Advanced Search (OLGA)

Gene: Mzb1 (marginal zone B and B1 cell-specific protein) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Mzb1

Name:

marginal zone B and B1 cell-specific protein

RGD ID:

1310251

Description:

Predicted to be involved in several processes, including integrin activation; positive regulation of immunoglobulin production; and regulation of B cell proliferation. Predicted to be located in endoplasmic reticulum lumen. Predicted to be part of endoplasmic reticulum chaperone complex. Predicted to be active in extracellular region. Orthologous to human MZB1 (marginal zone B and B1 cell specific protein); INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; alpha-Zearalanol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC291675; marginal zone B- and B1-cell-specific protein; MGC112758; PACAP; pERp1; plasma cell-induced resident endoplasmic reticulum protein; plasma cell-induced resident ER protein; proapoptotic caspase adapter protein; RGD1310251; similar to RIKEN cDNA 2010001M09

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	27,513,087 - 27,515,148 (-)	NCBI		GRCr8
mRatBN7.2	18	27,238,999 - 27,241,060 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	27,239,001 - 27,241,094 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	27,366,417 - 27,368,478 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	28,128,528 - 28,130,589 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	27,463,414 - 27,465,475 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	28,436,546 - 28,438,607 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	28,436,548 - 28,438,654 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	28,149,656 - 28,151,717 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	28,261,741 - 28,263,802 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	28,288,388 - 28,290,448 (-)	NCBI
Celera	18	26,972,541 - 26,974,602 (-)	NCBI		Celera
Cytogenetic Map	18	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mzb1	Rat	COVID-19		ISO	MZB1 (Homo sapiens)	9068941	mRNA:increased expression:peripheral blood mononuclear cell (human)	RGD	PMID:32228226 and REF_RGD_ID:28912744

