 mRNA CTD PMID:32253466 more ... Acat2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Acat2 (Mus musculus) 6480464 [Dietary Fats co-treated with perfluorooctane sulfonic acid] results in decreased expression of ACAT2 mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of ACAT2 mRNA CTD PMID:33483757 and PMID:36331819 Acat2 Rat perfluorooctanoic acid increases expression ISO Acat2 (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of ACAT2 mRNA CTD PMID:18467677 and PMID:30657992 Acat2 Rat perfluorooctanoic acid decreases expression ISO ACAT2 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of ACAT2 mRNA CTD PMID:32253466 Acat2 Rat perfluorooctanoic acid multiple interactions ISO Acat2 (Mus musculus) 6480464 PPARA protein promotes the reaction [perfluorooctanoic acid results in increased expression of ACAT2 mRNA] CTD PMID:18467677 Acat2 Rat phenethyl isothiocyanate decreases expression ISO ACAT2 (Homo sapiens) 6480464 phenethyl isothiocyanate results in decreased expression of ACAT2 mRNA CTD PMID:26678675 Acat2 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of ACAT2 mRNA CTD PMID:19162173 Acat2 Rat phenobarbital decreases expression ISO Acat2 (Mus musculus) 6480464 Phenobarbital results in decreased expression of ACAT2 mRNA CTD PMID:19270015 Acat2 Rat phenylephrine increases expression EXP 6480464 Phenylephrine results in increased expression of ACAT2 mRNA CTD PMID:18158353 Acat2 Rat picoxystrobin increases expression ISO ACAT2 (Homo sapiens) 6480464 picoxystrobin results in increased expression of ACAT2 mRNA CTD PMID:33512557 Acat2 Rat pioglitazone decreases expression ISO ACAT2 (Homo sapiens) 6480464 Pioglitazone results in decreased expression of ACAT2 mRNA CTD PMID:30031879 Acat2 Rat pirinixic acid multiple interactions ISO Acat2 (Mus musculus) 6480464 PPARA protein promotes the reaction [pirinixic acid results in increased expression of ACAT2 mRNA] CTD PMID:18467677 and PMID:20059764 Acat2 Rat pirinixic acid decreases expression ISO Acat2 (Mus musculus) 6480464 pirinixic acid results in decreased expression of ACAT2 mRNA CTD PMID:17426115 more ... Acat2 Rat pirinixic acid increases expression ISO Acat2 (Mus musculus) 6480464 pirinixic acid results in increased expression of ACAT2 mRNA CTD PMID:18467677 more ... Acat2 Rat potassium dichromate increases expression ISO ACAT2 (Homo sapiens) 6480464 Potassium Dichromate results in increased expression of ACAT2 protein CTD PMID:23718831 Acat2 Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of ACAT2 mRNA CTD PMID:19162173 Acat2 Rat pregnenolone 16alpha-carbonitrile decreases expression ISO Acat2 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in decreased expression of ACAT2 mRNA CTD PMID:28903501 Acat2 Rat progesterone increases expression ISO ACAT2 (Homo sapiens) 6480464 Progesterone results in increased expression of ACAT2 mRNA CTD PMID:18070364 Acat2 Rat propiconazole increases expression ISO ACAT2 (Homo sapiens) 6480464 propiconazole results in increased expression of ACAT2 mRNA CTD PMID:36291160 Acat2 Rat quercetin decreases expression ISO ACAT2 (Homo sapiens) 6480464 Quercetin results in decreased expression of ACAT2 mRNA CTD PMID:21632981 Acat2 Rat quercetin 3-O-beta-D-glucofuranoside multiple interactions ISO ACAT2 (Homo sapiens) 6480464 [isoquercitrin co-treated with Hydrogen Peroxide] results in increased expression of ACAT2 mRNA CTD PMID:18032389 Acat2 Rat quercetin 3-O-beta-D-glucopyranoside multiple interactions ISO ACAT2 (Homo sapiens) 6480464 [isoquercitrin co-treated with Hydrogen Peroxide] results in increased expression of ACAT2 mRNA CTD PMID:18032389 Acat2 Rat quinolin-8-ol decreases expression ISO ACAT2 (Homo sapiens) 6480464 Oxyquinoline results in decreased expression of ACAT2 mRNA CTD PMID:21632981 Acat2 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of ACAT2 mRNA CTD PMID:28374803 Acat2 Rat rotenone