Symbol:
Kdm2a
Name:
lysine demethylase 2A
RGD ID:
1309419
Description:
Predicted to enable several functions, including histone H3K36 demethylase activity; unmethylated CpG binding activity; and zinc ion binding activity. Predicted to be involved in double-strand break repair via nonhomologous end joining; regulation of circadian rhythm; and regulation of gene expression. Predicted to act upstream of or within several processes, including epithelial tube morphogenesis; neuroepithelial cell differentiation; and regulation of gene expression. Predicted to be located in chromatin and nucleoplasm. Human ortholog(s) of this gene implicated in lung non-small cell carcinoma. Orthologous to human KDM2A (lysine demethylase 2A); PARTICIPATES IN DNA modification pathway; histone modification pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
F-box and leucine-rich repeat protein 11; Fbxl11; LOC361700; lysine (K)-specific demethylase 2A; lysine-specific demethylase 2A
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
KDM2A (lysine demethylase 2A) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):
Kdm2a (lysine (K)-specific demethylase 2A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Kdm2a (lysine demethylase 2A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
KDM2A (lysine demethylase 2A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
KDM2A (lysine demethylase 2A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Kdm2a (lysine demethylase 2A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
KDM2A (lysine demethylase 2A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
KDM2A (lysine demethylase 2A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Kdm2a (lysine demethylase 2A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
KDM2A (lysine demethylase 2A)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Kdm2a (lysine (K)-specific demethylase 2A)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
kdm2ab (lysine (K)-specific demethylase 2Ab)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
kdm2aa (lysine (K)-specific demethylase 2Aa)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
JHD1
Alliance
DIOPT (OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Kdm2
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
jhdm-1
Alliance
DIOPT (InParanoid|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
kdm2a
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 211,041,859 - 211,125,749 (-) NCBI GRCr8 mRatBN7.2 1 201,612,427 - 201,682,359 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 201,612,453 - 201,680,787 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 209,964,511 - 210,033,280 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 217,057,845 - 217,126,197 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 209,748,863 - 209,817,220 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 219,566,130 - 219,642,294 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 219,566,156 - 219,640,294 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 226,436,243 - 226,509,594 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 206,903,426 - 206,972,100 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 207,057,263 - 207,125,981 (-) NCBI Celera 1 199,156,169 - 199,224,605 (-) NCBI Celera Cytogenetic Map 1 q43 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Kdm2a Rat (1->4)-beta-D-glucan multiple interactions ISO Kdm2a (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of KDM2A mRNA CTD PMID:36331819 Kdm2a Rat 1,2-dichloroethane affects expression ISO Kdm2a (Mus musculus) 6480464 ethylene dichloride affects the expression of KDM2A mRNA CTD PMID:28960355 Kdm2a Rat 17alpha-ethynylestradiol multiple interactions ISO Kdm2a (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of KDM2A mRNA CTD PMID:17942748 Kdm2a Rat 17beta-estradiol increases expression ISO Kdm2a (Mus musculus) 6480464 Estradiol results in increased expression of KDM2A mRNA CTD PMID:39298647 Kdm2a Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Kdm2a (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of KDM2A mRNA CTD PMID:17942748 