Symbol:
Slc38a9
Name:
solute carrier family 38, member 9
RGD ID:
1311881
Description:
Predicted to enable several functions, including L-amino acid transmembrane transporter activity; arginine binding activity; and cholesterol binding activity. Predicted to be involved in carboxylic acid transport; cellular response to amino acid stimulus; and positive regulation of TORC1 signaling. Predicted to be located in late endosome and lysosome. Predicted to be part of FNIP-folliculin RagC/D GAP and Ragulator complex. Predicted to be active in lysosomal membrane. Orthologous to human SLC38A9 (solute carrier family 38 member 9); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC310091; MGC125012; neutral amino acid transporter 9; putative sodium-coupled neutral amino acid transporter 9; RGD1311881; similar to hypothetical protein FLJ90709; sodium-coupled neutral amino acid transporter 9; solute carrier family 38 member 9
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SLC38A9 (solute carrier family 38 member 9) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Slc38a9 (solute carrier family 38, member 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Slc38a9 (solute carrier family 38 member 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SLC38A9 (solute carrier family 38 member 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SLC38A9 (solute carrier family 38 member 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Slc38a9 (solute carrier family 38 member 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SLC38A9 (solute carrier family 38 member 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SLC38A9 (solute carrier family 38 member 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Slc38a9 (solute carrier family 38 member 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Slc38a9 (solute carrier family 38, member 9)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
SLC38A9 (solute carrier family 38 member 9)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
slc38a9 (solute carrier family 38 member 9)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
F13H10.3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
slc38a9
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 46,024,731 - 46,102,419 (+) NCBI GRCr8 mRatBN7.2 2 44,291,637 - 44,374,897 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 44,291,989 - 44,368,955 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 51,417,505 - 51,482,408 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 49,475,942 - 49,540,776 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 44,349,547 - 44,416,361 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 44,512,556 - 44,592,793 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 44,512,895 - 44,592,053 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 63,554,196 - 63,634,429 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 44,044,770 - 44,110,884 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 43,961,910 - 44,040,250 (+) NCBI Celera 2 40,082,412 - 40,147,573 (+) NCBI Celera Cytogenetic Map 2 q14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Slc38a9 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO SLC38A9 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of SLC38A9 mRNA CTD PMID:22079256 Slc38a9 Rat 1,2-dichloroethane decreases expression ISO Slc38a9 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of SLC38A9 mRNA CTD PMID:28960355 Slc38a9 Rat 1,2-dimethylhydrazine decreases expression ISO Slc38a9 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of SLC38A9 mRNA CTD PMID:22206623 Slc38a9 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of SLC38A9 mRNA CTD PMID:26496021 Slc38a9 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Slc38a9 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Slc38a9 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Slc38a9 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Slc38a9 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Slc38a9 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Lipopolysaccharides] results in increased methylation of SLC38A9 gene CTD PMID:21212295 Slc38a9 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SLC38A9 mRNA CTD PMID:33387578 Slc38a9 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Slc38a9 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SLC38A9 mRNA CTD PMID:21570461 Slc38a9 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of SLC38A9 mRNA CTD PMID:30047161 Slc38a9 Rat atrazine decreases expression ISO SLC38A9 (Homo sapiens) 6480464 Atrazine results in decreased expression of SLC38A9 mRNA CTD PMID:22378314 Slc38a9 Rat benzo[b]fluoranthene increases expression ISO Slc38a9 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of SLC38A9 mRNA CTD PMID:26377693 Slc38a9 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of SLC38A9 mRNA CTD PMID:26496021 Slc38a9 Rat bisphenol A decreases expression ISO Slc38a9 (Mus musculus) 6480464 bisphenol A results in decreased expression