Symbol:
Itk
Name:
IL2-inducible T-cell kinase
RGD ID:
1311618
Description:
Predicted to enable non-membrane spanning protein tyrosine kinase activity. Predicted to be involved in several processes, including T cell activation; antigen receptor-mediated signaling pathway; and protein phosphorylation. Predicted to be located in cell-cell junction; cytosol; and nucleus. Predicted to be active in plasma membrane. Human ortholog(s) of this gene implicated in lymphoproliferative syndrome 1. Orthologous to human ITK (IL2 inducible T cell kinase); PARTICIPATES IN phosphatidylinositol 3-kinase class I signaling pathway; chemokine mediated signaling pathway; T cell receptor signaling pathway; INTERACTS WITH 1,2-dimethylhydrazine; 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC363577; tyrosine-protein kinase ITK/TSK
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 31,254,667 - 31,316,004 (-) NCBI GRCr8 mRatBN7.2 10 30,753,344 - 30,814,685 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 30,753,344 - 30,814,685 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 35,480,495 - 35,541,820 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 4,018,954 - 4,080,268 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 30,455,134 - 30,516,447 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 31,431,820 - 31,493,413 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 31,431,809 - 31,493,419 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 31,248,181 - 31,308,814 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 31,455,982 - 31,518,075 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 31,457,025 - 31,519,124 (-) NCBI Celera 10 30,205,244 - 30,266,599 (-) NCBI Celera Cytogenetic Map 10 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Itk Rat (1->4)-beta-D-glucan multiple interactions ISO Itk (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ITK mRNA CTD PMID:36331819 Itk Rat 1,2-dichloroethane decreases expression ISO Itk (Mus musculus) 6480464 ethylene dichloride results in decreased expression of ITK mRNA CTD PMID:28960355 Itk Rat 1,2-dimethylhydrazine multiple interactions EXP 6480464 [APC protein affects the susceptibility to 1 and 2-Dimethylhydrazine] which results in increased expression of ITK mRNA CTD PMID:27840820 Itk Rat 1,2-dimethylhydrazine increases expression ISO Itk (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of ITK mRNA CTD PMID:22206623 Itk Rat 1-naphthyl isothiocyanate decreases expression EXP 6480464 1-Naphthylisothiocyanate results in decreased expression of ITK mRNA CTD PMID:30723492 Itk Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Itk (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ITK mRNA CTD PMID:26377647 Itk Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ITK mRNA CTD PMID:33387578 Itk Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Itk (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Itk Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of ITK mRNA CTD PMID:24780913 Itk Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of ITK mRNA CTD PMID:31881176 Itk Rat acetohydrazide decreases expression ISO Itk (Mus musculus) 6480464 acetylhydrazine results in decreased expression of ITK mRNA CTD PMID:15282401 Itk Rat alpha-Zearalanol increases expression EXP 6480464 Zeranol results in increased expression of ITK mRNA CTD PMID:35163327 Itk Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of ITK mRNA CTD PMID:30779732 Itk Rat antirheumatic drug decreases expression ISO ITK (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of ITK mRNA CTD PMID:24449571 Itk Rat aristolochic acid A increases expression ISO ITK (Homo sapiens) 6480464 aristolochic acid I results in increased expression of ITK mRNA CTD PMID:33212167 Itk Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of ITK mRNA CTD PMID:21839799 Itk Rat benzo[a]pyrene increases methylation ISO ITK (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of ITK promoter CTD PMID:27901495 Itk Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of ITK protein CTD PMID:21467743 Itk Rat benzo[a]pyrene decreases expression ISO ITK (Homo sapiens) 6480464 Benzo(a)pyrene metabolite results in decreased expression of ITK mRNA and Benzo(a)pyrene results in decreased expression of ITK mRNA CTD PMID:22316170 and PMID:26314263 Itk Rat bisphenol A increases expression ISO ITK (Homo sapiens) 6480464 bisphenol A results in increased expression of ITK mRNA CTD PMID:33476716 Itk Rat bisphenol A increases expression ISO Itk (Mus musculus) 6480464 bisphenol A results in increased expression of ITK mRNA CTD PMID:38701888 Itk Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of ITK gene CTD PMID:28505145 Itk Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ITK mRNA CTD PMID:25181051 Itk Rat buta-1,3-diene decreases expression ISO Itk (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of ITK mRNA CTD PMID:29038090 Itk Rat carbon nanotube decreases expression ISO Itk (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Itk Rat chloroprene decreases expression ISO Itk (Mus musculus) 6480464 Chloroprene results in decreased expression of ITK