Symbol:
Erf
Name:
Ets2 repressor factor
RGD ID:
1311991
Description:
Predicted to enable DNA-binding transcription repressor activity, RNA polymerase II-specific and sequence-specific DNA binding activity. Predicted to be involved in cell differentiation and negative regulation of transcription by RNA polymerase II. Predicted to act upstream of or within chorio-allantoic fusion; ectodermal cell differentiation; and trophoblast giant cell differentiation. Predicted to be located in cytosol; nucleoplasm; and plasma membrane. Predicted to be active in nucleus. Human ortholog(s) of this gene implicated in craniosynostosis 4. Orthologous to human ERF (ETS2 repressor factor); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol; aflatoxin B1.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
ETS domain-containing transcription factor ERF; LOC292721
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 89,957,760 - 89,966,213 (-) NCBI GRCr8 mRatBN7.2 1 80,829,935 - 80,838,388 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 80,829,935 - 80,838,388 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 86,222,152 - 86,230,605 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 94,773,296 - 94,781,750 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 87,977,929 - 87,986,382 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 82,112,449 - 82,120,902 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 82,112,449 - 82,120,902 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 83,378,953 - 83,382,937 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 80,518,385 - 80,527,142 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 80,597,483 - 80,605,113 (-) NCBI Celera 1 75,273,608 - 75,281,418 (-) NCBI Celera Cytogenetic Map 1 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Erf Rat 1,2-dimethylhydrazine multiple interactions ISO Erf (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ERF mRNA CTD PMID:22206623 Erf Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Erf (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of ERF mRNA CTD PMID:24058054 Erf Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Erf (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ERF mRNA CTD PMID:24680724 Erf Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ERF mRNA CTD PMID:21215274 Erf Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Erf (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to ERF promoter] CTD PMID:19654925 Erf Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Erf (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of ERF mRNA CTD PMID:19933214 Erf Rat 2-hydroxypropanoic acid increases expression ISO ERF (Homo sapiens) 6480464 Lactic Acid results in increased expression of ERF mRNA CTD PMID:30851411 Erf Rat 2-methylcholine affects expression ISO ERF (Homo sapiens) 6480464 beta-methylcholine affects the expression of ERF mRNA CTD PMID:21179406 Erf Rat 4,4'-sulfonyldiphenol decreases expression ISO Erf (Mus musculus) 6480464 bisphenol S results in decreased expression of ERF mRNA CTD PMID:39298647 Erf Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of ERF mRNA CTD PMID:36041667 Erf Rat 4-hydroxyphenyl retinamide increases expression ISO Erf (Mus musculus) 6480464 Fenretinide results in increased expression of ERF mRNA CTD PMID:28973697 Erf Rat 8-Br-cAMP decreases expression ISO ERF (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in decreased expression of ERF mRNA CTD PMID:22079614 Erf Rat aflatoxin B1 multiple interactions EXP 6480464 [sulforaphane co-treated with Aflatoxin B1] affects the expression of ERF mRNA CTD PMID:25450479 Erf Rat all-trans-retinoic acid affects expression ISO ERF (Homo sapiens) 6480464 Tretinoin affects the expression of ERF mRNA CTD PMID:16054129 Erf Rat all-trans-retinoic acid decreases expression ISO ERF (Homo sapiens) 6480464 Tretinoin results in decreased expression of ERF mRNA CTD PMID:33167477 Erf Rat all-trans-retinoic acid increases expression ISO Erf (Mus musculus) 6480464 Tretinoin results in increased expression of ERF mRNA CTD PMID:16604517 Erf Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of ERF mRNA CTD PMID:30779732 Erf Rat azoxystrobin multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of ERF mRNA CTD PMID:33854195 Erf Rat benzo[a]pyrene multiple interactions ISO Erf (Mus musculus) 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to ERF promoter] CTD PMID:19654925 Erf Rat benzo[a]pyrene increases methylation ISO ERF (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of ERF promoter CTD PMID:27901495 Erf Rat benzo[b]fluoranthene increases expression ISO Erf (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of ERF mRNA CTD PMID:26377693 Erf Rat bisphenol A decreases expression ISO Erf (Mus musculus) 6480464 bisphenol A results in decreased expression of ERF mRNA CTD PMID:26063408 Erf Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of ERF mRNA CTD PMID:36041667 Erf Rat bisphenol A increases expression ISO Erf (Mus musculus) 6480464 bisphenol A results in increased expression of ERF mRNA CTD PMID:32156529 Erf Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ERF mRNA CTD PMID:32145629 Erf Rat bisphenol A affects methylation ISO Erf (Mus musculus) 6480464 bisphenol A affects the methylation of ERF promoter CTD PMID:27334623 Erf Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ERF mRNA CTD PMID:25181051 Erf Rat bisphenol F increases expression ISO Erf (Mus musculus) 6480464 bisphenol F results in increased expression of ERF mRNA CTD PMID:38685157 Erf Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of ERF mRNA CTD PMID:36041667 Erf Rat butanal increases expression ISO ERF (Homo sapiens) 6480464 butyraldehyde results in increased expression of ERF mRNA CTD PMID:26079696 Erf Rat cadmium atom increases expression ISO ERF (Homo sapiens) 6480464 Cadmium results in increased expression of ERF mRNA CTD PMID:24376830 Erf Rat cadmium atom multiple interactions ISO Erf (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of ERF mRNA CTD PMID:37325564 Erf Rat cadmium dichloride multiple interactions ISO Erf (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of ERF mRNA CTD PMID:37325564 Erf Rat caffeine decreases phosphorylation ISO ERF (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of ERF protein CTD PMID:35688186 Erf Rat calciol decreases expression ISO Erf (Mus musculus) 6480464 Cholecalciferol results in decreased expression of ERF mRNA CTD PMID:16508948 Erf Rat chlorpyrifos multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of ERF mRNA CTD PMID:33854195 Erf Rat chlorpyrifos increases expression ISO Erf (Mus musculus) 6480464 Chlorpyrifos results in increased expression of ERF mRNA CTD PMID:37019170 Erf Rat cis-caffeic acid multiple interactions ISO ERF (Homo sapiens) 6480464 caffeic acid promotes the reaction [Thapsigargin results in increased expression of ERF mRNA] CTD PMID:19442820 Erf Rat clofibrate multiple interactions ISO Erf (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of ERF mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of ERF mRNA] CTD PMID:17585979 Erf Rat cobalt dichloride decreases expression ISO ERF (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of ERF mRNA CTD PMID:19376846 Erf Rat coumarin increases phosphorylation ISO ERF (Homo sapiens) 6480464 coumarin results in increased phosphorylation of ERF protein CTD PMID:35688186 Erf Rat Dibutyl phosphate affects expression ISO ERF (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of ERF mRNA CTD PMID:37042841 Erf Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of ERF mRNA CTD PMID:21266533 Erf Rat dieldrin affects expression EXP 6480464 Dieldrin affects the expression of ERF mRNA CTD PMID:22546817 Erf Rat dorsomorphin multiple interactions ISO ERF (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of ERF mRNA CTD PMID:27188386 Erf Rat doxorubicin decreases expression ISO ERF (Homo sapiens) 6480464 Doxorubicin results in decreased expression of ERF mRNA CTD PMID:29803840 Erf Rat epoxiconazole affects expression ISO Erf (Mus musculus) 6480464 epoxiconazole affects the expression of ERF mRNA CTD PMID:35436446 Erf Rat folic acid multiple interactions ISO Erf (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ERF mRNA CTD PMID:22206623 Erf Rat FR900359 affects phosphorylation ISO ERF (Homo sapiens) 6480464 FR900359 affects the phosphorylation of ERF protein CTD PMID:37730182 Erf Rat furan decreases expression EXP 6480464 furan results in decreased expression of ERF mRNA CTD PMID:25539665 Erf Rat glyphosate multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of ERF mRNA CTD PMID:33854195 Erf Rat GSK-J4 increases expression ISO ERF (Homo sapiens) 6480464 GSK-J4 results in increased expression of ERF mRNA CTD PMID:29301935 Erf Rat hydrazine decreases expression ISO Erf (Mus musculus) 6480464 hydrazine results in decreased expression of ERF mRNA CTD PMID:15282401 Erf Rat hydrogen peroxide multiple interactions ISO ERF (Homo sapiens) 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in increased expression of ERF protein CTD PMID:18951874 Erf Rat imidacloprid multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of ERF mRNA CTD PMID:33854195 Erf Rat Licochalcone B increases expression ISO ERF (Homo sapiens) 6480464 licochalcone