of SLC38A9 mRNA CTD PMID:32156529 Slc38a9 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SLC38A9 mRNA CTD PMID:25181051 more ... Slc38a9 Rat bisphenol F decreases expression ISO Slc38a9 (Mus musculus) 6480464 bisphenol F results in decreased expression of SLC38A9 mRNA CTD PMID:38685157 Slc38a9 Rat cadmium dichloride increases expression ISO SLC38A9 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of SLC38A9 mRNA CTD PMID:38568856 Slc38a9 Rat carbon nanotube decreases expression ISO Slc38a9 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Slc38a9 Rat clothianidin decreases expression ISO SLC38A9 (Homo sapiens) 6480464 clothianidin results in decreased expression of SLC38A9 mRNA CTD PMID:31626844 Slc38a9 Rat copper(II) sulfate decreases expression ISO SLC38A9 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of SLC38A9 mRNA CTD PMID:19549813 Slc38a9 Rat dicrotophos decreases expression ISO SLC38A9 (Homo sapiens) 6480464 dicrotophos results in decreased expression of SLC38A9 mRNA CTD PMID:28302478 Slc38a9 Rat doxorubicin decreases expression ISO SLC38A9 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of SLC38A9 mRNA CTD PMID:29803840 Slc38a9 Rat ethyl methanesulfonate increases expression ISO SLC38A9 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of SLC38A9 mRNA CTD PMID:23649840 Slc38a9 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of SLC38A9 mRNA CTD PMID:33387578 Slc38a9 Rat lipopolysaccharide multiple interactions ISO Slc38a9 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Lipopolysaccharides] results in increased methylation of SLC38A9 gene CTD PMID:21212295 Slc38a9 Rat manganese atom multiple interactions ISO SLC38A9 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of SLC38A9 mRNA CTD PMID:39836092 Slc38a9 Rat manganese(0) multiple interactions ISO SLC38A9 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of SLC38A9 mRNA CTD PMID:39836092 Slc38a9 Rat manganese(II) chloride multiple interactions ISO SLC38A9 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of SLC38A9 mRNA CTD PMID:39836092 Slc38a9 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of SLC38A9 gene CTD PMID:35440735 Slc38a9 Rat methyl methanesulfonate increases expression ISO SLC38A9 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of SLC38A9 mRNA CTD PMID:23649840 Slc38a9 Rat paracetamol decreases expression ISO SLC38A9 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of SLC38A9 mRNA CTD PMID:21420995 Slc38a9 Rat PCB138 multiple interactions ISO Slc38a9 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Slc38a9 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Slc38a9 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of SLC38A9 mRNA CTD PMID:36331819 Slc38a9 Rat phenobarbital decreases methylation ISO Slc38a9 (Mus musculus) 6480464 Phenobarbital results in decreased methylation of SLC38A9 gene CTD PMID:19233941 Slc38a9 Rat pirinixic acid decreases expression ISO Slc38a9 (Mus musculus) 6480464 pirinixic acid results in decreased expression of SLC38A9 mRNA CTD PMID:20813756 Slc38a9 Rat potassium chromate multiple interactions ISO SLC38A9 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of SLC38A9 mRNA CTD PMID:22079256 Slc38a9 Rat potassium chromate decreases expression ISO SLC38A9 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of SLC38A9 mRNA CTD PMID:22079256 Slc38a9 Rat quercetin decreases expression ISO SLC38A9 (Homo sapiens) 6480464 Quercetin results in decreased expression of SLC38A9 mRNA CTD PMID:21632981 Slc38a9 Rat Salinomycin decreases expression ISO SLC38A9 (Homo sapiens) 6480464 salinomycin results in decreased expression of SLC38A9 mRNA CTD PMID:19682730 Slc38a9 Rat silicon dioxide decreases expression ISO SLC38A9 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of SLC38A9 mRNA CTD PMID:25895662 Slc38a9 Rat sodium arsenite decreases expression ISO SLC38A9 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of SLC38A9 mRNA CTD PMID:22714537 Slc38a9 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of SLC38A9 mRNA CTD PMID:30047161 Slc38a9 Rat sunitinib increases expression ISO SLC38A9 (Homo sapiens) 6480464 Sunitinib results in increased expression of SLC38A9 mRNA CTD PMID:31533062 Slc38a9 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of SLC38A9 mRNA CTD PMID:34492290 Slc38a9 Rat triphenyl phosphate affects expression ISO SLC38A9 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of SLC38A9 mRNA CTD PMID:37042841 Slc38a9 Rat tunicamycin increases expression ISO SLC38A9 (Homo sapiens) 6480464 Tunicamycin results in increased expression of SLC38A9 mRNA CTD PMID:29453283 Slc38a9 Rat valproic acid decreases expression ISO SLC38A9 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of SLC38A9 mRNA CTD PMID:23179753 Slc38a9 Rat valproic acid increases expression ISO SLC38A9 (Homo sapiens) 6480464 Valproic Acid results in increased expression of SLC38A9 mRNA CTD PMID:28001369