increases expression ISO ACAT2 (Homo sapiens) 6480464 Rotenone results in increased expression of ACAT2 mRNA CTD PMID:33512557 Acat2 Rat sarin decreases expression ISO ACAT2 (Homo sapiens) 6480464 Sarin results in decreased expression of ACAT2 mRNA CTD PMID:19522546 Acat2 Rat sarin increases expression ISO ACAT2 (Homo sapiens) 6480464 Sarin results in increased expression of ACAT2 mRNA CTD PMID:19522546 Acat2 Rat SB 431542 multiple interactions ISO ACAT2 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of ACAT2 protein CTD PMID:37664457 Acat2 Rat silicon dioxide decreases expression ISO ACAT2 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of ACAT2 mRNA CTD PMID:23806026 Acat2 Rat sodium arsenite increases expression ISO Acat2 (Mus musculus) 6480464 sodium arsenite results in increased expression of ACAT2 mRNA CTD PMID:31532247 Acat2 Rat sodium arsenite multiple interactions ISO ACAT2 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ACAT2 mRNA CTD PMID:39836092 Acat2 Rat sodium arsenite increases expression ISO ACAT2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of ACAT2 mRNA CTD PMID:34032870 Acat2 Rat sodium arsenite decreases expression ISO ACAT2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of ACAT2 mRNA CTD PMID:38568856 Acat2 Rat sodium arsenite affects methylation ISO ACAT2 (Homo sapiens) 6480464 sodium arsenite affects the methylation of ACAT2 gene CTD PMID:28589171 Acat2 Rat sodium chloride multiple interactions ISO ACAT2 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of ACAT2 protein more ... CTD PMID:38598786 Acat2 Rat sunitinib increases expression ISO ACAT2 (Homo sapiens) 6480464 Sunitinib results in increased expression of ACAT2 mRNA CTD PMID:31533062 Acat2 Rat T-2 toxin affects expression EXP 6480464 T-2 Toxin affects the expression of ACAT2 protein CTD PMID:26141394 Acat2 Rat tamoxifen affects expression ISO Acat2 (Mus musculus) 6480464 Tamoxifen affects the expression of ACAT2 mRNA CTD PMID:17555576 Acat2 Rat tebuconazole increases expression ISO ACAT2 (Homo sapiens) 6480464 tebuconazole results in increased expression of ACAT2 mRNA CTD PMID:36291160 Acat2 Rat tetrachloromethane decreases expression ISO Acat2 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of ACAT2 mRNA CTD PMID:27339419 and PMID:31919559 Acat2 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of ACAT2 mRNA CTD PMID:31150632 Acat2 Rat tetracycline decreases expression ISO Acat2 (Mus musculus) 6480464 Tetracycline results in decreased expression of ACAT2 mRNA CTD PMID:24489787 Acat2 Rat tetracycline increases expression ISO Acat2 (Mus musculus) 6480464 Tetracycline results in increased expression of ACAT2 mRNA CTD PMID:16917069 Acat2 Rat thapsigargin decreases expression ISO ACAT2 (Homo sapiens) 6480464 Thapsigargin results in decreased expression of ACAT2 mRNA CTD PMID:22378314 Acat2 Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of ACAT2 protein CTD PMID:35544339 Acat2 Rat thioacetamide decreases expression ISO ACAT2 (Homo sapiens) 6480464 Thioacetamide results in decreased expression of ACAT2 mRNA CTD PMID:11793227 Acat2 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of ACAT2 mRNA CTD PMID:34492290 Acat2 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of ACAT2 mRNA CTD PMID:26222700 Acat2 Rat thiram decreases expression ISO ACAT2 (Homo sapiens) 6480464 Thiram results in decreased expression of ACAT2 mRNA CTD PMID:38568856 Acat2 Rat titanium dioxide decreases methylation ISO Acat2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ACAT2 gene CTD PMID:35295148 Acat2 Rat tolcapone increases expression EXP 6480464 tolcapone results in increased expression of ACAT2 mRNA CTD PMID:24136188 Acat2 Rat topotecan affects response to substance ISO ACAT2 (Homo sapiens) 6480464 ACAT2 protein affects the susceptibility to Topotecan CTD PMID:16217747 Acat2 