Kdm2a Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of KDM2A mRNA CTD PMID:33387578 Kdm2a Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of KDM2A mRNA CTD PMID:34747641 Kdm2a Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of KDM2A mRNA CTD PMID:21346803 Kdm2a Rat 4,4'-sulfonyldiphenol decreases expression ISO Kdm2a (Mus musculus) 6480464 bisphenol S results in decreased expression of KDM2A mRNA CTD PMID:39298647 Kdm2a Rat 4,4'-sulfonyldiphenol multiple interactions ISO KDM2A (Homo sapiens) 6480464 [KDM2A protein co-treated with bisphenol S] results in decreased expression of and results in decreased activity of TET2 protein more ... CTD PMID:37315367 Kdm2a Rat 4,4'-sulfonyldiphenol increases expression ISO KDM2A (Homo sapiens) 6480464 bisphenol S results in increased expression of KDM2A mRNA and bisphenol S results in increased expression of KDM2A protein CTD PMID:37315367 Kdm2a Rat acrolein multiple interactions ISO KDM2A (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of KDM2A mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of KDM2A mRNA CTD PMID:32699268 Kdm2a Rat acrylamide increases expression ISO KDM2A (Homo sapiens) 6480464 Acrylamide results in increased expression of KDM2A mRNA CTD PMID:32763439 Kdm2a Rat aflatoxin B1 increases expression ISO Kdm2a (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of KDM2A mRNA CTD PMID:19770486 Kdm2a Rat all-trans-retinoic acid increases expression ISO KDM2A (Homo sapiens) 6480464 Tretinoin results in increased expression of KDM2A mRNA CTD PMID:33167477 Kdm2a Rat alpha-pinene multiple interactions ISO KDM2A (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of KDM2A mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of KDM2A mRNA CTD PMID:32699268 Kdm2a Rat antirheumatic drug decreases expression ISO KDM2A (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of KDM2A mRNA CTD PMID:24449571 Kdm2a Rat arsane multiple interactions ISO KDM2A (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of KDM2A mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of KDM2A mRNA CTD PMID:39836092 Kdm2a Rat arsenic atom multiple interactions ISO KDM2A (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of KDM2A mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of KDM2A mRNA CTD PMID:39836092 Kdm2a Rat arsenous acid increases expression ISO KDM2A (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of KDM2A mRNA CTD PMID:20458559 Kdm2a Rat benzene decreases expression ISO Kdm2a (Mus musculus) 6480464 Benzene results in decreased expression of KDM2A mRNA CTD PMID:20018183 Kdm2a Rat benzo[a]pyrene increases expression ISO Kdm2a (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of KDM2A mRNA CTD PMID:19770486 and PMID:21715664 Kdm2a Rat benzo[a]pyrene decreases methylation ISO KDM2A (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of KDM2A promoter CTD PMID:27901495 Kdm2a Rat bis(2-ethylhexyl) phthalate decreases expression ISO Kdm2a (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of KDM2A mRNA CTD PMID:33754040 Kdm2a Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of KDM2A mRNA CTD PMID:26982218 Kdm2a Rat bisphenol A increases expression ISO KDM2A (Homo sapiens) 6480464 bisphenol A results in increased expression of KDM2A mRNA and bisphenol A results in increased expression of KDM2A protein CTD PMID:37315367 Kdm2a Rat bisphenol A multiple interactions ISO KDM2A (Homo sapiens) 6480464 [KDM2A protein co-treated with bisphenol A] results in decreased expression of and results in decreased activity of TET2 protein more ... CTD PMID:37315367 Kdm2a Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of KDM2A gene CTD PMID:28505145 Kdm2a Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of KDM2A mRNA CTD PMID:25181051 and PMID:30816183 Kdm2a Rat Bisphenol A diglycidyl ether affects splicing ISO Kdm2a (Mus musculus) 6480464 bisphenol A diglycidyl ether affects the splicing of KDM2A mRNA CTD PMID:36464114 Kdm2a Rat bisphenol AF affects splicing ISO Kdm2a (Mus musculus) 6480464 bisphenol AF affects the splicing of KDM2A mRNA CTD PMID:36464114 Kdm2a Rat bisphenol F increases expression ISO Kdm2a (Mus musculus) 6480464 bisphenol