(-)-epigallocatechin 3-gallate (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 6-propyl-2-thiouracil (EXP) atrazine (ISO) benzo[b]fluoranthene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) clothianidin (ISO) copper(II) sulfate (ISO) dicrotophos (ISO) doxorubicin (ISO) ethyl methanesulfonate (ISO) gentamycin (EXP) lipopolysaccharide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methoxychlor (EXP) methyl methanesulfonate (ISO) paracetamol (ISO) PCB138 (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) pirinixic acid (ISO) potassium chromate (ISO) quercetin (ISO) Salinomycin (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sulfadimethoxine (EXP) sunitinib (ISO) thioacetamide (EXP) triphenyl phosphate (ISO) tunicamycin (ISO) valproic acid (ISO)
Slc38a9 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 46,024,731 - 46,102,419 (+) NCBI GRCr8 mRatBN7.2 2 44,291,637 - 44,374,897 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 44,291,989 - 44,368,955 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 51,417,505 - 51,482,408 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 49,475,942 - 49,540,776 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 44,349,547 - 44,416,361 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 44,512,556 - 44,592,793 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 44,512,895 - 44,592,053 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 63,554,196 - 63,634,429 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 44,044,770 - 44,110,884 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 43,961,910 - 44,040,250 (+) NCBI Celera 2 40,082,412 - 40,147,573 (+) NCBI Celera Cytogenetic Map 2 q14 NCBI
SLC38A9 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 55,625,845 - 55,712,335 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 55,625,845 - 55,773,194 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 54,921,673 - 55,008,163 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 54,957,435 - 55,043,852 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 5 51,875,777 - 51,961,881 (-) NCBI Celera Cytogenetic Map 5 q11.2 NCBI HuRef 5 51,895,210 - 51,981,393 (-) NCBI HuRef CHM1_1 5 54,925,864 - 55,012,366 (-) NCBI CHM1_1 T2T-CHM13v2.0 5 56,453,712 - 56,540,626 (-) NCBI T2T-CHM13v2.0
Slc38a9 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 112,792,723 - 112,875,286 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 112,797,285 - 112,875,283 (+) Ensembl GRCm39 Ensembl GRCm38 13 112,656,189 - 112,738,752 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 112,660,751 - 112,738,749 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 113,450,974 - 113,528,960 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 113,781,654 - 113,853,776 (+) NCBI MGSCv36 mm8 Celera 13 116,969,812 - 117,051,744 (+) NCBI Celera Cytogenetic Map 13 D2.2 NCBI cM Map 13 63.93 NCBI
Slc38a9 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955446 12,042,313 - 12,132,211 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955446 12,042,848 - 12,132,211 (+) NCBI ChiLan1.0 ChiLan1.0
SLC38A9 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 58,223,410 - 58,308,449 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 56,377,185 - 56,463,038 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 58,312,101 - 58,397,365 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 59,936,081 - 60,020,771 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 59,944,034 - 60,020,769 (+) Ensembl panpan1.1 panPan2
SLC38A9 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 42,921,906 - 43,004,265 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 42,922,494 - 42,991,577 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 39,968,649 - 40,050,988 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 43,387,804 - 43,470,243 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 43,387,807 - 43,470,208 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 40,465,898 - 40,548,267 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 41,267,439 - 41,349,747 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 42,088,670 - 42,171,039 (-) NCBI UU_Cfam_GSD_1.0
Slc38a9 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 203,167,196 - 203,262,973 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936480 12,103,693 - 12,195,358 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936480 12,103,697 - 12,198,592 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SLC38A9 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 16 34,768,987 - 34,858,747 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 16 34,639,575 - 34,858,827 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 16 36,889,795 - 36,974,298 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SLC38A9 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 4 51,876,430 - 51,961,914 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 4 51,876,268 - 51,948,012 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666049 752,110 - 837,809 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Slc38a9
.