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of ACAT2 gene CTD PMID:27618143 Acat2 Rat triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of ACAT2 mRNA CTD PMID:30589522 Acat2 Rat triptonide increases expression ISO Acat2 (Mus musculus) 6480464 triptonide results in increased expression of ACAT2 mRNA CTD PMID:33045310 Acat2 Rat troglitazone increases expression EXP 6480464 troglitazone results in increased expression of ACAT2 protein CTD PMID:21315101 Acat2 Rat tunicamycin decreases expression ISO ACAT2 (Homo sapiens) 6480464 Tunicamycin results in decreased expression of ACAT2 mRNA CTD PMID:22378314 Acat2 Rat uranium atom affects expression ISO ACAT2 (Homo sapiens) 6480464 Uranium affects the expression of ACAT2 mRNA CTD PMID:15672453 Acat2 Rat urethane decreases expression ISO ACAT2 (Homo sapiens) 6480464 Urethane results in decreased expression of ACAT2 mRNA CTD PMID:28818685 Acat2 Rat valdecoxib increases expression EXP 6480464 valdecoxib results in increased expression of ACAT2 mRNA CTD PMID:24136188 Acat2 Rat valproic acid affects expression ISO Acat2 (Mus musculus) 6480464 Valproic Acid affects the expression of ACAT2 mRNA CTD PMID:17292431 Acat2 Rat valproic acid decreases expression ISO ACAT2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of ACAT2 mRNA CTD PMID:19101580 more ... Acat2 Rat valproic acid affects expression ISO ACAT2 (Homo sapiens) 6480464 Valproic Acid affects the expression of ACAT2 mRNA CTD PMID:25979313 Acat2 Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of ACAT2 mRNA CTD PMID:23665938 Acat2 Rat valproic acid multiple interactions ISO ACAT2 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of ACAT2 mRNA CTD PMID:17183730 Acat2 Rat vancomycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of ACAT2 protein CTD PMID:30545405 Acat2 Rat vincaleukoblastine affects response to substance ISO ACAT2 (Homo sapiens) 6480464 ACAT2 protein affects the susceptibility to Vinblastine CTD PMID:16217747 Acat2 Rat zearalenone decreases expression ISO Acat2 (Mus musculus) 6480464 Zearalenone results in decreased expression of ACAT2 protein CTD PMID:25058043 Acat2 Rat zoledronic acid increases expression ISO ACAT2 (Homo sapiens) 6480464 zoledronic acid results in increased expression of ACAT2 mRNA CTD PMID:24714768
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(-)-epigallocatechin 3-gallate (ISO) 1,2-dimethylhydrazine (ISO) 1-(3-(trifluoromethyl)phenyl)piperazine (EXP) 1-benzylpiperazine (EXP) 1-chloro-2,4-dinitrobenzene (ISO) 1-naphthyl isothiocyanate (EXP,ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) 6-(4-chlorophenyl)imidazo[2,1-b][1,3]thiazole-5-carbaldehyde O-(3,4-dichlorobenzyl)oxime (ISO) 8-Br-cAMP (ISO) acetamide (EXP) acrylamide (EXP,ISO) actinomycin D (ISO) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) alpha-hexachlorocyclohexane (EXP) amiodarone (EXP) ampicillin (EXP) Archazolid B (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) avobenzone (ISO) azathioprine (ISO) azoxystrobin (ISO) beauvericin (ISO) benzo[a]pyrene (ISO) beta-naphthoflavone (EXP,ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) bromobenzene (EXP) butyric acid (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) captan (ISO) carbon nanotube (ISO) chlorpyrifos (EXP,ISO) cisplatin (ISO) clozapine (ISO) copper atom (ISO) copper(0) (ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) coumestrol (ISO) cyclosporin A (ISO) cyproconazole (EXP) dexamethasone (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) dicrotophos (ISO) diuron (EXP) endosulfan (EXP) enniatin (ISO) Enterolactone (ISO) entinostat (ISO) enzyme inhibitor (ISO) epoxiconazole (EXP) ethanol (ISO) farnesol (ISO) fenvalerate (EXP) flutamide (EXP) folic acid (ISO) folpet (ISO) formaldehyde (ISO) fulvestrant (ISO) furfural (ISO) gentamycin (EXP) glycyrrhetinate (ISO) glycyrrhetinic acid (ISO) glycyrrhizinic acid (ISO) GW 