B results in increased expression of ERF mRNA CTD PMID:33647349 Erf Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of ERF mRNA CTD PMID:33484710 Erf Rat okadaic acid increases expression ISO ERF (Homo sapiens) 6480464 Okadaic Acid results in increased expression of ERF mRNA CTD PMID:38832940 Erf Rat ozone multiple interactions ISO ERF (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of ERF mRNA CTD PMID:35430440 Erf Rat paracetamol multiple interactions ISO Erf (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of ERF mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of ERF mRNA] CTD PMID:17585979 Erf Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of ERF mRNA CTD PMID:33387578 Erf Rat paracetamol affects expression ISO Erf (Mus musculus) 6480464 Acetaminophen affects the expression of ERF mRNA CTD PMID:17562736 Erf Rat propiconazole decreases expression ISO Erf (Mus musculus) 6480464 propiconazole results in decreased expression of ERF mRNA CTD PMID:21278054 Erf Rat quercetin decreases phosphorylation ISO ERF (Homo sapiens) 6480464 Quercetin results in decreased phosphorylation of ERF protein CTD PMID:35688186 Erf Rat rac-lactic acid increases expression ISO ERF (Homo sapiens) 6480464 Lactic Acid results in increased expression of ERF mRNA CTD PMID:30851411 Erf Rat SB 431542 multiple interactions ISO ERF (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of ERF mRNA CTD PMID:27188386 Erf Rat silicon dioxide increases expression ISO ERF (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of ERF mRNA CTD PMID:23806026 Erf Rat sodium arsenite increases expression ISO ERF (Homo sapiens) 6480464 sodium arsenite results in increased expression of ERF mRNA CTD PMID:38568856 Erf Rat sulforaphane multiple interactions EXP 6480464 [sulforaphane co-treated with Aflatoxin B1] affects the expression of ERF mRNA CTD PMID:25450479 Erf Rat sunitinib decreases expression ISO ERF (Homo sapiens) 6480464 Sunitinib results in decreased expression of ERF mRNA CTD PMID:31533062 Erf Rat temozolomide decreases expression ISO ERF (Homo sapiens) 6480464 Temozolomide results in decreased expression of ERF mRNA CTD PMID:31758290 Erf Rat thapsigargin multiple interactions ISO ERF (Homo sapiens) 6480464 caffeic acid promotes the reaction [Thapsigargin results in increased expression of ERF mRNA] more ... CTD PMID:19442820 Erf Rat thapsigargin increases expression ISO ERF (Homo sapiens) 6480464 Thapsigargin results in increased expression of ERF mRNA CTD PMID:19442820 Erf Rat theophylline multiple interactions ISO ERF (Homo sapiens) 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in increased expression of ERF protein CTD PMID:18951874 Erf Rat thiabendazole multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of ERF mRNA CTD PMID:33854195 Erf Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of ERF mRNA CTD PMID:34492290 Erf Rat thiram increases expression ISO ERF (Homo sapiens) 6480464 Thiram results in increased expression of ERF mRNA CTD PMID:38568856 Erf Rat titanium dioxide decreases expression ISO Erf (Mus musculus) 6480464 titanium dioxide results in decreased expression of ERF mRNA CTD PMID:23557971 Erf Rat trans-caffeic acid multiple interactions ISO ERF (Homo sapiens) 6480464 caffeic acid promotes the reaction [Thapsigargin results in increased expression of ERF mRNA] CTD PMID:19442820 Erf Rat triphenyl phosphate affects expression ISO ERF (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ERF mRNA CTD PMID:37042841 Erf Rat valproic acid increases methylation ISO ERF (Homo sapiens) 6480464 Valproic Acid results in increased methylation of ERF gene CTD PMID:29154799 Erf Rat valproic acid affects expression ISO ERF (Homo sapiens) 6480464 Valproic Acid affects the expression of ERF mRNA CTD PMID:25979313 Erf Rat valproic acid decreases expression ISO ERF (Homo sapiens) 6480464 Valproic Acid results in decreased expression of ERF mRNA CTD PMID:26272509 Erf Rat valproic acid multiple interactions ISO ERF (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of ERF mRNA CTD PMID:27188386