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mzb1	Rat	autosomal dominant intellectual developmental disorder 31		ISO	MZB1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: NEURODEVELOPMENTAL DISORDER WITH NEONATAL RESPIRATORY INSUFFICIENCY more ...	ClinVar	PMID:28492532
Mzb1	Rat	familial adenomatous polyposis 1		ISO	MZB1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Familial adenomatous polyposis 1	ClinVar	PMID:17963004 more ...
Mzb1	Rat	Hereditary Neoplastic Syndromes		ISO	MZB1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hereditary cancer-predisposing syndrome	ClinVar	PMID:17963004 more ...
Mzb1	Rat	Neurodevelopmental Disorders		ISO	MZB1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868
Mzb1	Rat	STING-associated vasculopathy with onset in infancy		ISO	MZB1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: STING-associated vasculopathy with onset in infancy	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mzb1	Rat	(-)-demecolcine	decreases expression	ISO	MZB1 (Homo sapiens)	6480464	Demecolcine results in decreased expression of MZB1 mRNA	CTD	PMID:23649840
Mzb1	Rat	17beta-estradiol	multiple interactions	EXP		6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of MZB1 mRNA	CTD	PMID:32741896
Mzb1	Rat	17beta-estradiol 3-benzoate	multiple interactions	EXP		6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of MZB1 mRNA	CTD	PMID:32741896
Mzb1	Rat	2,4-dibromophenyl 2,4,5-tribromophenyl ether	affects expression	ISO	Mzb1 (Mus musculus)	6480464	2 more ...	CTD	PMID:38648751
Mzb1	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	Mzb1 (Mus musculus)	6480464	bisphenol S results in decreased expression of MZB1 mRNA	CTD	PMID:39298647
Mzb1	Rat	alpha-Zearalanol	increases expression	EXP		6480464	Zeranol results in increased expression of MZB1 mRNA	CTD	PMID:35163327
Mzb1	Rat	benzo[a]pyrene	decreases methylation	ISO	MZB1 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of MZB1 promoter	CTD	PMID:27901495
Mzb1	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	MZB1 (Homo sapiens)	6480464	Diethylhexyl Phthalate results in decreased expression of MZB1 mRNA	CTD	PMID:31163220
Mzb1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of MZB1 mRNA	CTD	PMID:25181051
Mzb1	Rat	bisphenol A	increases expression	ISO	Mzb1 (Mus musculus)	6480464	bisphenol A results in increased expression of MZB1 mRNA	CTD	PMID:32156529
Mzb1	Rat	bisphenol A	decreases methylation	ISO	MZB1 (Homo sapiens)	6480464	bisphenol A results in decreased methylation of MZB1 gene	CTD	PMID:31601247
Mzb1	Rat	buta-1,3-diene	decreases expression	ISO	Mzb1 (Mus musculus)	6480464	1 and 3-butadiene results in decreased expression of MZB1 mRNA	CTD	PMID:29038090
Mzb1	Rat	carbon nanotube	affects expression	ISO	Mzb1 (Mus musculus)	6480464	Nanotubes and Carbon affects the expression of MZB1 mRNA	CTD	PMID:25554681
Mzb1	Rat	carbon nanotube	decreases expression	ISO	Mzb1 (Mus musculus)	6480464	Nanotubes and Carbon analog results in decreased expression of MZB1 mRNA	CTD	PMID:25554681
Mzb1	Rat	chlordecone	increases expression	ISO	Mzb1 (Mus musculus)	6480464	Chlordecone results in increased expression of MZB1 mRNA	CTD	PMID:33711761
Mzb1	Rat	chloroprene	decreases expression	ISO	Mzb1 (Mus musculus)	6480464	Chloroprene results in decreased expression of MZB1 mRNA	CTD	PMID:23125180
Mzb1	Rat	cisplatin	decreases expression	ISO	MZB1 (Homo sapiens)	6480464	Cisplatin results in decreased expression of MZB1 mRNA	CTD	PMID:27594783
Mzb1	Rat	dextran sulfate	multiple interactions	ISO	Mzb1 (Mus musculus)	6480464	evodiamine inhibits the reaction [Dextran Sulfate results in decreased expression of MZB1 protein]	CTD	PMID:35362542
Mzb1	Rat	dextran sulfate	decreases expression	ISO	Mzb1 (Mus musculus)	6480464	Dextran Sulfate results in decreased expression of MZB1 protein	CTD	PMID:35362542
Mzb1	Rat	dimethylarsinic acid	multiple interactions	ISO	Mzb1 (Mus musculus)	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of MZB1 mRNA	CTD	PMID:34876320
Mzb1	Rat	dioxygen	multiple interactions	ISO	Mzb1 (Mus musculus)	6480464	[NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of MZB1 mRNA	CTD	PMID:30529165
Mzb1	Rat	ethyl methanesulfonate	decreases expression	ISO	MZB1 (Homo sapiens)	6480464	Ethyl Methanesulfonate results in decreased expression of MZB1 mRNA	CTD	PMID:23649840
Mzb1	Rat	Evodiamine	multiple interactions	ISO	Mzb1 (Mus musculus)	6480464	evodiamine inhibits the reaction [Dextran Sulfate results in decreased expression of MZB1 protein]	CTD	PMID:35362542
Mzb1	Rat	formaldehyde	decreases expression	ISO	MZB1 (Homo sapiens)	6480464	Formaldehyde results in decreased expression of MZB1 mRNA	CTD	PMID:23649840
Mzb1	Rat	genistein	increases expression	ISO	Mzb1 (Mus musculus)	6480464	Genistein results in increased expression of MZB1 mRNA	CTD	PMID:32186404
Mzb1	Rat	methyl methanesulfonate	decreases expression	ISO	MZB1 (Homo sapiens)	6480464	Methyl Methanesulfonate results in decreased expression of MZB1 mRNA	CTD	PMID:23649840
Mzb1	Rat	methylarsonic acid	multiple interactions	ISO	Mzb1 (Mus musculus)	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of MZB1 mRNA	CTD	PMID:34876320
Mzb1	Rat	nitrates	multiple interactions	ISO	Mzb1 (Mus musculus)	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of MZB1 mRNA	CTD	PMID:35964746
Mzb1	Rat	paraquat	decreases expression	EXP		6480464	Paraquat results in decreased expression of MZB1 mRNA	CTD	PMID:32680482
Mzb1	Rat	perfluorononanoic acid	decreases expression	ISO	MZB1 (Homo sapiens)	6480464	perfluoro-n-nonanoic acid results in decreased expression of MZB1 mRNA	CTD	PMID:25812627
Mzb1	Rat	perfluorooctane-1-sulfonic acid	decreases expression	ISO	MZB1 (Homo sapiens)	6480464	perfluorooctane sulfonic acid results in decreased expression of MZB1 mRNA	CTD	PMID:25812627
Mzb1	Rat	perfluorooctanoic acid	decreases expression	ISO	MZB1 (Homo sapiens)	6480464	perfluorooctanoic acid results in decreased expression of MZB1 mRNA	CTD	PMID:25812627
Mzb1	Rat	pioglitazone	multiple interactions	ISO	Mzb1 (Mus musculus)	6480464	[N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of MZB1 mRNA	CTD	PMID:27935865
Mzb1	Rat	silicon dioxide	decreases expression	ISO	MZB1 (Homo sapiens)	6480464	Silicon Dioxide analog results in decreased expression of MZB1 mRNA	CTD	PMID:25895662
Mzb1	Rat	silicon dioxide	increases expression	ISO	Mzb1 (Mus musculus)	6480464	Silicon Dioxide results in increased expression of MZB1 mRNA	CTD	PMID:29341224
Mzb1	Rat	sodium arsenate	multiple interactions	ISO	Mzb1 (Mus musculus)	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of MZB1 mRNA	CTD	PMID:34876320
Mzb1	Rat	sodium arsenite	multiple interactions	ISO	Mzb1 (Mus musculus)	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of MZB1 mRNA	CTD	PMID:34876320
Mzb1	Rat	testosterone	multiple interactions	EXP		6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of MZB1 mRNA	CTD	PMID:32741896
Mzb1	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of MZB1 mRNA	CTD	PMID:34492290
Mzb1	Rat	titanium dioxide	increases expression	ISO	Mzb1 (Mus musculus)	6480464	titanium dioxide results in increased expression of MZB1 mRNA	CTD	PMID:23557971 and PMID:35295148
Mzb1	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of MZB1 mRNA	CTD	PMID:33387578
Mzb1	Rat	triclosan	decreases expression	ISO	MZB1 (Homo sapiens)	6480464	Triclosan results in decreased expression of MZB1 mRNA	CTD	PMID:30510588
Mzb1	Rat	triptonide	increases expression	ISO	Mzb1 (Mus musculus)	6480464	triptonide results in increased expression of MZB1 mRNA	CTD	PMID:33045310
Mzb1	Rat	valproic acid	increases methylation	ISO	MZB1 (Homo sapiens)	6480464	Valproic Acid results in increased methylation of MZB1 gene	CTD	PMID:29154799
Mzb1	Rat	vincristine	decreases expression	ISO	MZB1 (Homo sapiens)	6480464	Vincristine results in decreased expression of MZB1 mRNA	CTD	PMID:23649840
Mzb1	Rat	zinc atom	increases expression	ISO	MZB1 (Homo sapiens)	6480464	Zinc deficiency results in increased expression of MZB1 mRNA	CTD	PMID:22171008
Mzb1	Rat	zinc(0)	increases expression	ISO	MZB1 (Homo sapiens)	6480464	Zinc deficiency results in increased expression of MZB1 mRNA	CTD	PMID:22171008