4064 (ISO) hyaluronic acid (EXP) hydralazine (ISO) hydrogen peroxide (EXP,ISO) hydrogen sulfide (ISO) indometacin (EXP) inulin (ISO) isotretinoin (ISO) ivermectin (ISO) ketamine (EXP) lead diacetate (ISO) manganese atom (ISO) manganese(0) (ISO) menadione (ISO) metformin (EXP) methapyrilene (EXP) methylazoxymethanol (ISO) metronidazole (EXP) microcystin-LR (ISO) N-nitrosodiethylamine (EXP) neomycin (EXP) nickel atom (ISO) Nutlin-3 (ISO) O-methyleugenol (ISO) octocrylene (ISO) oleic acid (ISO) paracetamol (ISO) perfluorohexanesulfonic acid (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenethyl isothiocyanate (ISO) phenobarbital (EXP,ISO) phenylephrine (EXP) picoxystrobin (ISO) pioglitazone (ISO) pirinixic acid (ISO) potassium dichromate (ISO) pregnenolone 16alpha-carbonitrile (EXP,ISO) progesterone (ISO) propiconazole (ISO) quercetin (ISO) quercetin 3-O-beta-D-glucofuranoside (ISO) quercetin 3-O-beta-D-glucopyranoside (ISO) quinolin-8-ol (ISO) rotenone (EXP,ISO) sarin (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium chloride (ISO) sunitinib (ISO) T-2 toxin (EXP) tamoxifen (ISO) tebuconazole (ISO) tetrachloromethane (EXP,ISO) tetracycline (ISO) thapsigargin (EXP,ISO) thioacetamide (EXP,ISO) thiram (ISO) titanium dioxide (ISO) tolcapone (EXP) topotecan (ISO) trichloroethene (EXP) triphenyl phosphate (EXP) triptonide (ISO) troglitazone (EXP) tunicamycin (ISO) uranium atom (ISO) urethane (ISO) valdecoxib (EXP) valproic acid (EXP,ISO) vancomycin (EXP) vincaleukoblastine (ISO) zearalenone (ISO) zoledronic acid (ISO)
1.
Identification, purification and characterization of an acetoacetyl-CoA thiolase from rat liver peroxisomes.
Antonenkov VD, etal., Eur J Biochem. 2000 May;267(10):2981-90.
2.
Liver-specific inhibition of acyl-coenzyme a:cholesterol acyltransferase 2 with antisense oligonucleotides limits atherosclerosis development in apolipoprotein B100-only low-density lipoprotein receptor-/- mice.
Bell TA 3rd, etal., Arterioscler Thromb Vasc Biol. 2006 Aug;26(8):1814-20. Epub 2006 May 4.
3.
The influence of chylomicron remnants on cholesteryl ester metabolism in cultured rat hepatocytes: comparison of the effects of particles enriched in n-3 or n-6 polyunsaturated fatty acids.
Botham KM, etal., Biochim Biophys Acta. 2001 Dec 30;1534(2-3):96-109.
4.
The effects of dietary n-3 polyunsaturated fatty acids delivered in chylomicron remnants on the transcription of genes regulating synthesis and secretion of very-low-density lipoprotein by the liver: modulation by cellular oxidative state.
Botham KM, etal., Exp Biol Med (Maywood). 2003 Feb;228(2):143-51.
5.
Resistance to diet-induced hypercholesterolemia and gallstone formation in ACAT2-deficient mice.
Buhman KK, etal., Nat Med 2000 Dec;6(12):1341-7.
6.
Impaired VLDL assembly: a novel mechanism contributing to hepatic lipid accumulation following ovariectomy and high-fat/high-cholesterol diets?
Côté I, etal., Br J Nutr. 2014 Nov 28;112(10):1592-600. doi: 10.1017/S0007114514002517. Epub 2014 Sep 29.
7.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
8.
Acyl-CoA: cholesterol acyltransferase-2 gene polymorphisms and their association with plasma lipids and coronary artery disease risks.
He X, etal., Hum Genet. 2005 Dec;118(3-4):393-403. Epub 2005 Sep 30.
9.
ACAT2 contributes cholesteryl esters to newly secreted VLDL, whereas LCAT adds cholesteryl ester to LDL in mice.
Lee RG, etal., J Lipid Res 2005 Jun;46(6):1205-12. Epub 2005 Apr 1.
10.
Dual action of neutral sphingomyelinase on rat hepatocytes: activation of cholesteryl ester metabolism and biliary cholesterol secretion and inhibition of VLDL secretion.
Liza M, etal., Lipids. 2003 Jan;38(1):53-63.
11.
The course of ketosis and the activity of key enzymes of ketogenesis and ketone-body utilization during development of the postnatal rat.
Lockwood EA and Bailey E, Biochem J. 1971 Aug;124(1):249-54.
12.