mRNA CTD PMID:23125180 Itk Rat chlorpyrifos increases expression ISO Itk (Mus musculus) 6480464 Chlorpyrifos results in increased expression of ITK mRNA CTD PMID:34289071 Itk Rat cobalt dichloride increases expression ISO ITK (Homo sapiens) 6480464 cobaltous chloride results in increased expression of ITK mRNA CTD PMID:26314263 Itk Rat cyclophosphamide decreases expression ISO Itk (Mus musculus) 6480464 Cyclophosphamide results in decreased expression of ITK mRNA CTD PMID:21041162 Itk Rat dexamethasone decreases expression ISO Itk (Mus musculus) 6480464 Dexamethasone results in decreased expression of ITK mRNA CTD PMID:21041162 Itk Rat Dibutyl phosphate affects expression ISO ITK (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of ITK mRNA CTD PMID:37042841 Itk Rat diethylstilbestrol decreases expression ISO Itk (Mus musculus) 6480464 Diethylstilbestrol results in decreased expression of ITK mRNA CTD PMID:21041162 Itk Rat disodium selenite decreases expression ISO ITK (Homo sapiens) 6480464 Sodium Selenite results in decreased expression of ITK mRNA CTD PMID:18175754 Itk Rat diuron decreases expression ISO ITK (Homo sapiens) 6480464 Diuron results in decreased expression of ITK mRNA CTD PMID:35967413 Itk Rat furan increases expression EXP 6480464 furan results in increased expression of ITK mRNA CTD PMID:27387713 Itk Rat hydrazine decreases expression ISO Itk (Mus musculus) 6480464 hydrazine results in decreased expression of ITK mRNA CTD PMID:15282401 Itk Rat hydroxychloroquine multiple interactions ISO ITK (Homo sapiens) 6480464 [Hydroxychloroquine co-treated with Methotrexate co-treated with Sulfasalazine] results in decreased expression of ITK mRNA CTD PMID:28863153 Itk Rat isoprenaline decreases expression ISO Itk (Mus musculus) 6480464 Isoproterenol results in decreased expression of ITK mRNA CTD PMID:20003209 Itk Rat methapyrilene increases methylation EXP 6480464 Methapyrilene results in increased methylation of ITK gene CTD PMID:26431795 Itk Rat methotrexate multiple interactions ISO ITK (Homo sapiens) 6480464 [Hydroxychloroquine co-treated with Methotrexate co-treated with Sulfasalazine] results in decreased expression of ITK mRNA CTD PMID:28863153 Itk Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of ITK gene CTD PMID:33148267 Itk Rat nickel atom increases expression ISO ITK (Homo sapiens) 6480464 Nickel results in increased expression of ITK mRNA CTD PMID:25583101 Itk Rat ochratoxin A decreases expression ISO ITK (Homo sapiens) 6480464 ochratoxin A metabolite results in decreased expression of ITK mRNA and ochratoxin A results in decreased expression of ITK mRNA CTD PMID:26314263 Itk Rat ozone multiple interactions ISO Itk (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of ITK mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of ITK mRNA CTD PMID:34911549 Itk Rat paracetamol affects expression ISO Itk (Mus musculus) 6480464 Acetaminophen affects the expression of ITK mRNA CTD PMID:17562736 Itk Rat paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of ITK mRNA CTD PMID:33387578 Itk Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Itk (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ITK mRNA CTD PMID:36331819 Itk Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of ITK gene CTD PMID:33148267 Itk Rat pirinixic acid increases expression ISO Itk (Mus musculus) 6480464 pirinixic acid results in increased expression of ITK mRNA CTD PMID:23811191 Itk Rat silicon dioxide increases expression ISO Itk (Mus musculus) 6480464 Silicon Dioxide results in increased expression of ITK mRNA CTD PMID:29341224 Itk Rat sulfasalazine multiple interactions ISO ITK (Homo sapiens) 6480464 [Hydroxychloroquine co-treated with Methotrexate co-treated with Sulfasalazine] results in decreased expression of ITK mRNA CTD PMID:28863153 Itk Rat temozolomide decreases expression ISO ITK (Homo sapiens) 6480464 Temozolomide results in decreased expression of ITK mRNA CTD PMID:31758290 Itk Rat testosterone decreases expression ISO ITK (Homo sapiens) 6480464 Testosterone results in decreased expression of ITK mRNA CTD PMID:33359661 Itk Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of ITK mRNA CTD PMID:34492290 Itk Rat titanium dioxide decreases expression ISO Itk (Mus musculus) 6480464 titanium dioxide results in decreased expression of ITK mRNA CTD PMID:23557971 Itk Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of ITK mRNA CTD PMID:33387578 Itk Rat triclosan increases expression ISO ITK (Homo sapiens) 6480464 Triclosan results in increased expression of ITK mRNA CTD PMID:30510588 Itk Rat triphenyl phosphate affects expression ISO ITK (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ITK mRNA CTD PMID:37042841 Itk Rat valproic acid decreases methylation ISO ITK (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of ITK gene CTD PMID:29154799