1,2-dimethylhydrazine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-hydroxypropanoic acid (ISO) 2-methylcholine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxyphenyl retinamide (ISO) 8-Br-cAMP (ISO) aflatoxin B1 (EXP) all-trans-retinoic acid (ISO) amphetamine (EXP) azoxystrobin (EXP) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP,ISO) butanal (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) calciol (ISO) chlorpyrifos (EXP,ISO) cis-caffeic acid (ISO) clofibrate (ISO) cobalt dichloride (ISO) coumarin (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) dieldrin (EXP) dorsomorphin (ISO) doxorubicin (ISO) epoxiconazole (ISO) folic acid (ISO) FR900359 (ISO) furan (EXP) glyphosate (EXP) GSK-J4 (ISO) hydrazine (ISO) hydrogen peroxide (ISO) imidacloprid (EXP) Licochalcone B (ISO) nitrofen (EXP) okadaic acid (ISO) ozone (ISO) paracetamol (EXP,ISO) propiconazole (ISO) quercetin (ISO) rac-lactic acid (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sulforaphane (EXP) sunitinib (ISO) temozolomide (ISO) thapsigargin (ISO) theophylline (ISO) thiabendazole (EXP) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trans-caffeic acid (ISO) triphenyl phosphate (ISO) valproic acid (ISO)
Erf Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 89,957,760 - 89,966,213 (-) NCBI GRCr8 mRatBN7.2 1 80,829,935 - 80,838,388 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 80,829,935 - 80,838,388 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 86,222,152 - 86,230,605 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 94,773,296 - 94,781,750 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 87,977,929 - 87,986,382 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 82,112,449 - 82,120,902 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 82,112,449 - 82,120,902 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 83,378,953 - 83,382,937 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 80,518,385 - 80,527,142 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 80,597,483 - 80,605,113 (-) NCBI Celera 1 75,273,608 - 75,281,418 (-) NCBI Celera Cytogenetic Map 1 q21 NCBI
ERF Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 42,247,569 - 42,255,128 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 42,247,569 - 42,255,128 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 42,751,721 - 42,759,280 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 47,443,557 - 47,451,149 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 47,443,561 - 47,451,113 NCBI Celera 19 39,552,513 - 39,560,105 (-) NCBI Celera Cytogenetic Map 19 q13.2 NCBI HuRef 19 39,182,130 - 39,189,922 (-) NCBI HuRef CHM1_1 19 42,753,399 - 42,760,960 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 45,066,943 - 45,074,502 (-) NCBI T2T-CHM13v2.0
Erf Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 24,941,985 - 24,950,522 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 24,941,986 - 24,950,186 (-) Ensembl GRCm39 Ensembl GRCm38 7 25,242,560 - 25,251,104 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 25,242,561 - 25,250,761 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 26,027,579 - 26,035,777 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 24,951,320 - 24,959,425 (-) NCBI MGSCv36 mm8 Celera 7 19,858,364 - 19,866,638 (-) NCBI Celera Cytogenetic Map 7 A3 NCBI cM Map 7 13.73 NCBI
Erf Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955555 654,414 - 665,277 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955555 654,945 - 661,097 (+) NCBI ChiLan1.0 ChiLan1.0
ERF Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 48,353,012 - 48,360,570 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 50,221,637 - 50,229,198 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 39,135,757 - 39,143,343 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 47,728,192 - 47,735,808 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 47,728,192 - 47,735,808 (-) Ensembl panpan1.1 panPan2
ERF Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 112,117,338 - 112,124,464 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 112,117,141 - 112,124,077 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 111,539,322 - 111,550,990 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 112,725,792 - 112,737,462 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 112,729,426 - 112,736,627 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 112,279,998 - 112,291,665 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 111,915,949 - 111,927,016 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 112,842,484 - 112,854,156 (+) NCBI UU_Cfam_GSD_1.0
Erf
ERF Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 49,678,888 - 49,685,538 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 49,678,858 - 49,686,422 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 45,597,124 - 45,604,058 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ERF Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 36,452,604 - 36,460,188 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 36,452,577 - 36,460,122 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666073 14,696,845 - 14,704,450 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Erf
.