Predicted Target Of
Count of predictions: 26 Count of miRNA genes: 23 Interacting mature miRNAs: 26 Transcripts: ENSRNOT00000013218 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10755430 Coatc6 Coat color QTL 6 0.02576 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 11591100 56591100 Rat 2293671 Bss44 Bone structure and strength QTL 44 10.97 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 2 43162366 148478373 Rat 7387318 Stl32 Serum triglyceride level QTL 32 3.2 0.0003 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 22384627 67384627 Rat 10755436 Coatc8 Coat color QTL 8 0.02431 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 35023117 80023117 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 10755434 Coatc7 Coat color QTL 7 0.04794 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 30648065 75648065 Rat 2293676 Bmd19 Bone mineral density QTL 19 10.7 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 2 43162366 111362592 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 2293682 Bmd24 Bone mineral density QTL 24 8.9 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 2 43162366 111362592 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300160 Hrtrt3 Heart rate QTL 3 3.62 heart pumping trait (VT:2000009) absolute change in heart rate (CMO:0000534) 2 29971593 51729300 Rat 731167 Glom4 Glomerulus QTL 4 2.4 0.0082 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 2 20304672 65304672 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 152025242 Bw191 Body weight QTL 191 3.62 body mass (VT:0001259) 2 38573329 122609194 Rat 738012 Anxrr3 Anxiety related response QTL 3 3.8 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 2 9023519 54023519 Rat 1302794 Stl27 Serum triglyceride level QTL 27 4.4 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 25413423 143657569 Rat 9685065 Swd6 Spike wave discharge measurement QTL 6 5.8 0.01 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge rate (CMO:0001739) 2 39223937 48793699 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 10402051 Gdil2 Gastrointestinal dilation QTL 2 enteric ganglion morphology trait (VT:0001045) length of intestine affected by colonic aganglionosis to total length of colon ratio (CMO:0001836) 2 24903853 74786777 Rat 9590095 Sffal3 Serum free fatty acids level QTL 3 6.78 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 2 27157160 72157160 Rat 70174 BpQTLCluster2 Blood pressure QTL cluster 2 4.24 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 2 40067944 102785628 Rat 1358901 Cm38 Cardiac mass QTL 38 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 631208 Bw1 Body weight QTL1 5.09 mesenteric fat pad mass (VT:0010427) mesenteric fat pad weight to body weight ratio (CMO:0000654) 2 43171017 83575226 Rat 1358899 Kidm23 Kidney mass QTL 23 3.88 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1643006 Pain1 Pain QTL 1 3.63 0.005 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 2 26999571 48268661 Rat 1358908 Bw49 Body weight QTL 49 3.36 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1300155 Bp174 Blood pressure