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(1->4)-beta-D-glucan (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (EXP,ISO) 1-naphthyl isothiocyanate (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acetohydrazide (ISO) alpha-Zearalanol (EXP) amphetamine (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) benzo[a]pyrene (EXP,ISO) bisphenol A (EXP,ISO) buta-1,3-diene (ISO) carbon nanotube (ISO) chloroprene (ISO) chlorpyrifos (ISO) cobalt dichloride (ISO) cyclophosphamide (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) diethylstilbestrol (ISO) disodium selenite (ISO) diuron (ISO) furan (EXP) hydrazine (ISO) hydroxychloroquine (ISO) isoprenaline (ISO) methapyrilene (EXP) methotrexate (ISO) N,N-diethyl-m-toluamide (EXP) nickel atom (ISO) ochratoxin A (ISO) ozone (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) permethrin (EXP) pirinixic acid (ISO) silicon dioxide (ISO) sulfasalazine (ISO) temozolomide (ISO) testosterone (ISO) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (EXP) triclosan (ISO) triphenyl phosphate (ISO) valproic acid (ISO)
Itk Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 31,254,667 - 31,316,004 (-) NCBI GRCr8 mRatBN7.2 10 30,753,344 - 30,814,685 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 30,753,344 - 30,814,685 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 35,480,495 - 35,541,820 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 4,018,954 - 4,080,268 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 30,455,134 - 30,516,447 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 31,431,820 - 31,493,413 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 31,431,809 - 31,493,419 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 31,248,181 - 31,308,814 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 31,455,982 - 31,518,075 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 31,457,025 - 31,519,124 (-) NCBI Celera 10 30,205,244 - 30,266,599 (-) NCBI Celera Cytogenetic Map 10 q21 NCBI
ITK Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 157,180,840 - 157,255,185 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 157,142,933 - 157,255,185 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 156,607,851 - 156,682,195 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 156,540,485 - 156,614,687 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 156,540,484 - 156,614,687 NCBI Celera 5 152,634,440 - 152,708,658 (+) NCBI Celera Cytogenetic Map 5 q33.3 NCBI HuRef 5 151,695,940 - 151,769,767 (+) NCBI HuRef CHM1_1 5 156,040,619 - 156,114,765 (+) NCBI CHM1_1 T2T-CHM13v2.0 5 157,699,782 - 157,774,113 (+) NCBI T2T-CHM13v2.0
Itk Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 46,215,975 - 46,280,342 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 46,215,977 - 46,280,342 (-) Ensembl GRCm39 Ensembl GRCm38 11 46,325,148 - 46,389,515 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 46,325,150 - 46,389,515 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 46,138,652 - 46,203,017 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 46,168,576 - 46,232,923 (-) NCBI MGSCv36 mm8 Celera 11 50,911,124 - 50,975,428 (-) NCBI Celera Cytogenetic Map 11 B1.1 NCBI cM Map 11 27.75 NCBI
Itk Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955408 11,387,589 - 11,448,199 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955408 11,387,595 - 11,447,896 (+) NCBI ChiLan1.0 ChiLan1.0
ITK Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 152,364,876 - 152,450,621 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 150,504,423 - 150,590,168 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 152,582,125 - 152,656,211 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 159,204,016 - 159,277,689 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 159,204,016 - 159,277,689 (+) Ensembl panpan1.1 panPan2
ITK Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 4 52,902,886 - 52,966,465 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 4 52,902,871 - 52,966,542 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 4 52,795,128 - 52,858,373 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 4 53,339,439 - 53,402,778 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 4 53,340,020 - 53,402,842 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 4 53,165,818 - 53,229,419 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 4 53,272,737 - 53,336,070 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 4 53,789,682 - 53,852,963 (-) NCBI UU_Cfam_GSD_1.0
Itk Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 107,441,822 - 107,503,029 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936515 5,891,828 - 5,952,458 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936515 5,891,873 - 5,952,400 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ITK Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 16 66,010,772 - 66,082,185 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 16 66,010,766 - 66,082,263 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 16 71,884,821 - 71,940,522 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ITK Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 23 59,575,113 - 59,650,166 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 23 59,575,179 - 59,650,559 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666034 17,980,495 - 18,055,594 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Itk
.
