Advanced Search (OLGA)

Gene: Taar5 (trace amine-associated receptor 5) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Taar5

Name:

trace amine-associated receptor 5

RGD ID:

1359185

Description:

Enables trace-amine receptor activity. Predicted to be involved in adenylate cyclase-activating G protein-coupled receptor signaling pathway; cognition; and sensory perception of chemical stimulus. Predicted to be active in plasma membrane. Orthologous to human TAAR5 (trace amine associated receptor 5); INTERACTS WITH indole-3-methanol; N-nitrosodiethylamine; (+)-catechin (ortholog).

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

taR-5; trace amine associated receptor 5; trace amine receptor 5

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	23,289,163 - 23,290,176 (-)	NCBI		GRCr8
mRatBN7.2	1	21,469,923 - 21,470,936 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	21,469,923 - 21,470,936 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	21,246,888 - 21,247,901 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	27,246,933 - 27,247,946 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	21,446,572 - 21,447,585 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	22,547,662 - 22,548,675 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	22,547,662 - 22,548,675 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	24,022,589 - 24,023,602 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	21,996,992 - 21,998,005 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	21,999,937 - 22,000,950 (-)	NCBI
Celera	1	20,213,693 - 20,214,706 (-)	NCBI		Celera
Cytogenetic Map	1	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Taar5	Rat	(+)-catechin	multiple interactions	ISO	TAAR5 (Homo sapiens)	6480464	[Catechin co-treated with Grape Seed Proanthocyanidins] results in increased expression of TAAR5 mRNA	CTD	PMID:24763279
Taar5	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	TAAR5 (Homo sapiens)	6480464	Tetrachlorodibenzodioxin results in decreased expression of TAAR5 mRNA	CTD	PMID:21296121
Taar5	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Taar5 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of TAAR5 mRNA	CTD	PMID:21570461
Taar5	Rat	Azoxymethane	multiple interactions	ISO	Taar5 (Mus musculus)	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of TAAR5 mRNA	CTD	PMID:29950665
Taar5	Rat	benzo[a]pyrene	increases expression	ISO	TAAR5 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased expression of TAAR5 mRNA	CTD	PMID:17879257
Taar5	Rat	benzo[a]pyrene	affects methylation	ISO	TAAR5 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of TAAR5 promoter	CTD	PMID:27901495
Taar5	Rat	benzo[a]pyrene	increases methylation	ISO	TAAR5 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of TAAR5 exon	CTD	PMID:27901495
Taar5	Rat	CGP 52608	multiple interactions	ISO	TAAR5 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to TAAR5 gene]	CTD	PMID:28238834
Taar5	Rat	dextran sulfate	multiple interactions	ISO	Taar5 (Mus musculus)	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of TAAR5 mRNA	CTD	PMID:29950665
Taar5	Rat	indole-3-methanol	multiple interactions	EXP		6480464	[indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of TAAR5 mRNA	CTD	PMID:22129741
Taar5	Rat	N-nitrosodiethylamine	multiple interactions	EXP		6480464	[indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of TAAR5 mRNA	CTD	PMID:22129741
Taar5	Rat	resveratrol	multiple interactions	ISO	TAAR5 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of TAAR5 mRNA	CTD	PMID:23557933
Taar5	Rat	titanium dioxide	multiple interactions	ISO	Taar5 (Mus musculus)	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of TAAR5 mRNA	CTD	PMID:29950665
Taar5	Rat	trimethylamine	increases activity	ISO	TAAR5 (Homo sapiens)	6480464	trimethylamine results in increased activity of TAAR5 protein	CTD	PMID:23393561