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mzb1	Rat	biological_process		ND		1598407	02/2015: no relevant rat data	RGD
Mzb1	Rat	integrin activation	involved_in	ISO	Mzb1 (Mus musculus)	1624291	PMID:21093319	RGD	PMID:21093319
Mzb1	Rat	integrin activation	involved_in	IEA	UniProtKB:Q9D8I1 and ensembl:ENSMUSP00000025211	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mzb1	Rat	integrin activation	involved_in	ISS	UniProtKB:Q9D8I1	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Mzb1	Rat	positive regulation of cell population proliferation	involved_in	ISS	UniProtKB:Q9D8I1	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Mzb1	Rat	positive regulation of cell population proliferation	involved_in	IEA	UniProtKB:Q9D8I1 and ensembl:ENSMUSP00000025211	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mzb1	Rat	positive regulation of cell population proliferation	involved_in	ISO	Mzb1 (Mus musculus)	1624291	PMID:21688198	RGD	PMID:21688198
Mzb1	Rat	positive regulation of cell population proliferation	involved_in	ISO	MZB1 (Homo sapiens) and UniProtKB:Q8WU39-1	1624291	PMID:21688198	RGD	PMID:21688198
Mzb1	Rat	positive regulation of immunoglobulin production	involved_in	ISS	UniProtKB:Q9D8I1	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Mzb1	Rat	positive regulation of immunoglobulin production	involved_in	IEA	UniProtKB:Q9D8I1 and ensembl:ENSMUSP00000025211	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mzb1	Rat	positive regulation of immunoglobulin production	involved_in	ISO	Mzb1 (Mus musculus)	1624291	PMID:19805154 and PMID:19805157	RGD	PMID:19805154 and PMID:19805157
Mzb1	Rat	regulation of B cell proliferation	involved_in	ISS	UniProtKB:Q9D8I1	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Mzb1	Rat	regulation of B cell proliferation	involved_in	IEA	UniProtKB:Q9D8I1 and ensembl:ENSMUSP00000025211	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mzb1	Rat	regulation of B cell proliferation	involved_in	ISO	Mzb1 (Mus musculus)	1624291	PMID:21093319	RGD	PMID:21093319
Mzb1	Rat	regulation of B cell proliferation	involved_in	IBA	MGI:1917066 and PANTHER:PTN001040490	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Mzb1	Rat	regulation of cell population proliferation	involved_in	ISS	UniProtKB:Q9D8I1	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Mzb1	Rat	regulation of cell population proliferation	involved_in	IEA	UniProtKB:Q9D8I1 and ensembl:ENSMUSP00000025211	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mzb1	Rat	regulation of cell population proliferation	involved_in	ISO	Mzb1 (Mus musculus)	1624291	PMID:21093319	RGD	PMID:21093319
Mzb1	Rat	regulation of insulin receptor signaling pathway	involved_in	ISS	UniProtKB:Q9D8I1	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Mzb1	Rat	regulation of insulin receptor signaling pathway	involved_in	IEA	UniProtKB:Q9D8I1 and ensembl:ENSMUSP00000025211	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mzb1	Rat	regulation of insulin receptor signaling pathway	involved_in	ISO	Mzb1 (Mus musculus)	1624291	PMID:21688198	RGD	PMID:21688198