QTL 174 4.09 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 2 42804607 60653831 Rat 2293835 Kiddil5 Kidney dilation QTL 5 3.8 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 157142209 Rat 1358910 Kidm27 Kidney mass QTL 27 5.77 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 61355 Bp36 Blood pressure QTL 36 2.9 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 2 5873687 102844969 Rat 2300168 Bmd47 Bone mineral density QTL 47 6.6 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 2 20662448 65662448 Rat 1358911 Kidm28 Kidney mass QTL 28 5.42 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358904 Cm39 Cardiac mass QTL 39 2.26 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1354617 Bp240 Blood pressure QTL 240 4 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 26917817 81754745 Rat 1578664 Bmd9 Bone mineral QTL density 9 5 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 2 11852062 49003364 Rat 2293843 Kiddil6 Kidney dilation QTL 6 3.1 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 182042367 Rat 1357990 Ael1 Aortic elastin QTL 1 3.1 0.00091 aorta elastin amount (VT:0003905) aortic elastin 2 19076825 64076825 Rat 1358887 Bw50 Body weight QTL 50 2.39 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 12879863 Bp402 Blood pressure QTL 402 0.003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 41125789 56532139 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 2290453 Scl55 Serum cholesterol level QTL 55 2.83 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 2 26917817 136917119 Rat 152025206 Hrtrt23 Heart rate QTL 23 5.98 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1358894 Kidm24 Kidney mass QTL 24 4.03 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 731184 Mamtr4 Mammary tumor resistance QTL 4 0.0003 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 2 16491740 61491740 Rat 152025204 Hrtrt22 Heart rate QTL 22 5.6 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 61371 Edpm1 Estrogen-dependent pituitary mass QTL 1 4 0.05 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 35134841 88029593 Rat 1354601 Slep1 Serum leptin concentration QTL 1 5.39 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 2 43171017 184114403 Rat 1354603 Bp243 Blood pressure QTL 243 3.9 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 26917817 127469484 Rat
D10S1272E
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 44,338,724 - 44,338,921 (+) MAPPER mRatBN7.2 Rnor_6.0 2 44,559,934 - 44,560,130 NCBI Rnor6.0 Rnor_5.0 2 63,601,570 - 63,601,766 UniSTS Rnor5.0 RGSC_v3.4 2 44,080,644 - 44,080,840 UniSTS RGSC3.4 Celera 2 40,118,267 - 40,118,463 UniSTS Cytogenetic Map 2 q14 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000013218 ⟹ ENSRNOP00000013218
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 44,291,989 - 44,368,955 (+) Ensembl Rnor_6.0 Ensembl 2 44,512,895 - 44,592,053 (+) Ensembl
RefSeq Acc Id:
NM_001035251 ⟹ NP_001030328
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 46,036,068 - 46,102,064 (+) NCBI mRatBN7.2 2 44,302,847 - 44,368,847 (+) NCBI Rnor_6.0 2 44,524,060 - 44,589,470 (+) NCBI Rnor_5.0 2 63,554,196 - 63,634,429 (+) NCBI RGSC_v3.4 2 44,044,770 - 44,110,884 (+) RGD Celera 2 40,082,412 - 40,147,573 (+) RGD