Evidence for substantial effect modification by gender in a large-scale genetic association study of the metabolic syndrome among coronary heart disease patients.
McCarthy JJ, etal., Hum Genet. 2003 Dec;114(1):87-98. Epub 2003 Oct 14.
13.
The acetoacetyl-coenzyme A thiolases of rat brain and their relative activities during postnatal development.
Middleton B Biochem J. 1973 Apr;132(4):731-7.
14.
Cerebral ketone body metabolism.
Morris AA J Inherit Metab Dis. 2005;28(2):109-21.
15.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
16.
Activities of enzymes of ketone-body utilization in brain and other tissues of suckling rats.
Page MA, etal., Biochem J. 1971 Jan;121(1):49-53.
17.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
18.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
19.
GOA pipeline
RGD automated data pipeline
20.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
21.
Comprehensive gene review and curation
RGD comprehensive gene curation
22.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
23.
Defects of cholesterol biosynthesis.
Waterham HR FEBS Lett. 2006 Oct 9;580(23):5442-9. Epub 2006 Jul 20.
Acat2 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 50,100,840 - 50,118,886 (+) NCBI GRCr8 mRatBN7.2 1 47,695,833 - 47,713,879 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 47,695,788 - 47,752,821 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 48,244,680 - 48,262,723 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 54,232,698 - 54,250,748 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 48,320,196 - 48,338,239 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 47,972,399 - 47,992,654 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 47,972,399 - 47,992,653 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 51,757,961 - 51,776,935 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 41,922,020 - 41,940,074 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 41,924,964 - 41,943,018 (+) NCBI Celera 1 43,380,977 - 43,399,019 (+) NCBI Celera Cytogenetic Map 1 q11 NCBI
ACAT2 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 159,762,045 - 159,779,112 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 159,762,045 - 159,779,112 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 160,183,077 - 160,200,144 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 160,102,979 - 160,120,077 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 160,153,495 - 160,170,496 NCBI Celera 6 160,829,071 - 160,846,164 (+) NCBI Celera Cytogenetic Map 6 q25.3 NCBI HuRef 6 157,652,350 - 157,670,330 (+) NCBI HuRef CHM1_1 6 160,445,318 - 160,462,378 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 161,007,676 - 161,024,729 (+) NCBI T2T-CHM13v2.0
Acat2 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 13,161,929 - 13,179,612 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 13,161,777 - 13,179,634 (-) Ensembl GRCm39 Ensembl GRCm38 17 12,943,042 - 12,960,725 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 12,942,890 - 12,960,747 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 13,135,908 - 13,153,591 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 12,785,822 - 12,803,643 (-) NCBI MGSCv36 mm8 Celera 17 12,974,572 - 12,992,259 (-) NCBI Celera Cytogenetic Map 17 A1 NCBI cM Map 17 8.73 NCBI
Acat2 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955439 21,122,923 - 21,142,480 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955439 21,123,886 - 21,142,562 (-) NCBI ChiLan1.0 ChiLan1.0
ACAT2 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 179,860,401 - 179,877,462 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 177,765,362 - 177,782,416 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 157,644,894 - 157,661,965 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 162,656,497 - 162,673,606 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 162,656,497 - 162,673,606 (+) Ensembl panpan1.1 panPan2