F results in increased expression of KDM2A mRNA CTD PMID:38685157 Kdm2a Rat caffeine decreases phosphorylation ISO KDM2A (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of KDM2A protein CTD PMID:35688186 Kdm2a Rat CGP 52608 multiple interactions ISO KDM2A (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to KDM2A gene] CTD PMID:28238834 Kdm2a Rat ciguatoxin CTX1B affects expression ISO Kdm2a (Mus musculus) 6480464 Ciguatoxins affects the expression of KDM2A mRNA CTD PMID:18353800 Kdm2a Rat cobalt dichloride increases expression ISO KDM2A (Homo sapiens) 6480464 cobaltous chloride results in increased expression of KDM2A mRNA CTD PMID:19320972 and PMID:19376846 Kdm2a Rat copper(II) chloride increases expression ISO KDM2A (Homo sapiens) 6480464 cupric chloride results in increased expression of KDM2A mRNA CTD PMID:17211630 Kdm2a Rat copper(II) sulfate increases expression ISO KDM2A (Homo sapiens) 6480464 Copper Sulfate results in increased expression of KDM2A mRNA CTD PMID:19549813 Kdm2a Rat coumarin affects phosphorylation ISO KDM2A (Homo sapiens) 6480464 coumarin affects the phosphorylation of KDM2A protein CTD PMID:35688186 Kdm2a Rat cyclophosphamide increases expression EXP 6480464 Cyclophosphamide results in increased expression of KDM2A mRNA CTD PMID:27281708 Kdm2a Rat diarsenic trioxide increases expression ISO KDM2A (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of KDM2A mRNA CTD PMID:20458559 Kdm2a Rat Dibutyl phosphate affects expression ISO KDM2A (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of KDM2A mRNA CTD PMID:37042841 Kdm2a Rat dicrotophos increases expression ISO KDM2A (Homo sapiens) 6480464 dicrotophos results in increased expression of KDM2A mRNA CTD PMID:28302478 Kdm2a Rat doxorubicin decreases expression ISO KDM2A (Homo sapiens) 6480464 Doxorubicin results in decreased expression of KDM2A mRNA CTD PMID:29803840 Kdm2a Rat ethanol multiple interactions ISO Kdm2a (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of KDM2A mRNA CTD PMID:30319688 Kdm2a Rat fenthion increases expression ISO Kdm2a (Mus musculus) 6480464 Fenthion results in increased expression of KDM2A mRNA CTD PMID:34813904 Kdm2a Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of KDM2A mRNA CTD PMID:24136188 Kdm2a Rat folic acid decreases expression ISO Kdm2a (Mus musculus) 6480464 Folic Acid results in decreased expression of KDM2A mRNA CTD PMID:25629700 Kdm2a Rat FR900359 affects phosphorylation ISO KDM2A (Homo sapiens) 6480464 FR900359 affects the phosphorylation of KDM2A protein CTD PMID:37730182 Kdm2a Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of KDM2A mRNA CTD PMID:22061828 Kdm2a Rat hydrogen peroxide decreases expression ISO KDM2A (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of KDM2A mRNA CTD PMID:18951874 Kdm2a Rat inulin multiple interactions ISO Kdm2a (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of KDM2A mRNA CTD PMID:36331819 Kdm2a Rat manganese atom multiple interactions ISO KDM2A (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of KDM2A mRNA CTD PMID:39836092 Kdm2a Rat manganese(0) multiple interactions ISO KDM2A (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of KDM2A mRNA CTD PMID:39836092 Kdm2a Rat manganese(II) chloride multiple interactions ISO KDM2A (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of KDM2A mRNA CTD PMID:39836092 Kdm2a Rat methidathion increases expression ISO Kdm2a (Mus musculus) 6480464 methidathion results in increased expression of KDM2A mRNA CTD PMID:34813904 Kdm2a Rat N-acetyl-L-cysteine multiple interactions ISO Kdm2a (Mus musculus) 6480464 Acetylcysteine inhibits the reaction [[Vehicle Emissions results in increased abundance of Particulate Matter] which results in increased expression of KDM2A protein] CTD PMID:31551408 Kdm2a Rat N-acetyl-L-cysteine multiple interactions ISO KDM2A (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [[Vehicle Emissions results in increased abundance of Particulate Matter] promotes the reaction [KDM2A protein binds to CDKN2A promoter]] CTD PMID:31551408 Kdm2a Rat ozone multiple interactions ISO KDM2A (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of