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Taar5	Rat	adenylate cyclase-activating G protein-coupled receptor signaling pathway	involved_in	ISO	TAAR5 (Homo sapiens)	1624291	PMID:23393561	RGD	PMID:23393561
Taar5	Rat	adenylate cyclase-activating G protein-coupled receptor signaling pathway	involved_in	IEA	UniProtKB:O14804 and ensembl:ENSP00000258034	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Taar5	Rat	adenylate cyclase-activating G protein-coupled receptor signaling pathway	involved_in	IEA	UniProtKB:Q5QD14 and ensembl:ENSMUSP00000090329	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Taar5	Rat	adenylate cyclase-activating G protein-coupled receptor signaling pathway	involved_in	ISO	Taar5 (Mus musculus)	1624291	PMID:37225986	RGD	PMID:37225986
Taar5	Rat	adenylate cyclase-activating G protein-coupled receptor signaling pathway	involved_in	ISS	UniProtKB:Q5QD14	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Taar5	Rat	cell surface receptor signaling pathway	involved_in	IEA	InterPro:IPR017981	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Taar5	Rat	cognition	involved_in	ISO	Taar5 (Mus musculus)	1624291	PMID:36038766	RGD	PMID:36038766
Taar5	Rat	cognition	involved_in	IEA	UniProtKB:Q5QD14 and ensembl:ENSMUSP00000090329	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Taar5	Rat	cognition	involved_in	ISS	UniProtKB:Q5QD14	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Taar5	Rat	G protein-coupled receptor signaling pathway	involved_in	IBA	FB:FBgn0029909 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Taar5	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	UniProtKB-KW:KW-0297	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Taar5	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	InterPro:IPR000276 and InterPro:IPR009132	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Taar5	Rat	sensory perception of chemical stimulus	involved_in	IEA	UniProtKB:Q5QD14 and ensembl:ENSMUSP00000090329	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Taar5	Rat	sensory perception of chemical stimulus	involved_in	ISO	Taar5 (Mus musculus)	1624291	PMID:16878137 and PMID:23177478	RGD	PMID:16878137 and PMID:23177478
Taar5	Rat	signal transduction	involved_in	IEA	UniProtKB-KW:KW-0807	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Taar5	Rat	membrane	located_in	IEA	InterPro:IPR000276 more ...	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Taar5	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Taar5	Rat	plasma membrane	is_active_in	ISO	TAAR5 (Homo sapiens)	1624291	PMID:37225986	RGD	PMID:37225986
Taar5	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Taar5	Rat	plasma membrane	located_in	IEA	UniProtKB:O14804 and ensembl:ENSP00000258034	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Taar5	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Taar5	Rat	plasma membrane	is_active_in	IBA	MGI:2148258 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Taar5	Rat	plasma membrane	located_in	ISO	TAAR5 (Homo sapiens)	1624291	PMID:23393561	RGD	PMID:23393561
Taar5	Rat	plasma membrane	located_in	ISS	UniProtKB:O14804	1600115	GO_REF:0000024	UniProt	GO_REF:0000024

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Taar5	Rat	G protein-coupled receptor activity	enables	IEA	UniProtKB-KW:KW-0297	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Taar5	Rat	G protein-coupled receptor activity	enables	IEA	InterPro:IPR000276	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Taar5	Rat	trace-amine receptor activity	enables	ISS	UniProtKB:Q5QD14	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Taar5	Rat	trace-amine receptor activity	enables	IEA	UniProtKB:Q5QD14 and ensembl:ENSMUSP00000090329	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Taar5	Rat	trace-amine receptor activity	enables	IEA	InterPro:IPR009132	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Taar5	Rat	trace-amine receptor activity	enables	IBA	MGI:2148258 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Taar5	Rat	trace-amine receptor activity	enables	ISO	Taar5 (Mus musculus)	1624291	PMID:22545963 and PMID:37225986	RGD	PMID:22545963 and PMID:37225986
Taar5	Rat	trace-amine receptor activity	enables	IDA		407430012	PMID:22545963	UniProt
Taar5	Rat	transmembrane signaling receptor activity	enables	IEA	InterPro:IPR017981	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Taar5	Rat	trimethylamine receptor activity	enables	ISO	Taar5 (Mus musculus)	1624291	PMID:16878137 more ...	RGD	PMID:16878137 more ...
Taar5	Rat	trimethylamine receptor activity	enables	ISO	TAAR5 (Homo sapiens)	1624291	PMID:23393561	RGD	PMID:23393561
Taar5	Rat	trimethylamine receptor activity	enables	IEA	UniProtKB:O14804 and ensembl:ENSP00000258034	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Taar5	Rat	trimethylamine receptor activity	enables	IEA	UniProtKB:Q5QD14 and ensembl:ENSMUSP00000090329	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

#	Reference Title	Reference Citation
1.	Agonists for 13 trace amine-associated receptors provide insight into the molecular basis of odor selectivity.	Ferrero DM, etal., ACS Chem Biol. 2012 Jul 20;7(7):1184-9. doi: 10.1021/cb300111e. Epub 2012 May 7.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Trace amine-associated receptors form structurally and functionally distinct subfamilies of novel G protein-coupled receptors.	Lindemann L, etal., Genomics 2005 Mar;85(3):372-85.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:16878137	PMID:20559446	PMID:23177478	PMID:23393561

Taar5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	23,289,163 - 23,290,176 (-)	NCBI		GRCr8
mRatBN7.2	1	21,469,923 - 21,470,936 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	21,469,923 - 21,470,936 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	21,246,888 - 21,247,901 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	27,246,933 - 27,247,946 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	21,446,572 - 21,447,585 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	22,547,662 - 22,548,675 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	22,547,662 - 22,548,675 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	24,022,589 - 24,023,602 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	21,996,992 - 21,998,005 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	21,999,937 - 22,000,950 (-)	NCBI
Celera	1	20,213,693 - 20,214,706 (-)	NCBI		Celera
Cytogenetic Map	1	p12	NCBI

TAAR5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	132,588,592 - 132,616,747 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	132,588,592 - 132,589,741 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	132,909,731 - 132,937,886 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	132,951,505 - 132,952,518 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	6	133,656,568 - 133,657,714 (-)	NCBI		Celera
Cytogenetic Map	6	q23.2	NCBI
HuRef	6	130,484,645 - 130,485,791 (-)	NCBI		HuRef
CHM1_1	6	133,173,402 - 133,174,548 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	133,783,556 - 133,811,705 (-)	NCBI		T2T-CHM13v2.0

Taar5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	23,846,604 - 23,847,617 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	23,846,604 - 23,847,617 (+)	Ensembl		GRCm39 Ensembl
GRCm38	10	23,970,706 - 23,971,719 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	23,970,706 - 23,971,719 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	23,690,512 - 23,691,525 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	23,660,122 - 23,661,135 (+)	NCBI		MGSCv36	mm8
Celera	10	24,904,076 - 24,905,089 (+)	NCBI		Celera
Cytogenetic Map	10	A4	NCBI
cM Map	10	11.4	NCBI

Taar5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955436	13,152,345 - 13,153,358 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955436	13,152,345 - 13,153,358 (-)	NCBI	ChiLan1.0	ChiLan1.0

LOC100976647
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	152,570,996 - 152,572,333 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	150,478,084 - 150,506,651 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	130,364,744 - 130,366,076 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	134,472,911 - 134,474,045 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	134,472,986 - 134,473,999 (-)	Ensembl	panpan1.1		panPan2

TAAR5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Dog10K_Boxer_Tasha	1	26,626,764 - 26,627,777 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	25,550,851 - 25,551,864 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	25,550,851 - 25,551,864 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	25,596,935 - 25,597,948 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	25,495,726 - 25,496,739 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	25,758,931 - 25,759,944 (-)	NCBI		UU_Cfam_GSD_1.0

Taar5
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	120,842,255 - 120,843,395 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936560	621,557 - 622,573 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936560	621,477 - 622,605 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TAAR5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	1	31,104,142 - 31,105,153 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	34,624,798 - 34,625,811 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TAAR5
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	13	40,954,395 - 40,957,978 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	13	40,956,572 - 40,957,585 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	13,145,071 - 13,146,203 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Taar5
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624952	748,649 - 749,660 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624952	747,682 - 750,305 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Taar5
2 total Variants

Assembly: Rnor_6.0

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain	Variant Page
1	22548201	22548202	A	C	snv	SR/JrHsd (RGD)	View more Information

Predicted Target Of

	Summary Value
Count of predictions:	42
Count of miRNA genes:	41
Interacting mature miRNAs:	42
Transcripts:	ENSRNOT00000061209
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1578650	Bmd6	Bone mineral density QTL 6	12.2		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	1	509108	43284926	Rat
1354647	Despr8	Despair related QTL 8		0.0000341	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	1	24744506	Rat
1578651	Bmd7	Bone mineral density QTL 7	14.2		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	1	509108	43284926	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
7421626	Bp360	Blood pressure QTL 360		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	4393289	49393289	Rat
2313070	Bss52	Bone structure and strength QTL 52	4.4	0.0001	body length (VT:0001256)	body length (CMO:0000013)	1	1	32356093	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
631494	Bp95	Blood pressure QTL 95	40	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	16206210	49268520	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
5684998	Bss101	Bone structure and strength QTL 101	3.6		tibia strength trait (VT:1000284)	tibia ultimate force (CMO:0001734)	1	15431621	49361612	Rat
2298546	Neuinf4	Neuroinflammation QTL 4	5.1		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	1	1	28736750	Rat
5684999	Bss102	Bone structure and strength QTL 102	5.5	7e-07	tibia strength trait (VT:1000284)	tibia stiffness (CMO:0001735)	1	15431621	49361612	Rat
1300167	Hrtrt2	Heart rate QTL 2	4.35		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	11481312	75088344	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
2317755	Glom22	Glomerulus QTL 22	3.8		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	1	11481482	32355910	Rat
1578756	Iddm22	Insulin dependent diabetes mellitus QTL 22	2.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	11835181	56835181	Rat
631508	Sald1	Serum aldosterone level QTL 1	3.7		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	1	9856001	54856001	Rat
2313090	Bmd69	Bone mineral density QTL 69	4.4	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	1	32356093	Rat
4889451	Eae29	Experimental allergic encephalomyelitis QTL 29	5.51		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	1	5925877	24697545	Rat
724520	Bp145	Blood pressure QTL 145	2.1	0.0024	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	20784828	65784828	Rat
1558642	Prcr2	Prostate cancer resistance QTL 2	4.3		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	1	20763158	44095856	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
738020	Pia8	Pristane induced arthritis QTL 8	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	1	65833076	Rat
1600360	Mcs16	Mammary carcinoma susceptibility QTL 16	2.4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	2244390	43433040	Rat
1578669	Bss9	Bone structure and strength QTL 9	6.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	1	509108	43284926	Rat
2302038	Pia31	Pristane induced arthritis QTL 31	5.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	1	10992065	55992065	Rat
634353	Rends2	Renal damage susceptibility QTL 2		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	1	19333571	56983283	Rat
2313053	Bss51	Bone structure and strength QTL 51	3.8	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	1	32356093	Rat

Taar5

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	21,470,054 - 21,470,861 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	22,547,794 - 22,548,600	NCBI	Rnor6.0
Rnor_5.0	1	24,022,721 - 24,023,527	UniSTS	Rnor5.0
RGSC_v3.4	1	21,997,124 - 21,997,930	UniSTS	RGSC3.4
Celera	1	20,213,825 - 20,214,631	UniSTS
Cytogenetic Map	1	p12	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	reproductive system	respiratory system
7	3	4	1	2	1	5	6	5	19	3


RefSeq Transcripts	NM_001009650	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC128759	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY702318	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FJ372562	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000061209 ⟹ ENSRNOP00000057922

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	21,469,923 - 21,470,936 (-)	Ensembl
Rnor_6.0 Ensembl	1	22,547,662 - 22,548,675 (-)	Ensembl

RefSeq Acc Id:

NM_001009650 ⟹ NP_001009650

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	23,289,163 - 23,290,176 (-)	NCBI
mRatBN7.2	1	21,469,923 - 21,470,936 (-)	NCBI
Rnor_6.0	1	22,547,662 - 22,548,675 (-)	NCBI
Rnor_5.0	1	24,022,589 - 24,023,602 (-)	NCBI
RGSC_v3.4	1	21,996,992 - 21,998,005 (-)	RGD
Celera	1	20,213,693 - 20,214,706 (-)	RGD

Sequence:

show sequence

ATGAGAGCTGTCCTCCTCCCCGGCTCTGGAGAGCAGCCTGCGGCGTTCTGTTACCAGGTGAATGGGTCTTGCCCCAGGACAGTCCACCCGCTGGCCATCCGGGTCCTCATCTACCTGGCCTGCGCAGT
AGGTATGCTGATCACAGTCCTGGGGAATTTGTTTGTGGTGTTTGCCGTGTCCTACTTTAAAGTGCTCCACACCCCCACCAACTTCCTGCTGCTCTCCCTGGCTCTGGCGGACATGTTGCTGGGTCTGC
TGGTGCTGCCCCTGAGCACAGTCCGCTCTGTGGAGAGCTGCTGGTTCTTCGGAGACTTCCTGTGCCGTCTGCATACCTACCTGGACACGCTGTTCTGCCTTACCTCCATCTTCCATCTCTGTTTTATT
TCCATTGACCGTCATTGTGCCATCTGTGACCCCCTGCTCTATCCCTCCAAGTTCACAGTCAGGATAGCCCTCCGATACATAGCGGCAGGGTGGGGGATACCAGCAGCCTACACTGCCTTCTTTCTCTA
CACAGATGTGGTAGAGAGAGCACTCAGCCAGTGGCTGGAAGAAATGCCTTGTGTGGGCAGCTGCCAGCTACTGTTCAATAAGTTCTGGGGGTGGTTAAACTTCCCTGCGTTTTTCATCCCCTGTCTCA
TCATGATCAGCTTGTACCTGAAGATCTTTGTGGTCGCTACCAGGCAAGCTCAGCAGATCAGAACCCTGAGCCAAAGTTTGTCCGGGGCTGTCAAGCGGGAAAGAAAAGCTGCCAAGACGCTGGGCATT
GCTGTGGGCATCTACCTTGTGTGTTGGCTTCCCTTCACTGTGGACACGCTGGTGGACAGCCTCCTTAACTTCGTCACCCCACCCCTGGTCTTTGACATCTTTATCTGGTTTGCTTATTTCAATTCAGC
CTGTAACCCCATCATCTATGTCTTCTCGTATAGATGGTTTAGGAAGGCCCTGAAACTCCTCCTGAGCCGGGAGATCCTCTCACCACGGACACAGACTGCTGATCTGTTCCATGACTGA

hide sequence


Protein RefSeqs	NP_001009650	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAV70130	(Get FASTA)	NCBI Sequence Viewer
	ACP18695	(Get FASTA)	NCBI Sequence Viewer
	EDL87751	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000057922
	ENSRNOP00000057922.1
GenBank Protein	Q5QD23	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001009650 ⟸ NM_001009650

- UniProtKB:

Q5QD23 (UniProtKB/Swiss-Prot), D8KZT4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MRAVLLPGSGEQPAAFCYQVNGSCPRTVHPLAIRVLIYLACAVGMLITVLGNLFVVFAVSYFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFI
SIDRHCAICDPLLYPSKFTVRIALRYIAAGWGIPAAYTAFFLYTDVVERALSQWLEEMPCVGSCQLLFNKFWGWLNFPAFFIPCLIMISLYLKIFVVATRQAQQIRTLSQSLSGAVKRERKAAKTLGI
AVGIYLVCWLPFTVDTLVDSLLNFVTPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKALKLLLSREILSPRTQTADLFHD

hide sequence

Ensembl Acc Id:

ENSRNOP00000057922 ⟸ ENSRNOT00000061209

Protein Domains

G-protein coupled receptors family 1 profile G-protein coupled receptors family 2 profile

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5QD23-F1-model_v2	AlphaFold	Q5QD23	1-337	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-62084	BioCyc
Ensembl Genes	ENSRNOG00000039869	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000061209	ENTREZGENE
	ENSRNOT00000061209.2	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot
InterPro	GPCR_2-like	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot
	TAAR	UniProtKB/Swiss-Prot
	TAAR_fam	UniProtKB/Swiss-Prot
KEGG Report	rno:294123	UniProtKB/Swiss-Prot
NCBI Gene	294123	ENTREZGENE
PANTHER	HISTAMINE RECEPTOR-RELATED G-PROTEIN COUPLED RECEPTOR	UniProtKB/Swiss-Prot
	TRACE AMINE-ASSOCIATED RECEPTOR 5	UniProtKB/Swiss-Prot
Pfam	7tm_1	UniProtKB/Swiss-Prot
PhenoGen	Taar5	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot
	TRACEAMINER	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000039869	RatGTEx
SMART	7TM_GPCR_Srsx	UniProtKB/Swiss-Prot
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot
UniProt	D8KZT4	ENTREZGENE, UniProtKB/TrEMBL
	Q5QD23	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-11-20	Taar5	trace amine-associated receptor 5	Taar5	trace amine associated receptor 5	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Taar5	trace amine associated receptor 5			Symbol and Name updated	1559027	APPROVED
2005-11-17	Taar5	trace amine associated receptor 5			Symbol and Name status set to approved	1299863	APPROVED
2005-07-29	Taar5	trace amine associated receptor 5			Symbol and Name status set to provisional	70820	PROVISIONAL

Note Type	Note	Reference
gene_evolution	phylogenetic analysis, as well as analysis of the amino acid composition of the ligand pocket, places Taar5 in a subfamily distinct from the other members of the Taar family	1334501

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message