ACAT2 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 49,011,665 - 49,029,368 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 49,011,706 - 49,029,327 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 49,853,633 - 49,871,344 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 49,196,147 - 49,214,069 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 49,196,175 - 49,214,050 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 49,078,510 - 49,096,406 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 48,949,606 - 48,967,503 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 49,564,773 - 49,582,676 (+) NCBI UU_Cfam_GSD_1.0
Acat2 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 144,003,888 - 144,021,848 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936489 11,255,871 - 11,283,216 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936489 11,255,871 - 11,273,848 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ACAT2 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 7,598,735 - 7,612,866 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 7,600,616 - 7,612,861 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 9,399,574 - 9,411,820 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ACAT2 (Chlorocebus sabaeus - green monkey)
Acat2 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 217 Count of miRNA genes: 151 Interacting mature miRNAs: 170 Transcripts: ENSRNOT00000033408 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331732 Srn4 Serum renin concentration QTL 4 4.467 renin activity (VT:0005581) plasma renin activity level (CMO:0000116) 1 35239598 78430678 Rat 2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1357397 Bw41 Body weight QTL 41 4.19 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 1 22340647 49361612 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 1331792 Rf29 Renal function QTL 29 4.589 urine potassium amount (VT:0010539) urine potassium level (CMO:0000128) 1 35239598 78430678 Rat 2313062 Bmd73 Bone mineral density QTL 73 3.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 11481312 82174945 Rat 8552900 Pigfal1 Plasma insulin-like growth factor 1 level QTL 1 7.4 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 1 34836858 79836858 Rat 1554320 Bmd1 Bone mineral density QTL 1 12.2 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 509108 86060548 Rat 1354643 Foco2 Food consumption QTL 2 7.17 0.0001 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 1 33449848 78449848 Rat 2302059 Pia36 Pristane induced arthritis QTL 36 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 43333002 88333002 Rat 2313065 Bss67 Bone structure and strength QTL 67 3.1 0.0001 tibia area (VT:1000281) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 7421626 Bp360 Blood pressure QTL 360 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 4393289 49393289 Rat 1357400 Bw62 Body weight QTL62 4.05 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 1 22340647 67340647 Rat 1357401 Bw43 Body weight QTL 43 3.75 body mass (VT:0001259) body weight (CMO:0000012) 1 22340647 49361612 Rat 2313069 Bss68 Bone structure and strength QTL 68 2.9 0.0001 tibia size trait (VT:0100001) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 631494 Bp95 Blood pressure QTL 95 40 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 16206210 49268520 Rat 2313075 Bss66 Bone structure and strength QTL 66 3.4 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 11481312 82174945 Rat 5684998 Bss101 Bone structure and strength QTL 101 3.6 tibia strength trait (VT:1000284) tibia ultimate force (CMO:0001734) 1 15431621 49361612 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 5684999 Bss102 Bone structure and strength QTL 102 5.5 7e-07 tibia strength trait (VT:1000284) tibia stiffness (CMO:0001735) 1 15431621 49361612 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 1300167 Hrtrt2 Heart rate QTL 2 4.35 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 11481312 75088344 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 2313077 Bss69 Bone structure and strength QTL 69 3.5 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 11481312 82174945 Rat 1331778 Rf28 Renal function QTL 28 4.66 urine potassium amount (VT:0010539) urine potassium excretion rate (CMO:0000761) 1 45803140 78430678 Rat 1578756 Iddm22 Insulin dependent diabetes mellitus QTL 22 2.