KDM2A mRNA more ... CTD PMID:32699268 and PMID:35430440 Kdm2a Rat paracetamol decreases expression ISO KDM2A (Homo sapiens) 6480464 Acetaminophen results in decreased expression of KDM2A mRNA CTD PMID:21420995 Kdm2a Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of KDM2A mRNA CTD PMID:33387578 Kdm2a Rat paraquat decreases expression ISO Kdm2a (Mus musculus) 6480464 Paraquat results in decreased expression of KDM2A mRNA CTD PMID:21371552 Kdm2a Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Kdm2a (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of KDM2A mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of KDM2A mRNA CTD PMID:36331819 Kdm2a Rat phenobarbital affects expression ISO Kdm2a (Mus musculus) 6480464 Phenobarbital affects the expression of KDM2A mRNA CTD PMID:23091169 Kdm2a Rat pirinixic acid multiple interactions ISO Kdm2a (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of KDM2A mRNA CTD PMID:19710929 Kdm2a Rat silver atom increases expression ISO KDM2A (Homo sapiens) 6480464 Silver results in increased expression of KDM2A mRNA CTD PMID:26014281 Kdm2a Rat silver(0) increases expression ISO KDM2A (Homo sapiens) 6480464 Silver results in increased expression of KDM2A mRNA CTD PMID:26014281 Kdm2a Rat sodium arsenite increases expression ISO KDM2A (Homo sapiens) 6480464 sodium arsenite results in increased expression of KDM2A mRNA CTD PMID:38568856 Kdm2a Rat sodium arsenite multiple interactions ISO KDM2A (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of KDM2A mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of KDM2A mRNA CTD PMID:39836092 Kdm2a Rat Soman increases expression EXP 6480464 Soman results in increased expression of KDM2A mRNA CTD PMID:19281266 Kdm2a Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of KDM2A mRNA CTD PMID:34492290 Kdm2a Rat thiram increases expression ISO KDM2A (Homo sapiens) 6480464 Thiram results in increased expression of KDM2A mRNA CTD PMID:38568856 Kdm2a Rat titanium dioxide increases methylation ISO Kdm2a (Mus musculus) 6480464 titanium dioxide results in increased methylation of KDM2A gene and titanium dioxide results in increased methylation of KDM2A promoter CTD PMID:35295148 Kdm2a Rat triptonide increases expression ISO Kdm2a (Mus musculus) 6480464 triptonide results in increased expression of KDM2A mRNA CTD PMID:33045310 Kdm2a Rat triticonazole decreases expression EXP 6480464 triticonazole results in decreased expression of KDM2A mRNA CTD PMID:36084822 Kdm2a Rat troglitazone decreases expression ISO Kdm2a (Mus musculus) 6480464 troglitazone results in decreased expression of KDM2A mRNA CTD PMID:28973697 Kdm2a Rat tungsten decreases expression ISO Kdm2a (Mus musculus) 6480464 Tungsten results in decreased expression of KDM2A mRNA CTD PMID:30912803 Kdm2a Rat urethane increases expression ISO KDM2A (Homo sapiens) 6480464 Urethane results in increased expression of KDM2A mRNA CTD PMID:28818685 Kdm2a Rat valproic acid affects expression ISO KDM2A (Homo sapiens) 6480464 Valproic Acid affects the expression of KDM2A mRNA CTD PMID:25979313 Kdm2a Rat valproic acid decreases methylation ISO KDM2A (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of KDM2A gene CTD PMID:29154799 Kdm2a Rat vorinostat decreases expression ISO KDM2A (Homo sapiens) 6480464 vorinostat results in decreased expression of KDM2A mRNA CTD PMID:27188386 Kdm2a Rat zinc atom multiple interactions ISO KDM2A (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of KDM2A mRNA CTD PMID:18593933 Kdm2a Rat zinc(0) multiple interactions ISO KDM2A (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of KDM2A mRNA CTD PMID:18593933
1.
Epigenetic switch at atp2a2 and myh7 gene promoters in pressure overload-induced heart failure.
Angrisano T, etal., PLoS One. 2014 Sep 2;9(9):e106024. doi: 10.1371/journal.pone.0106024. eCollection 2014.
2.
Histone lysine methylation dynamics: establishment, regulation, and biological impact.
Black JC, etal., Mol Cell. 2012 Nov 30;48(4):491-507. doi: 10.1016/j.molcel.2012.11.006.
3.
Transcriptional repression of histone deacetylase 3 by the histone demethylase KDM2A is coupled to tumorigenicity of lung cancer cells.