Predicted Target Of
Count of predictions: 668 Count of miRNA genes: 298 Interacting mature miRNAs: 371 Transcripts: ENSRNOT00000009211 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 631564 Apr3 Acute phase response QTL 3 3.9 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 10 15275955 60275955 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1578761 Stresp21 Stress response QTL 21 3.3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 6375746 51375746 Rat 2293680 Bss40 Bone structure and strength QTL 40 5.66 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 10 1 35225947 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 10401803 Kidm50 Kidney mass QTL 50 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 10 418344 45418344 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 1581497 Esta1 Estrogen-induced thymic atrophy QTL 1 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 21329805 61345413 Rat 2313095 Bss62 Bone structure and strength QTL 62 1.5 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 1331762 Rf40 Renal function QTL 40 3.873 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 10 29299504 64155584 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 2313104 Bss61 Bone structure and strength QTL 61 0.9 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 6893352 Bw100 Body weight QTL 100 0.33 0.6 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 2313066 Bss63 Bone structure and strength QTL 63 1.4 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 10 5387014 50387014 Rat 2313064 Bmd71 Bone mineral density QTL 71 0.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 10 5387014 50387014 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 1354587 Kidm21 Kidney mass QTL 21 3.3 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 10 15028513 60430477 Rat 6893350 Bw99 Body weight QTL 99 0.87 0.16 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 70224 Eae3 Experimental allergic encephalomyelitis QTL 3 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 26521957 61345413 Rat 2298480 Eau7 Experimental allergic uveoretinitis QTL 7 0.0049 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 10 27957626 34490668 Rat 2313081 Bss64 Bone structure and strength QTL 64 1.3 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 10 5387014 50387014 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 634327 Hc4 Hypercalciuria QTL 4 2.4 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 10 1 38328221 Rat 631531 Iresp2 Immunoglobin response QTL2 6.3 blood immunoglobulin E amount (VT:0002492) serum immunoglobulin E level (CMO:0002101) 10 22918268 36400810 Rat 631532 Cm50 Cardiac mass QTL 50 6.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 17907113 51786432 Rat 7411611 Foco17 Food consumption QTL 17 18.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 1 42315980 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1600371 Mcs21 Mammary carcinoma susceptibility QTL 21 3 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 28875650 52200160 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat
AU047252
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 10 31,262,708 - 31,262,834 (+) Marker Load Pipeline mRatBN7.2 10 30,761,387 - 30,761,513 (+) MAPPER mRatBN7.2 Rnor_6.0 10 31,439,869 - 31,439,994 NCBI Rnor6.0 Rnor_5.0 10 31,256,228 - 31,256,353 UniSTS Rnor5.0 RGSC_v3.4 10 31,464,024 - 31,464,149 UniSTS RGSC3.4 Celera 10 30,213,284 - 30,213,409 UniSTS Cytogenetic Map 10 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
8
29
89
83
82
51
25
51
6
187
74
69
45
58
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000009211 ⟹ ENSRNOP00000009211
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 30,753,344 - 30,814,685 (-) Ensembl Rnor_6.0 Ensembl 10 31,431,809 - 31,493,419 (-) Ensembl
RefSeq Acc Id:
NM_001108825 ⟹ NP_001102295
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 31,254,667 - 31,316,004 (-) NCBI mRatBN7.2 10 30,753,344 - 30,814,685 (-) NCBI Rnor_6.0 10 31,431,827 - 31,493,357 (-) NCBI Rnor_5.0 10 31,248,181 - 31,308,814 (-) NCBI RGSC_v3.4 10 31,455,982 - 31,518,075 (-) RGD Celera 10 30,205,244 - 30,266,599 (-) RGD
Sequence:
AACTGCATCCTGTCGCGTTCCCAGCCGTTCCTCTCCTTCAGTCGAACTCAGGGGTGATGCCCGAGGCGCCTCACCTTTCAGAACTGGACCATGAACAACTTCATCCTCCTGGAAGAACAGCTGATCAA
hide sequence
RefSeq Acc Id:
NP_001102295 ⟸ NM_001108825
- UniProtKB:
A6HDR3 (UniProtKB/TrEMBL), D4A7W7 (UniProtKB/TrEMBL)
- Sequence:
MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRHGKKRTLKGSIELSRIKCVEIVKSDISIPCHYKYPFQTLTSFQVMHDNYLLYVFAPDCESRQRWVLTLKEETRNNNSLVSKYHP
hide sequence
Ensembl Acc Id:
ENSRNOP00000009211 ⟸ ENSRNOT00000009211
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Itk
IL2-inducible T-cell kinase
Itk_predicted
IL2-inducible T-cell kinase (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Itk_predicted
IL2-inducible T-cell kinase (predicted)
Symbol and Name status set to approved
70820 APPROVED