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mzb1	Rat	cytoplasm	located_in	ISO	MZB1 (Homo sapiens) and UniProtKB:Q8WU39-2	1624291	PMID:11350957	RGD	PMID:11350957
Mzb1	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB-KW:KW-0256	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Mzb1	Rat	endoplasmic reticulum chaperone complex	part_of	ISO	Mzb1 (Mus musculus)	1624291	PMID:19805157	RGD	PMID:19805157
Mzb1	Rat	endoplasmic reticulum chaperone complex	part_of	IEA	UniProtKB:Q9D8I1 and ensembl:ENSMUSP00000025211	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mzb1	Rat	endoplasmic reticulum chaperone complex	part_of	IBA	MGI:1917066 and PANTHER:PTN001040490	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Mzb1	Rat	endoplasmic reticulum chaperone complex	part_of	ISS	UniProtKB:Q9D8I1	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Mzb1	Rat	endoplasmic reticulum lumen	located_in	ISS	UniProtKB:Q9D8I1	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Mzb1	Rat	endoplasmic reticulum lumen	located_in	IEA	UniProtKB:Q9D8I1 and ensembl:ENSMUSP00000025211	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mzb1	Rat	endoplasmic reticulum lumen	located_in	ISO	Mzb1 (Mus musculus)	1624291	PMID:21093319	RGD	PMID:21093319
Mzb1	Rat	endoplasmic reticulum lumen	located_in	IEA	UniProtKB-SubCell:SL-0096	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Mzb1	Rat	extracellular region	located_in	ISS	UniProtKB:Q9D8I1	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Mzb1	Rat	extracellular region	located_in	IEA	UniProtKB-SubCell:SL-0243	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Mzb1	Rat	extracellular region	located_in	IEA	UniProtKB-KW:KW-0964	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Mzb1	Rat	extracellular region	is_active_in	IBA	MGI:1917066 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Mzb1	Rat	extracellular region	located_in	IEA	UniProtKB:Q9D8I1 and ensembl:ENSMUSP00000025211	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mzb1	Rat	extracellular region	located_in	ISO	Mzb1 (Mus musculus)	1624291	PMID:21688198	RGD	PMID:21688198
Mzb1	Rat	extracellular region	located_in	ISO	MZB1 (Homo sapiens) and UniProtKB:Q8WU39-1	1624291	PMID:21688198	RGD	PMID:21688198