Dhar SS, etal., J Biol Chem. 2014 Mar 14;289(11):7483-96. doi: 10.1074/jbc.M113.521625. Epub 2014 Jan 30.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
ZF-CxxC domain-containing proteins, CpG islands and the chromatin connection.
Long HK, etal., Biochem Soc Trans. 2013 Jun;41(3):727-40. doi: 10.1042/BST20130028.
7.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
8.
KDM2A promotes lung tumorigenesis by epigenetically enhancing ERK1/2 signaling.
Wagner KW, etal., J Clin Invest. 2013 Dec 2;123(12):5231-46. doi: 10.1172/JCI68642. Epub 2013 Nov 8.
Kdm2a Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 211,041,859 - 211,125,749 (-) NCBI GRCr8 mRatBN7.2 1 201,612,427 - 201,682,359 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 201,612,453 - 201,680,787 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 209,964,511 - 210,033,280 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 217,057,845 - 217,126,197 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 209,748,863 - 209,817,220 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 219,566,130 - 219,642,294 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 219,566,156 - 219,640,294 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 226,436,243 - 226,509,594 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 206,903,426 - 206,972,100 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 207,057,263 - 207,125,981 (-) NCBI Celera 1 199,156,169 - 199,224,605 (-) NCBI Celera Cytogenetic Map 1 q43 NCBI
KDM2A Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 67,119,263 - 67,258,082 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 67,119,263 - 67,258,082 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 66,886,734 - 67,025,553 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 66,644,074 - 66,781,717 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 66,644,073 - 66,781,717 NCBI Celera 11 64,216,493 - 64,358,014 (+) NCBI Celera Cytogenetic Map 11 q13.2 NCBI HuRef 11 63,214,819 - 63,354,668 (+) NCBI HuRef CHM1_1 11 66,769,756 - 66,908,574 (+) NCBI CHM1_1 T2T-CHM13v2.0 11 67,110,939 - 67,252,047 (+) NCBI T2T-CHM13v2.0
Kdm2a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 4,366,172 - 4,448,749 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 4,364,447 - 4,448,313 (-) Ensembl GRCm39 Ensembl GRCm38 19 4,316,144 - 4,398,721 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 4,314,419 - 4,398,285 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 4,316,144 - 4,397,077 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 4,317,806 - 4,398,266 (-) NCBI MGSCv36 mm8 Celera 19 4,187,040 - 4,267,780 (-) NCBI Celera Cytogenetic Map 19 A NCBI cM Map 19 4.01 NCBI
Kdm2a Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955422 18,200,758 - 18,308,163 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955422 18,201,243 - 18,308,163 (-) NCBI ChiLan1.0 ChiLan1.0
KDM2A Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 68,339,000 - 68,484,737 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 69,381,707 - 69,527,213 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 62,470,549 - 62,616,135 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 65,793,464 - 65,930,509 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 65,793,464 - 65,930,498 (+) Ensembl panpan1.1 panPan2
KDM2A Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 18 50,178,511 - 50,294,097 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 18 50,181,024 - 50,291,127 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 18 48,788,733 - 48,940,137 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 18 51,127,518 - 51,280,575 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 18 51,127,518 - 51,241,565 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 18 50,313,570 - 50,464,719 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 18 49,888,074 - 50,039,414 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 18 50,682,691 - 50,834,402 (-) NCBI UU_Cfam_GSD_1.0
Kdm2a Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 6,024,717 - 6,134,274 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936599 2,466,214 - 2,576,623 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936599 2,466,427 - 2,576,623 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KDM2A Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 5,240,312 - 5,357,829 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 5,238,690 - 5,357,799 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 4,021,430 - 4,050,212 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3 Sscrofa10.2 2 4,143,872 - 4,182,749 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
KDM2A Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 7,004,109 - 7,152,072 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 7,003,784 - 7,082,720 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 104,292,429 - 104,442,261 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Kdm2a
.