Sequence:
CTTCCCCAGTGCCTGGAATCTGAGAAAAAATGGCAAACGTGGATAGTGACTCTAGGCATCTTATCTCTGAGGTAGAACATGAAGTGAATCCCGGACCTATGAATATCCAGTTTGACTCCTCAGACCTA
hide sequence
RefSeq Acc Id:
XM_006231929 ⟹ XP_006231991
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 46,024,855 - 46,102,419 (+) NCBI mRatBN7.2 2 44,291,637 - 44,374,897 (+) NCBI Rnor_6.0 2 44,512,878 - 44,592,793 (+) NCBI Rnor_5.0 2 63,554,196 - 63,634,429 (+) NCBI
Sequence:
GCGCTTTCACAGAGGCGGCGGACTGTGTTCTCTTAGGACTCCATCCCCCACCATCCCCCGCGGC
hide sequence
RefSeq Acc Id:
XM_006231930 ⟹ XP_006231992
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 46,024,865 - 46,102,419 (+) NCBI mRatBN7.2 2 44,291,707 - 44,374,897 (+) NCBI Rnor_6.0 2 44,512,878 - 44,592,793 (+) NCBI Rnor_5.0 2 63,554,196 - 63,634,429 (+) NCBI
Sequence:
GCGCTTTCACAGAGGCGGCGGACTGTGTTCTCTTAGGACTCCATCCCCCACCATCCCCCGCGGC
hide sequence
RefSeq Acc Id:
XM_006231931 ⟹ XP_006231993
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 46,024,945 - 46,102,419 (+) NCBI mRatBN7.2 2 44,291,718 - 44,374,897 (+) NCBI Rnor_6.0 2 44,512,878 - 44,592,793 (+) NCBI Rnor_5.0 2 63,554,196 - 63,634,429 (+) NCBI
Sequence:
GCGCTTTCACAGAGGCGGCGGACTGTGTTCTCTTAGGACTCCATCCCCCACCATCCCCCGCGGCCTAAGCCGTTGCCTCTTCCTGTTTAGGGGACTATTCTCTAAGCCGCTGCCAACTGAGAGGTCTG
hide sequence
RefSeq Acc Id:
XM_006231932 ⟹ XP_006231994
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 46,025,115 - 46,102,419 (+) NCBI mRatBN7.2 2 44,291,895 - 44,374,897 (+) NCBI Rnor_6.0 2 44,513,048 - 44,592,793 (+) NCBI Rnor_5.0 2 63,554,196 - 63,634,429 (+) NCBI
Sequence:
GGTTTGGTCTGCTGAGGTAGACACTCTTTCGCTCCTGGCAAACTCACCCTGGGACAGTCCAAGA
hide sequence
RefSeq Acc Id:
XM_006231934 ⟹ XP_006231996
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 46,024,951 - 46,102,419 (+) NCBI mRatBN7.2 2 44,303,010 - 44,374,897 (+) NCBI Rnor_6.0 2 44,525,757 - 44,592,793 (+) NCBI Rnor_5.0 2 63,554,196 - 63,634,429 (+) NCBI
Sequence:
TTTTCTTCCAGAGGACATGGGTTTGATTCCTAGCACATACATACATGATAGCTCATAACCATGT
hide sequence
RefSeq Acc Id:
XM_006231936 ⟹ XP_006231998
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 46,024,951 - 46,102,419 (+) NCBI mRatBN7.2 2 44,303,010 - 44,374,897 (+) NCBI Rnor_6.0 2 44,525,757 - 44,592,793 (+) NCBI Rnor_5.0 2 63,554,196 - 63,634,429 (+) NCBI
Sequence:
TTTTCTTCCAGAGGACATGGGTTTGATTCCTAGCACATACATACATGATAGCTCATAACCATGTGTAATTCCAATCCCAGGAGATCTGACTCCTTCTGTCCTCCATCAGCAGTAGTCGTGCCCATGGT
hide sequence
RefSeq Acc Id:
XM_006231937 ⟹ XP_006231999
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 46,024,951 - 46,102,419 (+) NCBI mRatBN7.2 2 44,303,010 - 44,374,897 (+) NCBI Rnor_6.0 2 44,525,757 - 44,592,793 (+) NCBI Rnor_5.0 2 63,554,196 - 63,634,429 (+) NCBI
Sequence:
TTTTCTTCCAGAGGACATGGGTTTGATTCCTAGCACATACATACATGATAGCTCATAACCATGTGTAATTCCAATCCCAGGAGATCTGACTCCTTCTGTCCTCCATCAGCAGTAGTCGTGCCCATGGT
hide sequence
RefSeq Acc Id:
XM_006231939 ⟹ XP_006232001