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mzb1	Rat	protein binding	enables	ISO	Mzb1 (Mus musculus)	1624291	UniProtKB:P08113 more ...	RGD	PMID:21093319
Mzb1	Rat	protein binding	enables	ISO	MZB1 (Homo sapiens)	1624291	UniProtKB:Q99816 and PMID:32296183	RGD	PMID:32296183
Mzb1	Rat	protein binding	enables	ISO	MZB1 (Homo sapiens) and UniProtKB:Q8WU39-2	1624291	UniProtKB:P42575 more ...	RGD	PMID:11350957

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Comprehensive gene review and curation	RGD comprehensive gene curation

PMID:11350957	PMID:12477932	PMID:19805154	PMID:19805157	PMID:20379803	PMID:20387008	PMID:20387010	PMID:20407844	PMID:20414744	PMID:20428965	PMID:20443077	PMID:20449688
PMID:20449689	PMID:20461496	PMID:20567937	PMID:20692466	PMID:20699230	PMID:20703829	PMID:20728507	PMID:21093319	PMID:21688198

Mzb1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	27,513,087 - 27,515,148 (-)	NCBI		GRCr8
mRatBN7.2	18	27,238,999 - 27,241,060 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	27,239,001 - 27,241,094 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	27,366,417 - 27,368,478 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	28,128,528 - 28,130,589 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	27,463,414 - 27,465,475 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	28,436,546 - 28,438,607 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	28,436,548 - 28,438,654 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	28,149,656 - 28,151,717 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	28,261,741 - 28,263,802 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	28,288,388 - 28,290,448 (-)	NCBI
Celera	18	26,972,541 - 26,974,602 (-)	NCBI		Celera
Cytogenetic Map	18	p11	NCBI

MZB1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	139,387,467 - 139,389,913 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	139,387,467 - 139,390,081 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	138,723,156 - 138,725,602 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	138,751,156 - 138,753,504 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Cytogenetic Map	5	q31.2	NCBI
HuRef	5	133,912,990 - 133,915,337 (-)	NCBI		HuRef
CHM1_1	5	138,155,878 - 138,158,225 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	139,913,564 - 139,916,009 (-)	NCBI		T2T-CHM13v2.0