Predicted Target Of
Count of predictions: 413 Count of miRNA genes: 218 Interacting mature miRNAs: 287 Transcripts: ENSRNOT00000054850 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1357335 Bw39 Body weight QTL 39 3.3 body mass (VT:0001259) body weight (CMO:0000012) 1 197814409 242814409 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 2302375 Bw83 Body weight QTL 83 4.87 0.0002 body mass (VT:0001259) body weight (CMO:0000012) 1 197697768 242697768 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2293674 Bss39 Bone structure and strength QTL 39 7.1 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 1 201554356 246554356 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1354653 Despr9 Despair related QTL 9 0.00019 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 167909849 212909849 Rat 2293673 Bss27 Bone structure and strength QTL 27 18.63 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 1 171629477 216629477 Rat 2293677 Bss41 Bone structure and strength QTL 41 9.38 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 1 171629477 216629477 Rat 1302787 Stl25 Serum triglyceride level QTL 25 2.7 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 180359209 210702199 Rat 1549830 Bss1 Bone structure and strength QTL 1 4.8 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 172609619 217609619 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 70163 Bw20 Body weight QTL 20 5.1 body mass (VT:0001259) body weight (CMO:0000012) 1 174133260 219133260 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1558658 Bw59 Body weight QTL 59 3.5 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 1 178784622 223784622 Rat 631838 Niddm36 Non-insulin dependent diabetes mellitus QTL 36 0.01 insulin secretion trait (VT:0003564) calculated pancreatic islet insulin release measurement (CMO:0001217) 1 184550676 229550676 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 2293689 Bss47 Bone structure and strength QTL 47 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 1 171629477 216629477 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 2293694 Bss38 Bone structure and strength QTL 38 7.05 0.0001 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 1 201554356 246554356 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 61341 Bp26 Blood pressure QTL 26 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 169537671 214537671 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 2293693 Bss22 Bone structure and strength QTL 22 33.52 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 1 171629477 216629477 Rat 2300161 Bmd43 Bone mineral density QTL 43 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 1300145 Rf7 Renal function QTL 7 2.96 urine creatinine amount (VT:0010540) urine creatinine level (CMO:0000125) 1 185145134 221264292 Rat 61347 Bp197 Blood pressure QTL 197 4.2 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 1 158633083 203633083 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631214 Bw61 Body weight QTL61 3.4 0.0001 intramuscular adipose amount (VT:0010044) intramuscular fat area (CMO:0001162) 1 173108781 218108781 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 2300175 Bmd40 Bone mineral density QTL 40 15.4 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 1 201554356 246554356 Rat 2300174 Bmd42 Bone mineral density QTL 42 8.4 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 1 171629477 216629477 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 737977 Bp160 Blood pressure QTL 160 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 181133855 226133855 Rat 2293654 Bss30 Bone structure and strength QTL 30 32.65 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 1 171629477 216629477 Rat 2293655 Bss36 Bone structure and strength QTL 36 10.66 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 201554356 246554356 Rat 1298084 Thym4 Thymus enlargement QTL 4 10.68 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 197814409 242814409 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 2300187 Bmd41 Bone mineral density QTL 41 8.