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 46,024,951 - 46,102,419 (+) NCBI mRatBN7.2 2 44,303,010 - 44,374,897 (+) NCBI Rnor_6.0 2 44,525,757 - 44,592,793 (+) NCBI Rnor_5.0 2 63,554,196 - 63,634,429 (+) NCBI
Sequence:
TTTTCTTCCAGAGGACATGGGTTTGATTCCTAGCACATACATACATGATAGCTCATAACCATGTGTAATTCCAATCCCAGGAGATCTGACTCCTTCTGTCCTCCATCAGCAGTAGTCGTGCCCATGGT
hide sequence
RefSeq Acc Id:
XM_063281731 ⟹ XP_063137801
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 46,024,731 - 46,102,419 (+) NCBI
RefSeq Acc Id:
XM_063281732 ⟹ XP_063137802
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 46,024,951 - 46,102,419 (+) NCBI
RefSeq Acc Id:
XM_063281733 ⟹ XP_063137803
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 46,024,951 - 46,102,419 (+) NCBI
RefSeq Acc Id:
XM_063281734 ⟹ XP_063137804
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 46,024,951 - 46,102,419 (+) NCBI
RefSeq Acc Id:
XM_063281735 ⟹ XP_063137805
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 46,024,951 - 46,102,419 (+) NCBI
RefSeq Acc Id:
NP_001030328 ⟸ NM_001035251
- UniProtKB:
Q561Z8 (UniProtKB/Swiss-Prot), R9PXU2 (UniProtKB/Swiss-Prot), Q3B8Q3 (UniProtKB/Swiss-Prot), H9BFG3 (UniProtKB/TrEMBL), A6I5P6 (UniProtKB/TrEMBL)
- Sequence:
MANVDSDSRHLISEVEHEVNPGPMNIQFDSSDLRSKRPFYIEPTNIVNVNDVIQKVSDHAAAMNKRIHYYSRLTTPADKALIAPDHVVPAPEECYVYSPLGSAYKLKSYTEGYRKNTSLVTIFMIWNT
hide sequence
RefSeq Acc Id:
XP_006231993 ⟸ XM_006231931
- Peptide Label:
isoform X1
- UniProtKB:
Q561Z8 (UniProtKB/Swiss-Prot), R9PXU2 (UniProtKB/Swiss-Prot), Q3B8Q3 (UniProtKB/Swiss-Prot), H9BFG3 (UniProtKB/TrEMBL), A6I5P6 (UniProtKB/TrEMBL)
- Sequence:
MANVDSDSRHLISEVEHEVNPGPMNIQFDSSDLRSKRPFYIEPTNIVNVNDVIQKVSDHAAAMN
hide sequence
RefSeq Acc Id:
XP_006231992 ⟸ XM_006231930
- Peptide Label:
isoform X1
- UniProtKB:
Q561Z8 (UniProtKB/Swiss-Prot), R9PXU2 (UniProtKB/Swiss-Prot), Q3B8Q3 (UniProtKB/Swiss-Prot), H9BFG3 (UniProtKB/TrEMBL), A6I5P6 (UniProtKB/TrEMBL)
- Sequence:
MANVDSDSRHLISEVEHEVNPGPMNIQFDSSDLRSKRPFYIEPTNIVNVNDVIQKVSDHAAAMNKRIHYYSRLTTPADKALIAPDHVVPAPEECYVYSPLGSAYKLKSYTEGYRKNTSLVTIFMIWNT
hide sequence
RefSeq Acc Id:
XP_006231991 ⟸ XM_006231929
- Peptide Label:
isoform X1
- UniProtKB:
Q561Z8 (UniProtKB/Swiss-Prot), R9PXU2 (UniProtKB/Swiss-Prot), Q3B8Q3 (UniProtKB/Swiss-Prot), H9BFG3 (UniProtKB/TrEMBL), A6I5P6 (UniProtKB/TrEMBL)
- Sequence:
MANVDSDSRHLISEVEHEVNPGPMNIQFDSSDLRSKRPFYIEPTNIVNVNDVIQKVSDHAAAMN
hide sequence
RefSeq Acc Id:
XP_006231994 ⟸ XM_006231932
- Peptide Label:
isoform X1
- UniProtKB:
Q561Z8 (UniProtKB/Swiss-Prot), R9PXU2 (UniProtKB/Swiss-Prot), Q3B8Q3 (UniProtKB/Swiss-Prot), H9BFG3 (UniProtKB/TrEMBL), A6I5P6 (UniProtKB/TrEMBL)
- Sequence:
MANVDSDSRHLISEVEHEVNPGPMNIQFDSSDLRSKRPFYIEPTNIVNVNDVIQKVSDHAAAMNKRIHYYSRLTTPADKALIAPDHVVPAPEECYVYSPLGSAYKLKSYTEGYRKNTSLVTIFMIWNT
hide sequence
RefSeq Acc Id:
XP_006231998 ⟸ XM_006231936
- Peptide Label:
isoform X3
- UniProtKB:
A6I5P7 (UniProtKB/TrEMBL)
- Sequence:
MNKRIHYYSRLTTPADKALIAPDHVVPAPEECYVYSPLGSAYKLKSYTEGYRKNTSLVTIFMIW
hide sequence
RefSeq Acc Id:
XP_006232001 ⟸ XM_006231939
- Peptide Label:
isoform X3
- UniProtKB:
A6I5P7 (UniProtKB/TrEMBL)
- Sequence:
MNKRIHYYSRLTTPADKALIAPDHVVPAPEECYVYSPLGSAYKLKSYTEGYRKNTSLVTIFMIW
hide sequence
RefSeq Acc Id:
XP_006231999 ⟸ XM_006231937
- Peptide Label:
isoform X3
- UniProtKB:
A6I5P7 (UniProtKB/TrEMBL)
- Sequence:
MNKRIHYYSRLTTPADKALIAPDHVVPAPEECYVYSPLGSAYKLKSYTEGYRKNTSLVTIFMIW
hide sequence
RefSeq Acc Id:
XP_006231996 ⟸ XM_006231934
- Peptide Label:
isoform X2
- UniProtKB:
A6I5P7 (UniProtKB/TrEMBL)
- Sequence:
MRKNMPFYIEPTNIVNVNDVIQKVSDHAAAMNKRIHYYSRLTTPADKALIAPDHVVPAPEECYV
hide sequence
Ensembl Acc Id:
ENSRNOP00000013218 ⟸ ENSRNOT00000013218
RefSeq Acc Id:
XP_063137801 ⟸ XM_063281731
- Peptide Label:
isoform X1
- UniProtKB:
R9PXU2 (UniProtKB/Swiss-Prot), Q561Z8 (UniProtKB/Swiss-Prot), Q3B8Q3 (UniProtKB/Swiss-Prot), A6I5P6 (UniProtKB/TrEMBL), H9BFG3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063137802 ⟸ XM_063281732
- Peptide Label:
isoform X3
- UniProtKB:
A6I5P7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063137803 ⟸ XM_063281733
- Peptide Label:
isoform X3
- UniProtKB:
A6I5P7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063137805 ⟸ XM_063281735
- Peptide Label:
isoform X3
- UniProtKB:
A6I5P7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063137804 ⟸ XM_063281734
- Peptide Label:
isoform X3
- UniProtKB:
A6I5P7 (UniProtKB/TrEMBL)
RGD ID: 13691136 Promoter ID: EPDNEW_R1661 Type: initiation region Name: Slc38a9_1 Description: solute carrier family 38, member 9 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 44,512,974 - 44,513,034 EPDNEW
BioCyc Gene G2FUF-54392 BioCyc
Ensembl Genes ENSRNOG00000009851 Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript ENSRNOT00000013218 ENTREZGENE
ENSRNOT00000013218.7 UniProtKB/Swiss-Prot
ENSRNOT00000132035 ENTREZGENE
IMAGE_CLONE IMAGE:7365694 IMAGE-MGC_LOAD
IMAGE:7442690 IMAGE-MGC_LOAD
InterPro AA_transpt_TM UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report rno:310091 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE MGC:109589 IMAGE-MGC_LOAD
MGC:125012 IMAGE-MGC_LOAD
NCBI Gene 310091 ENTREZGENE
PANTHER AMINO ACID TRANSPORTER UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SODIUM-COUPLED NEUTRAL AMINO ACID TRANSPORTER 9 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam Aa_trans UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen Slc38a9 PhenoGen
RatGTEx ENSRNOG00000009851 RatGTEx
UniProt A6I5P6 ENTREZGENE, UniProtKB/TrEMBL
A6I5P7 ENTREZGENE, UniProtKB/TrEMBL
H9BFG3 ENTREZGENE, UniProtKB/TrEMBL
Q3B8Q3 ENTREZGENE
Q561Z8 ENTREZGENE
R9PXU2 ENTREZGENE
S38A9_RAT UniProtKB/Swiss-Prot
UniProt Secondary Q561Z8 UniProtKB/Swiss-Prot
R9PXU2 UniProtKB/Swiss-Prot
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-11
Slc38a9
solute carrier family 38, member 9
RGD1311881
similar to hypothetical protein FLJ90709
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
RGD1311881
similar to hypothetical protein FLJ90709
RGD1311881_predicted
similar to hypothetical protein FLJ90709 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-20
RGD1311881_predicted
similar to hypothetical protein FLJ90709 (predicted)
LOC310091_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC310091_predicted
similar to hypothetical protein FLJ90709 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