Mzb1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	35,780,318 - 35,782,420 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	35,780,320 - 35,782,420 (-)	Ensembl		GRCm39 Ensembl
GRCm38	18	35,647,265 - 35,650,266 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	35,647,267 - 35,649,367 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	18	35,806,919 - 35,809,021 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	18	35,773,246 - 35,775,341 (-)	NCBI		MGSCv36	mm8
Celera	18	36,103,387 - 36,105,489 (-)	NCBI		Celera
Cytogenetic Map	18	B2	NCBI
cM Map	18	19.19	NCBI

Mzb1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955418	1,170,365 - 1,172,581 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955418	1,170,365 - 1,172,581 (+)	NCBI	ChiLan1.0	ChiLan1.0

MZB1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	134,654,445 - 134,668,804 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	132,793,895 - 132,808,366 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	134,758,631 - 134,772,992 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	140,881,415 - 140,883,756 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	140,881,415 - 140,883,756 (-)	Ensembl	panpan1.1		panPan2

MZB1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	34,710,487 - 34,712,660 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	34,706,007 - 34,712,626 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	31,812,781 - 31,814,951 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	35,164,568 - 35,166,738 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	35,164,553 - 35,166,707 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	32,217,016 - 32,219,186 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	33,083,316 - 33,085,486 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	33,834,939 - 33,837,109 (-)	NCBI		UU_Cfam_GSD_1.0

Mzb1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	153,134,080 - 153,136,601 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936531	8,474,954 - 8,476,936 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936531	8,474,721 - 8,477,479 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MZB1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	141,277,544 - 141,279,641 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	141,277,541 - 141,279,652 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	147,108,147 - 147,110,263 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MZB1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	42,059,984 - 42,062,700 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	42,060,290 - 42,062,334 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666034	35,825,018 - 35,827,881 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mzb1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624743	32,192,251 - 32,194,376 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624743	32,192,264 - 32,194,848 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Mzb1
8 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	38
Count of miRNA genes:	34
Interacting mature miRNAs:	38
Transcripts:	ENSRNOT00000036301
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331733	Bp233	Blood pressure QTL 233	3.97196		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	24796977	79788953	Rat
1358358	Sradr6	Stress Responsive Adrenal Weight QTL 6	2.49		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	18	11944299	59330563	Rat
1331735	Rf44	Renal function QTL 44	2.981		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	18	18234564	31359530	Rat
61382	Bp46	Blood pressure QTL 46	18.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11941791	31393320	Rat
2301413	Bp318	Blood pressure QTL 318		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	26548082	46969551	Rat
1331741	Bp232	Blood pressure QTL 232	3.59112		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	21372893	83213037	Rat
61388	Bp2	Blood pressure QTL 2	3.23		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	1	35374722	Rat
6903359	Bp355	Blood pressure QTL 355	3.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11944544	59796478	Rat
12904668	Bw188	Body weight QTL 188		0.03	body mass (VT:0001259)	body weight (CMO:0000012)	18	26548082	46969551	Rat
2313082	Bss85	Bone structure and strength QTL 85	0.8	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	18	14951337	59951337	Rat
12904669	Cm125	Cardiac mass QTL 125		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	26548082	46969551	Rat
1641923	Colcr8	Colorectal carcinoma resistance QTL 8	3.1	0.0014	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	18	22066242	52293055	Rat
12904670	Cm126	Cardiac mass QTL 126		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	26548082	46969551	Rat
2312568	Glom21	Glomerulus QTL 21	2	0.005	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	18	5185858	40503530	Rat
12904677	Kidm72	Kidney mass QTL 72		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	26548082	46969551	Rat
1331766	Bp236	Blood pressure QTL 236	3.022		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	11944299	31359530	Rat
1358193	Emca2	Estrogen-induced mammary cancer QTL 2	1.6		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	18	18007599	63571040	Rat
12904673	Cm127	Cardiac mass QTL 127		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	26548082	46969551	Rat
12904675	Am19	Aortic mass QTL 19		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	26548082	46969551	Rat
631264	Scl22	Serum cholesterol level QTL 22	6.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	18	11941791	31393320	Rat
1331775	Bp235	Blood pressure QTL 235	3.201		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	18234564	31359530	Rat
2325839	Bp348	Blood pressure QTL 348		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	25570985	70570985	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19278901	83218561	Rat
2293708	Bss46	Bone structure and strength QTL 46	8.8	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	18	11791518	63636873	Rat
9589153	Insul31	Insulin level QTL 31	7.15	0.05	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	18	1	42547119	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	11791518	83218561	Rat
2312598	Bp340	Blood pressure QTL 340		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	1	30558703	Rat
2300180	Bmd67	Bone mineral density QTL 67	4.8	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	18	1	34291613	Rat
2299160	Iddm35	Insulin dependent diabetes mellitus QTL 35	2.79		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	18	4207941	60377792	Rat
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	11791518	83218561	Rat
1331753	Bp231	Blood pressure QTL 231	3.643		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11944299	52293055	Rat
2293661	Bss50	Bone structure and strength QTL 50	4.64	0.0003	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	18	1	34291613	Rat
61375	Bp41	Blood pressure QTL 41	2.4		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	18	11944299	41122201	Rat