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 2314011 Gluco56 Glucose level QTL 56 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 199773958 202166723 Rat 8552891 Epfw5 Epididymal fat weight QTL 5 4.4 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 1 193113876 238113876 Rat 1359018 Hrtrt20 Heart rate QTL 20 3.08 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 185356336 202902618 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358292 Cm37 Cardiac mass QTL 37 6.2 8e-07 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 1 196248093 241248093 Rat 61376 Bp42 Blood pressure QTL 42 23.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 197814409 242814409 Rat 634313 Niddm43 Non-insulin dependent diabetes mellitus QTL 43 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 199050459 259647894 Rat 634312 Bp143 Blood pressure QTL 143 3 0.0002 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 182623426 219932796 Rat 1358294 Bw37 Body weight QTL 37 5 0.000011 body mass (VT:0001259) body weight (CMO:0000012) 1 171310381 216310381 Rat 724559 Pancm1 Pancreatic morphology QTL 1 7.1 islet of Langerhans morphology trait (VT:0005215) pancreatic islet damage composite score (CMO:0001156) 1 181759564 214537555 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 10059600 Bp378 Blood pressure QTL 378 3.08 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 176869060 221869060 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 619613 Bp77 Blood pressure QTL 77 0.01 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 164747424 209747424 Rat 2312564 Glom18 Glomerulus QTL 18 2.4 0.003 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 185356336 231689108 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 2292218 Kidm35 Kidney mass QTL 35 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 199368955 224569684 Rat 724562 Rends1 Renal damage susceptibility QTL 1 0.05 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 1 169537671 214537671 Rat 1331790 Bp201 Blood pressure QTL 201 3.127 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 198211513 225126682 Rat 2292222 Bp307 Blood pressure QTL 307 3.06 0.0014 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 213533942 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 10059590 Kidm44 Kidney mass QTL 44 3.42 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 191033875 236033875 Rat 1641926 Teswt2 Testicular weight QTL 2 2.82 testis mass (VT:1000644) both testes wet weight (CMO:0000175) 1 197697768 238755659 Rat 631658 Cm7 Cardiac mass QTL 7 5.32 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 1 196248093 241248093 Rat 1600380 Niddm70 Non-insulin dependent diabetes mellitus QTL 70 3.1 0.0008 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 176550523 221550523 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1582206 Kidm33 Kidney mass QTL 33 6.9 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 188377360 224054420 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 634338 Hcar4 Hepatocarcinoma resistance QTL 4 4.6 liver integrity trait (VT:0010547) liver tumorous lesion number to liver area ratio (CMO:0001210) 1 193422268 214537671 Rat 6903303 Scl34 Serum cholesterol QTL 34 2.5 0.0033 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 180359209 218108781 Rat 1600374 Mcs17 Mammary carcinoma susceptibility QTL 17 3 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 197670404 242670404 Rat 2293083 Iddm25 Insulin dependent diabetes mellitus QTL 25 4.18 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 181829673 224569684 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 7394701 Uae46 Urinary albumin excretion QTL 46 3.6 0.0056 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 201554356 246554356 Rat
RH129222
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 201,612,485 - 201,612,672 (+) MAPPER mRatBN7.2 Rnor_6.0 1 219,566,189 - 219,566,375 NCBI Rnor6.0 Rnor_5.0 1 226,436,302 - 226,436,488 UniSTS Rnor5.0 RGSC_v3.4 1 206,903,483 - 206,903,669 UniSTS RGSC3.4 Celera 1 199,156,226 - 199,156,412 UniSTS RH 3.4 Map 1 1559.0 UniSTS Cytogenetic Map 1 q42 UniSTS
AW536790