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 11835181 56835181 Rat 631508 Sald1 Serum aldosterone level QTL 1 3.7 blood aldosterone amount (VT:0005346) serum aldosterone level (CMO:0000487) 1 9856001 54856001 Rat 1331785 Rf27 Renal function QTL 27 4.643 urine sodium amount (VT:0006274) urine sodium level (CMO:0000129) 1 28879780 78430678 Rat 1300172 Bp172 Blood pressure QTL 172 3.56 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 32737273 90665040 Rat 724520 Bp145 Blood pressure QTL 145 2.1 0.0024 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 20784828 65784828 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 2313092 Bmd72 Bone mineral density QTL 72 2.5 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 11481312 82174945 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 2313097 Bss70 Bone structure and strength QTL 70 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 9589820 Insglur3 Insulin/glucose ratio QTL 3 10.75 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 1 34836858 79836858 Rat 738020 Pia8 Pristane induced arthritis QTL 8 4.7 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 1 65833076 Rat 1354599 Bw29 Body weight QTL 29 3.46 0.001 body mass (VT:0001259) body weight (CMO:0000012) 1 33449848 78449848 Rat 2302038 Pia31 Pristane induced arthritis QTL 31 5.5 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111) 1 10992065 55992065 Rat 8552948 Pigfal11 Plasma insulin-like growth factor 1 level QTL 11 4.7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 1 34836858 79836858 Rat 634353 Rends2 Renal damage susceptibility QTL 2 0.05 kidney blood vessel morphology trait (VT:0000530) organ lesion measurement (CMO:0000677) 1 19333571 56983283 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat
D1Rat332
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 47,772,213 - 47,772,342 (-) MAPPER mRatBN7.2 mRatBN7.2 1 47,746,929 - 47,747,057 (-) MAPPER mRatBN7.2 Rnor_6.0 1 54,424,371 - 54,424,496 NCBI Rnor6.0 Rnor_5.0 1 55,644,514 - 55,644,639 UniSTS Rnor5.0 RGSC_v3.1 1 41,941,176 - 41,941,281 RGD Celera 1 43,397,178 - 43,397,283 UniSTS SHRSP x BN Map 1 24.95 UniSTS SHRSP x BN Map 1 24.95 RGD Cytogenetic Map 1 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000033408 ⟹ ENSRNOP00000059561
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 47,695,788 - 47,713,873 (+) Ensembl Rnor_6.0 Ensembl 1 47,972,399 - 47,992,653 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000076951 ⟹ ENSRNOP00000068312
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 47,695,788 - 47,752,821 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000077707 ⟹ ENSRNOP00000069035
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 1 47,972,425 - 47,991,846 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000111916 ⟹ ENSRNOP00000085078
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 47,695,788 - 47,730,867 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000114086 ⟹ ENSRNOP00000083545
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 47,695,810 - 47,724,428 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000117522 ⟹ ENSRNOP00000087001
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 47,695,810 - 47,724,428 (+) Ensembl
RefSeq Acc Id:
NM_001006995 ⟹ NP_001006996
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 50,100,840 - 50,118,886 (+) NCBI mRatBN7.2 1 47,695,833 - 47,713,879 (+) NCBI Rnor_6.0 1 47,972,399 - 47,992,654 (+) NCBI Rnor_5.0 1 51,757,961 - 51,776,935 (-) NCBI RGSC_v3.4 1 41,922,020 - 41,940,074 (+) RGD Celera 1 43,380,977 - 43,399,019 (+) RGD
Sequence:
GAGCTAGCAGACCTCGGAGCTACAGGATGAATGCAGGCTCGGACCCCGTCGTCATCATCTCAGCGGCGCGGACCGCCATAGGTTCCTTCAATGGTGCCCTGTCCACCGTGCCTGTCCACAACCTGGGG ACAACTGTTATCAAAGAAGTCCTTCAGAGAGCCAAAGTGGCTCCAGAAGAGGTGTCCGAGGTCATATTTGGACACGTTTTGACTGCAGGCTGTGGGCAGAATCCTACTCGACAAGCCAGTGTGGGTGC GGGGATCCCCTACTCGGTGCCAGCATGGAGCTGCCAGATGATCTGTGGCTCGGGCCTAAAAGCCGTGTGCCTTGCAGCTCAGTCCATAGCCATGGGTGACTCCACCATCGTGGTTGCTGGAGGCATGG AGAACATGAGCAAGGCCCCTCACTTGGCTCACCTGAGATCAGGAGTGAAGATGGGTGAGGTGCCACTCGCCGACAGCATCCTCTGTGATGGCCTCACAGATGCGTTTCACAACTACCACATGGGCATC ACAGCTGAAAACGTAGCCAAAAAATGGCAAGTGAGCAGAGAGGCCCAGGACAAGGTTGCTGTTGTGTCCCAGAATAGGGCGGAGCATGCGCAGAAAGCTGGCCACTTTGACAAGGAGATTGTGCCAGT GCACGTGTCTTCTAGAAAAGGTCTTACTGAAGTGAAAATCGATGAGTTTCCTCGTCATGGGAGTAACCTTGAAGCCATGAGCAAGCTGAAGCCTTACTTTCTTACTGATGGGACTGGAACGGTCACCC CAGCGAATGCATCAGGAATGAACGATGGTGCTGCTGCTGTGGTTCTTATGAAGAAGACGGAAGCTGAGAGTCGGATGCTGAAACCTTTAGCACAAGTGGTCTCCTGGTCACAAGCCGGTGTGGAGCCT TCTGTCATGGGAGTAGGACCGATTCCAGCCATAAAGCAAGCTGTTGCAAAGGCAGGCTGGTCCCTGGAGGATGTTGACGTGTTTGAAATCAATGAAGCCTTTGCAGCAGTGTCTGCAGCAATAGCTAA AGAACTTGGATTAAGCCCCGAGAAGGTGAACATCGATGGAGGAGCCATTGCCTTGGGACATCCTCTGGGAGCATCTGGCTGTAGGATTCTAGTGACCTTGTTACACACCCTGGAGAGAGTGGGTGGGA CTCGTGGTGTTGCAGCCCTGTGCATTGGGGGTGGTATGGGGATCGCAATGTGTGTTCAGAGAGGGTGAGCCACCACCCTTACAGTTCTCATTAAAACACTAAACAGAATGTGAGACCAGAGGACCAAC CTGAGGACAGGAACCCAGGTCGACAGCTTGCTGTACTTTAGTGTGAGACACCCAAGGCTAAGACGTTGAGACATTGCACTTGACACTGTTATAAAACAGGGAAATCCAGTCAGTCATCAAGGGCTCCA GAGTGAACGACAGTTTCATAATTTCCATGTTTATTGTCTTTGCTTTCTGGGTATAATTTTCTCTGATCATTGATTTGTTTGTTTGTTTGTTTTTGAGTCAGGGTCTCACCATATAGCCTGAAAATCGT TTTGTAGATGAGCTTGGCTTCAATTCCCAGAGATCCACCTTTCTGTGCCTCCTGAGTACTTGAATTAAAGACATGCACCGTTATGCACGGCCCCCAATATGATCCATTCAAGGAATGGGGATGTGGCT TCTGGTTTGAACTTCAGGCTCTTCGCTCAAACACCCCTGCTTGCTTGTTGTCTTGTGGTTTCCCATTGATCAAATCAAGACCAATCCTGTAATGGAAATTGGATTCAGTGACCTCTTCTAAGCTGAGG TGGTGGGGTAGGTATTCTAGCTATTCTAGTCAGAAGATTGGCCGTTCCAACAAGTGTGCCTCTGGGTTGTTAGAAAGTGAGCAGCAAGCGCCTTCAGTGCATTTATTTCTCTGCTTGACCAGACAGGA TGGTACTTGCTTCAAACGTCTACCTTGACTTCCCCAAAATGATGAACTGTAACTGGAATTGAAAGCCAAATAAACTCTTCCCTCCCTTGCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AA
hide sequence
RefSeq Acc Id:
NP_001006996 ⟸ NM_001006995
- UniProtKB:
Q5XI22 (UniProtKB/Swiss-Prot), A6KP31 (UniProtKB/TrEMBL), F1LS48 (UniProtKB/TrEMBL)
- Sequence:
MNAGSDPVVIISAARTAIGSFNGALSTVPVHNLGTTVIKEVLQRAKVAPEEVSEVIFGHVLTAGCGQNPTRQASVGAGIPYSVPAWSCQMICGSGLKAVCLAAQSIAMGDSTIVVAGGMENMSKAPHL AHLRSGVKMGEVPLADSILCDGLTDAFHNYHMGITAENVAKKWQVSREAQDKVAVVSQNRAEHAQKAGHFDKEIVPVHVSSRKGLTEVKIDEFPRHGSNLEAMSKLKPYFLTDGTGTVTPANASGMND GAAAVVLMKKTEAESRMLKPLAQVVSWSQAGVEPSVMGVGPIPAIKQAVAKAGWSLEDVDVFEINEAFAAVSAAIAKELGLSPEKVNIDGGAIALGHPLGASGCRILVTLLHTLERVGGTRGVAALCI GGGMGIAMCVQRG
hide sequence
Ensembl Acc Id:
ENSRNOP00000059561 ⟸ ENSRNOT00000033408
Ensembl Acc Id:
ENSRNOP00000069035 ⟸ ENSRNOT00000077707
Ensembl Acc Id:
ENSRNOP00000068312 ⟸ ENSRNOT00000076951
Ensembl Acc Id:
ENSRNOP00000085078 ⟸ ENSRNOT00000111916
Ensembl Acc Id:
ENSRNOP00000087001 ⟸ ENSRNOT00000117522
Ensembl Acc Id:
ENSRNOP00000083545 ⟸ ENSRNOT00000114086
RGD ID: 13689614
Promoter ID: EPDNEW_R138
Type: multiple initiation site
Name: Acat2_1
Description: acetyl-CoA acetyltransferase 2
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 47,972,376 - 47,972,436 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Acat2
acetyl-CoA acetyltransferase 2
LOC678796
similar to acetyl-Coenzyme A acetyltransferase 2
Data merged from RGD:1596891
737654
PROVISIONAL
2013-03-08
Acat2
acetyl-CoA acetyltransferase 2
Acat2
acetyl-Coenzyme A acetyltransferase 2
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2013-03-07
Acat2
acetyl-Coenzyme A acetyltransferase 2
Acat3
acetyl-Coenzyme A acetyltransferase 3
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2006-11-20
LOC678796
similar to acetyl-Coenzyme A acetyltransferase 2
Symbol and Name status set to provisional
70820
PROVISIONAL
2006-03-30
Acat2
acetyl-Coenzyme A acetyltransferase 2
MGC95138
similar to acetyl CoA transferase-like
Symbol and Name updated
1299863
APPROVED
2005-07-29
MGC95138
similar to acetyl CoA transferase-like
Symbol and Name status set to provisional
70820
PROVISIONAL