RH131353

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	27,239,020 - 27,239,205 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	28,436,568 - 28,436,752	NCBI	Rnor6.0
Rnor_5.0	18	28,149,678 - 28,149,862	UniSTS	Rnor5.0
RGSC_v3.4	18	28,261,763 - 28,261,947	UniSTS	RGSC3.4
Celera	18	26,972,563 - 26,972,747	UniSTS
Cytogenetic Map	18	p11	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	104	91	90	59	25	59	6	218	97	84	45	59	31


RefSeq Transcripts	NM_001024240	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC135285	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC093397	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473974	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234743	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000036301 ⟹ ENSRNOP00000030810

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	27,239,001 - 27,241,094 (-)	Ensembl
Rnor_6.0 Ensembl	18	28,436,548 - 28,438,654 (-)	Ensembl

RefSeq Acc Id:

NM_001024240 ⟹ NP_001019411

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	27,513,087 - 27,515,148 (-)	NCBI
mRatBN7.2	18	27,238,999 - 27,241,060 (-)	NCBI
Rnor_6.0	18	28,436,546 - 28,438,607 (-)	NCBI
Rnor_5.0	18	28,149,656 - 28,151,717 (-)	NCBI
RGSC_v3.4	18	28,261,741 - 28,263,802 (-)	RGD
Celera	18	26,972,541 - 26,974,602 (-)	RGD

Sequence:

show sequence

CATGAGACTACCCCTGCCGCTGTTGCTACTGTTCGGGTGCAGGGCTATCCTGGGGAGCTTCGGGGATAGGGTTTCCCTCTCAGCTACAGCTCCTACACTGGATGATGAAGAGAAGTACGCATCCCATA
TGCCGACTCACCTGCGCTGCGATGCCTGCCGGGCTGTGGCCTACCAGATGGGCCAACATCTGGCGAAAGCAGAGGCTAAATCTCACACTCCAGACTCCAGTGGATCGCAGGAGCTGAGTGAATCCACG
TACACAGATGTGCTGGACCGGACCTGCTCTCAGAACTGGCAGTCCTATGGAGTCCAAGAAGTGAACCAGATGAAGCGTCTCATGGGCCCGGGACTTAGCAAGGGGCCAGAGCCCAGCATCAGCGTGAT
GATTACTGGGGGTCCCTGGCCCAATAGGCTCTCCATGACGTGTTTCCACTACCTGGGAGAGTTTGGAGAGGACCAGATCTATGAAGCCTACCGCCAAGGCCACGAGACTCTGGAGGCGCTACTCTGTG
GGGGCACCCACGGGTCCTGCTCACAGGAGATCCCGGCTCAGAGAGAAGAGCTTTAGTCCAAGCTGTGACACCTATGGACCGTGTCTATATTTTTTTAATTAATTATTATTATTAATGGCTGTTTAGAG
ACAGGCTCTCATCATGTAGTCCAGGCTGGCCTTGAACTTGTCCTCCTGCTCAGCCTTGAAATTGCTGAAGTCCTGAGCCTTTGTGCTTGACCCTCCTATACCTTTCTTTCAGCAGTGGTGGTGGGGAG
GAGGCAGGGAAGCCTGACTCCAGCTGTCAATCTTCTCCCTCCACTCCTCCCTGGAGTACTGGGGCTGAGGCTGCCTTTCTACTTTCAAATAAAGTTCACTGACTTTGAAAAAAAAAAAAAAAAAAAAA
AAAA