Predicted Target Of
Count of predictions: 290 Count of miRNA genes: 175 Interacting mature miRNAs: 222 Transcripts: ENSRNOT00000027684 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1578649 Bmd8 Bone mineral density QTL 8 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 49393172 94393172 Rat 1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 78479925 123479925 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 4889929 Bss87 Bone structure and strength QTL 87 6.7 tibia area (VT:1000281) tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722) 1 53895117 82174945 Rat 2313062 Bmd73 Bone mineral density QTL 73 3.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 11481312 82174945 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 1554320 Bmd1 Bone mineral density QTL 1 12.2 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 509108 86060548 Rat 2302059 Pia36 Pristane induced arthritis QTL 36 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 43333002 88333002 Rat 2313065 Bss67 Bone structure and strength QTL 67 3.1 0.0001 tibia area (VT:1000281) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 2313069 Bss68 Bone structure and strength QTL 68 2.9 0.0001 tibia size trait (VT:0100001) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 2313075 Bss66 Bone structure and strength QTL 66 3.4 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 11481312 82174945 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 631512 Scl6 Serum cholesterol level QTL 6 9.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 72197680 90508767 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 2313077 Bss69 Bone structure and strength QTL 69 3.5 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 11481312 82174945 Rat 1549903 Bp267 Blood pressure QTL 267 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 77876254 106047988 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 4889494 Scort2 Serum corticosterone level QTL 2 4.2 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 80592172 125592172 Rat 61342 Bp27 Blood pressure QTL 27 3.4 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 56732668 98773277 Rat 1300172 Bp172 Blood pressure QTL 172 3.56 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 32737273 90665040 Rat 4889962 Bss94 Bone structure and strength QTL 94 3.8 tibia area (VT:1000281) tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722) 1 49361465 82174945 Rat 61344 Bp29 Blood pressure QTL 29 7.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 78350581 123350581 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 6903308 Scl36 Serum cholesterol QTL 36 2 0.0125 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 53863041 90532583 Rat 2313092 Bmd72 Bone mineral density QTL 72 2.5 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 11481312 82174945 Rat 2300164 Bmd44 Bone mineral density QTL 44 5.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 1 56949932 101949932 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 2313097 Bss70 Bone structure and strength QTL 70 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 152025249 Scl82 Serum cholesterol level QTL 82 4.77 blood cholesterol amount (VT:0000180) 1 50343510 99980958 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 77857876 122857876 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 78430536 123430536 Rat 4889919 Bss86 Bone structure and strength QTL 86 4.1 tibia area (VT:1000281) tibia midshaft total cross-sectional area (CMO:0001715) 1 53895117 82174945 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat 61433 Cia2 Collagen induced arthritis QTL 2 5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 78430754 91209302 Rat
RH79119
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 80,830,948 - 80,831,081 (+) MAPPER mRatBN7.2 Rnor_6.0 1 82,113,463 - 82,113,595 NCBI Rnor6.0 Rnor_5.0 1 83,379,967 - 83,380,099 UniSTS Rnor5.0 RGSC_v3.4 1 80,519,399 - 80,519,531 UniSTS RGSC3.4 Celera 1 75,274,622 - 75,274,754 UniSTS Cytogenetic Map 1 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000027684 ⟹ ENSRNOP00000027684
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 80,829,935 - 80,838,388 (-) Ensembl Rnor_6.0 Ensembl 1 82,112,449 - 82,120,902 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000099169 ⟹ ENSRNOP00000093732
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 80,833,134 - 80,838,388 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000112122 ⟹ ENSRNOP00000089762
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 80,829,935 - 80,834,794 (-) Ensembl
RefSeq Acc Id:
NM_001170335 ⟹ NP_001163806
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 89,957,760 - 89,966,213 (-) NCBI mRatBN7.2 1 80,829,935 - 80,838,388 (-) NCBI Rnor_6.0 1 82,112,449 - 82,120,902 (-) NCBI Rnor_5.0 1 83,378,953 - 83,382,937 (-) NCBI RGSC_v3.4 1 80,518,385 - 80,527,142 (-) RGD Celera 1 75,273,608 - 75,281,418 (-) RGD
Sequence:
GATATTAACCCGGGAGGCGGCGGCGGGGAGGGGAGAGGCTCTGAGAGGCGAGGCCGGGTGCGGCGGCGAGGGCGTCCCAACGGGCGCGGGACGGGACGGGGCAACGCGGGCGCCTGGAGCAGCGGCCC
hide sequence
RefSeq Acc Id:
NP_001163806 ⟸ NM_001170335
- UniProtKB:
D3ZJW0 (UniProtKB/TrEMBL), A0A8I6A9F0 (UniProtKB/TrEMBL)
- Sequence:
MKTPADTGFAFPDWAYKPESSPGSRQIQLWHFILELLRKEEYQGVIAWQGDYGEFVIKDPDEVARLWGVRKCKPQMNYDKLSRALRYYYNKRILHKTKGKRFTYKFNFNKLVLVNYPFIDVGLAGGAV
hide sequence
Ensembl Acc Id:
ENSRNOP00000027684 ⟸ ENSRNOT00000027684
Ensembl Acc Id:
ENSRNOP00000093732 ⟸ ENSRNOT00000099169
Ensembl Acc Id:
ENSRNOP00000089762 ⟸ ENSRNOT00000112122
RGD ID: 13689812 Promoter ID: EPDNEW_R337 Type: multiple initiation site Name: Erf_1 Description: Ets2 repressor factor SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 82,120,870 - 82,120,930 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Erf
Ets2 repressor factor
Erf_predicted
Ets2 repressor factor (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Erf_predicted
Ets2 repressor factor (predicted)
Symbol and Name status set to approved
70820 APPROVED