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 201,612,636 - 201,612,743 (+) MAPPER mRatBN7.2 Rnor_6.0 1 219,566,340 - 219,566,446 NCBI Rnor6.0 Rnor_5.0 1 226,436,453 - 226,436,559 UniSTS Rnor5.0 RGSC_v3.4 1 206,903,634 - 206,903,740 UniSTS RGSC3.4 Celera 1 199,156,377 - 199,156,483 UniSTS Cytogenetic Map 1 q42 UniSTS
BF390516
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 201,637,567 - 201,637,749 (+) MAPPER mRatBN7.2 Rnor_6.0 1 219,591,270 - 219,591,451 NCBI Rnor6.0 Rnor_5.0 1 226,461,383 - 226,461,564 UniSTS Rnor5.0 RGSC_v3.4 1 206,928,565 - 206,928,746 UniSTS RGSC3.4 Celera 1 199,181,307 - 199,181,488 UniSTS RH 3.4 Map 1 1558.4 UniSTS Cytogenetic Map 1 q42 UniSTS
UniSTS:224510
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 201,614,169 - 201,614,339 (+) MAPPER mRatBN7.2 Rnor_6.0 1 219,567,873 - 219,568,042 NCBI Rnor6.0 Rnor_5.0 1 226,437,986 - 226,438,155 UniSTS Rnor5.0 RGSC_v3.4 1 206,905,167 - 206,905,336 UniSTS RGSC3.4 Celera 1 199,157,910 - 199,158,079 UniSTS Cytogenetic Map 1 q42 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000054850 ⟹ ENSRNOP00000051732
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 201,612,453 - 201,680,787 (-) Ensembl Rnor_6.0 Ensembl 1 219,566,156 - 219,640,294 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000098321 ⟹ ENSRNOP00000097302
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 201,612,453 - 201,655,048 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000113561 ⟹ ENSRNOP00000096348
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 201,675,826 - 201,678,968 (-) Ensembl
RefSeq Acc Id:
NM_001108515 ⟹ NP_001101985
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 211,041,861 - 211,110,215 (-) NCBI mRatBN7.2 1 201,612,429 - 201,680,787 (-) NCBI Rnor_6.0 1 219,566,132 - 219,640,294 (-) NCBI Rnor_5.0 1 226,436,243 - 226,509,594 (-) NCBI RGSC_v3.4 1 206,903,426 - 206,972,100 (-) RGD Celera 1 199,156,169 - 199,224,605 (-) RGD
Sequence:
GGGCTTCGGAAGCGGCTGTGACCGTCTGAGGGTACCGAGAAGAGGGTGTTTCCCGCGGCCGGGTTGGCCCGGGTTTCGGGCTGGGGCTGCTGACCGCCAGCTTGGGGGAGTAGCCGAGTGGTCTTGCT
hide sequence
RefSeq Acc Id:
XM_039083854 ⟹ XP_038939782
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 211,041,859 - 211,059,221 (-) NCBI mRatBN7.2 1 201,612,427 - 201,629,792 (-) NCBI
RefSeq Acc Id:
XM_063268221 ⟹ XP_063124291
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 211,041,859 - 211,125,749 (-) NCBI
RefSeq Acc Id:
XM_063268222 ⟹ XP_063124292
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 211,041,859 - 211,110,878 (-) NCBI
RefSeq Acc Id:
XM_063268223 ⟹ XP_063124293
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 211,041,859 - 211,116,765 (-) NCBI
RefSeq Acc Id:
NP_001101985 ⟸ NM_001108515
- UniProtKB:
D3ZTJ7 (UniProtKB/TrEMBL), A6HYX1 (UniProtKB/TrEMBL), A0A8I6ARD6 (UniProtKB/TrEMBL)
- Sequence:
MEPEEERIRYSQRLRGTMRRRYEDDGISDDEIEGKRTFDLEEKLHTNKYNANFVTFMEGKDFNVEYIQRGGLRDPLIFKNSDGLGIKMPDPDFTVNDVKMCVGSRRMVDVMDVNTQKGIEMTMAQWTR
hide sequence
Ensembl Acc Id:
ENSRNOP00000051732 ⟸ ENSRNOT00000054850
RefSeq Acc Id:
XP_038939782 ⟸ XM_039083854
- Peptide Label:
isoform X2
Ensembl Acc Id:
ENSRNOP00000096348 ⟸ ENSRNOT00000113561
Ensembl Acc Id:
ENSRNOP00000097302 ⟸ ENSRNOT00000098321
RefSeq Acc Id:
XP_063124291 ⟸ XM_063268221
- Peptide Label:
isoform X1
- UniProtKB:
A6HYX1 (UniProtKB/TrEMBL), D3ZTJ7 (UniProtKB/TrEMBL), A0A8I6ARD6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063124293 ⟸ XM_063268223
- Peptide Label:
isoform X1
- UniProtKB:
A6HYX1 (UniProtKB/TrEMBL), D3ZTJ7 (UniProtKB/TrEMBL), A0A8I6ARD6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063124292 ⟸ XM_063268222
- Peptide Label:
isoform X1
- UniProtKB:
A6HYX1 (UniProtKB/TrEMBL), D3ZTJ7 (UniProtKB/TrEMBL), A0A8I6ARD6 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-17
Kdm2a
lysine demethylase 2A
Kdm2a
lysine (K)-specific demethylase 2A
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2010-04-20
Kdm2a
lysine (K)-specific demethylase 2A
Fbxl11
F-box and leucine-rich repeat protein 11
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Fbxl11
F-box and leucine-rich repeat protein 11
Fbxl11_predicted
F-box and leucine-rich repeat protein 11 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Fbxl11_predicted
F-box and leucine-rich repeat protein 11 (predicted)
Symbol and Name status set to approved
70820 APPROVED