hide sequence


Protein RefSeqs	NP_001019411	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH93397	(Get FASTA)	NCBI Sequence Viewer
	EDL76270	(Get FASTA)	NCBI Sequence Viewer
	EDL76271	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000030810
	ENSRNOP00000030810.4
GenBank Protein	Q561R0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001019411 ⟸ NM_001024240
- Peptide Label:	precursor
- UniProtKB:	Q561R0 (UniProtKB/Swiss-Prot), A6J2Y9 (UniProtKB/TrEMBL), A6J2Y8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MRLPLPLLLLFGCRAILGSFGDRVSLSATAPTLDDEEKYASHMPTHLRCDACRAVAYQMGQHLAKAEAKSHTPDSSGSQELSESTYTDVLDRTCSQNWQSYGVQEVNQMKRLMGPGLSKGPEPSISVM ITGGPWPNRLSMTCFHYLGEFGEDQIYEAYRQGHETLEALLCGGTHGSCSQEIPAQREEL hide sequence

Ensembl Acc Id:

ENSRNOP00000030810 ⟸ ENSRNOT00000036301

Protein Domains

DUF3456

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q561R0-F1-model_v2	AlphaFold	Q561R0	1-188	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13700709

Promoter ID:

EPDNEW_R11233

Type:

multiple initiation site

Name:

Mzb1_1

Description:

marginal zone B and B1 cell-specific protein

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	18	28,438,641 - 28,438,701	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-7900	BioCyc
Ensembl Genes	ENSRNOG00000022009	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000036301	ENTREZGENE
	ENSRNOT00000036301.7	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7389084	IMAGE-MGC_LOAD
InterPro	DUF3456	UniProtKB/Swiss-Prot
	MZB1	UniProtKB/Swiss-Prot
KEGG Report	rno:291675	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:112758	IMAGE-MGC_LOAD
NCBI Gene	291675	ENTREZGENE
PANTHER	MARGINAL ZONE B- AND B1-CELL-SPECIFIC PROTEIN	UniProtKB/Swiss-Prot
	MARGINAL ZONE B- AND B1-CELL-SPECIFIC PROTEIN	UniProtKB/Swiss-Prot
Pfam	DUF3456	UniProtKB/Swiss-Prot
PhenoGen	Mzb1	PhenoGen
PROSITE	ER_TARGET	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000022009	RatGTEx
UniProt	A6J2Y8	ENTREZGENE, UniProtKB/TrEMBL
	A6J2Y9	ENTREZGENE, UniProtKB/TrEMBL
	MZB1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-08-02	Mzb1	marginal zone B and B1 cell-specific protein	Pacap	proapoptotic caspase adapter protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2010-11-12	Pacap	proapoptotic caspase adapter protein	RGD1310251	similar to RIKEN cDNA 2010001M09	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1310251	similar to RIKEN cDNA 2010001M09	RGD1310251_predicted	similar to RIKEN cDNA 2010001M09 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1310251_predicted	similar to RIKEN cDNA 2010001M09 (predicted)	LOC291675_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC291675_predicted	similar to RIKEN cDNA 2010001M09 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar