Symbol:
Prg4
Name:
proteoglycan 4
RGD ID:
1308976
Description:
Predicted to enable polysaccharide binding activity and scavenger receptor activity. Predicted to be involved in immune response and vesicle-mediated transport. Predicted to act upstream of or within hematopoietic stem cell proliferation; negative regulation of interleukin-6 production; and regulation of cell population proliferation. Predicted to be active in collagen-containing extracellular matrix and extracellular space. Human ortholog(s) of this gene implicated in camptodactyly-arthropathy-coxa vara-pericarditis syndrome and pericarditis. Orthologous to human PRG4 (proteoglycan 4); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acetamide; acrylamide.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC289104; lubricin; proteoglycan 4, (megakaryocyte stimulating factor, articular superficial zone protein, camptodactyly, arthropathy, coxa vara, pericarditis syndrome)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 65,037,363 - 65,054,764 (-) NCBI GRCr8 mRatBN7.2 13 62,487,257 - 62,504,657 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 62,487,257 - 62,504,119 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 65,133,642 - 65,150,474 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 66,404,875 - 66,421,792 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 63,666,116 - 63,683,057 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 67,672,588 - 67,688,902 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 67,672,878 - 67,688,477 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 72,637,409 - 72,653,723 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 64,753,316 - 64,769,533 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 64,767,685 - 64,783,195 (-) NCBI Celera 13 62,446,883 - 62,463,361 (-) NCBI Celera Cytogenetic Map 13 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Prg4 Rat (1->4)-beta-D-glucan multiple interactions ISO Prg4 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PRG4 mRNA CTD PMID:36331819 Prg4 Rat (S)-nicotine decreases expression ISO Prg4 (Mus musculus) 6480464 Nicotine results in decreased expression of PRG4 mRNA CTD PMID:33640489 Prg4 Rat 1,2-dichloroethane increases expression ISO Prg4 (Mus musculus) 6480464 ethylene dichloride results in increased expression of PRG4 mRNA CTD PMID:28960355 Prg4 Rat 17alpha-ethynylestradiol multiple interactions ISO Prg4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PRG4 mRNA CTD PMID:17942748 Prg4 Rat 17beta-estradiol increases expression ISO Prg4 (Mus musculus) 6480464 Estradiol results in increased expression of PRG4 mRNA CTD PMID:19484750 and PMID:39298647 Prg4 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Prg4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PRG4 mRNA CTD PMID:17942748 Prg4 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PRG4 mRNA CTD PMID:32109520 and PMID:34747641 Prg4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO PRG4 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PRG4 mRNA CTD PMID:21296121 Prg4 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Prg4 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Prg4 Rat 4,4'-sulfonyldiphenol affects expression ISO Prg4 (Mus musculus) 6480464 bisphenol S affects the expression of PRG4 mRNA CTD PMID:39298647 Prg4 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of PRG4 mRNA CTD PMID:31881176 Prg4 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of PRG4 mRNA CTD PMID:28959563 Prg4 Rat aflatoxin B1 decreases expression ISO PRG4 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of PRG4 mRNA CTD PMID:27153756 Prg4 Rat aflatoxin B1 increases methylation ISO PRG4 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of PRG4 polyA tail CTD PMID:30157460 Prg4 Rat aflatoxin B1 decreases methylation ISO PRG4 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of PRG4 gene CTD PMID:27153756 Prg4 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of PRG4 mRNA CTD PMID:35163327 Prg4 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of PRG4 mRNA CTD PMID:30779732 Prg4 Rat aristolochic acid A increases expression ISO PRG4 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of PRG4 mRNA CTD PMID:33212167 Prg4 Rat arsenous acid increases expression ISO PRG4 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PRG4 mRNA CTD PMID:20458559 Prg4 Rat arsenous acid decreases expression ISO Prg4 (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of PRG4 mRNA CTD PMID:35676786 Prg4 Rat benzene-1,2,4-triol decreases expression ISO PRG4 (Homo sapiens) 6480464 hydroxyhydroquinone results in decreased expression of PRG4 mRNA CTD PMID:39245080 Prg4 Rat benzo[a]pyrene increases methylation ISO PRG4 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of PRG4 5' UTR and Benzo(a)pyrene results in increased methylation of PRG4 exon CTD PMID:27901495 Prg4 Rat benzo[a]pyrene affects methylation ISO PRG4 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PRG4 promoter CTD PMID:27901495 Prg4 Rat benzo[a]pyrene decreases expression ISO PRG4 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PRG4 mRNA CTD PMID:30453624 Prg4 Rat benzo[b]fluoranthene increases expression ISO Prg4 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of PRG4 mRNA CTD PMID:26377693 Prg4 Rat Benzo[k]fluoranthene increases expression ISO Prg4 (Mus musculus) 6480464 benzo(k)fluoranthene results in increased expression of PRG4 mRNA CTD PMID:26377693 Prg4 Rat berberine decreases expression ISO PRG4 (Homo sapiens) 6480464 Berberine results in decreased expression of PRG4 mRNA CTD PMID:26478571 Prg4 Rat bisphenol A multiple interactions ISO Prg4 (Mus musculus) 6480464 [potassium bromate co-treated with bisphenol A] affects the expression of PRG4 mRNA and [XRCC6 gene mutant form results in increased susceptibility to potassium bromate] affects the reaction [[potassium bromate co-treated with bisphenol A] affects the expression of PRG4 mRNA] CTD PMID:27082013 Prg4 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PRG4 mRNA CTD PMID:36779543 Prg4 Rat bisphenol A increases expression ISO Prg4 (Mus musculus) 6480464 bisphenol A results in increased expression of PRG4 mRNA CTD PMID:32156529 Prg4 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PRG4 mRNA CTD PMID:25181051 Prg4 Rat Butylbenzyl phthalate increases expression ISO Prg4 (Mus musculus) 6480464 butylbenzyl phthalate results in increased expression of PRG4 mRNA CTD PMID:32308655 Prg4 Rat cadmium atom decreases expression ISO PRG4 (Homo sapiens) 6480464 Cadmium results in decreased expression of PRG4 mRNA CTD PMID:24376830 Prg4 Rat cadmium atom multiple interactions ISO PRG4 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of PRG4 mRNA CTD PMID:35301059 Prg4 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of PRG4 mRNA CTD PMID:33453195 Prg4 Rat cadmium dichloride multiple interactions ISO PRG4 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of PRG4 mRNA CTD PMID:35301059 Prg4 Rat cadmium dichloride increases expression ISO PRG4 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of PRG4 mRNA CTD PMID:38382870 Prg4 Rat cantharidin decreases expression ISO Prg4 (Mus musculus) 6480464 Cantharidin results in decreased expression of PRG4 mRNA CTD PMID:36907384 Prg4 Rat carbon nanotube increases expression ISO Prg4 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Prg4 Rat CGP 52608 multiple interactions ISO PRG4 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to PRG4 gene] CTD PMID:28238834 Prg4 Rat copper(II) sulfate decreases expression ISO PRG4 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of PRG4 mRNA CTD PMID:19549813 Prg4 Rat cyclosporin A increases expression ISO PRG4 (Homo sapiens) 6480464 Cyclosporine results in increased expression of PRG4 mRNA CTD PMID:27989131 Prg4 Rat cyproconazole increases expression ISO Prg4 (Mus musculus) 6480464 cyproconazole results in increased expression of PRG4 mRNA CTD PMID:22334560 Prg4 Rat dexamethasone increases expression ISO Prg4 (Mus musculus) 6480464 Dexamethasone results in increased expression of PRG4 mRNA CTD PMID:22733784 Prg4 Rat diarsenic trioxide increases expression ISO PRG4 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PRG4 mRNA CTD PMID:20458559 Prg4 Rat diarsenic trioxide decreases expression ISO Prg4 (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of PRG4 mRNA CTD PMID:35676786 Prg4 Rat diclofenac increases expression ISO Prg4 (Mus musculus) 6480464 Diclofenac results in increased expression of PRG4 mRNA CTD PMID:26934552 Prg4 Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of PRG4 mRNA CTD PMID:33729688 Prg4 Rat diquat increases expression ISO Prg4 (Mus musculus) 6480464 Diquat results in increased expression of PRG4 mRNA CTD PMID:36851058 Prg4 Rat doxorubicin decreases expression ISO PRG4 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PRG4 mRNA CTD PMID:29803840 Prg4 Rat epoxiconazole increases expression ISO Prg4 (Mus musculus) 6480464 epoxiconazole results in increased expression of PRG4 mRNA CTD PMID:22334560 Prg4 Rat epoxiconazole affects expression ISO Prg4 (Mus musculus) 6480464 epoxiconazole affects the expression of PRG4 mRNA CTD PMID:35436446 Prg4 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of PRG4 mRNA CTD PMID:24793618 Prg4 Rat folic acid increases expression ISO Prg4 (Mus musculus) 6480464 Folic Acid results in increased expression of PRG4 mRNA CTD PMID:25629700 Prg4 Rat furan decreases expression EXP 6480464 furan results in decreased expression of PRG4 mRNA CTD PMID:25539665 Prg4 Rat genistein increases expression ISO Prg4 (Mus musculus) 6480464 Genistein results in increased expression of PRG4 mRNA CTD PMID:32186404 Prg4 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of PRG4 mRNA CTD PMID:33387578 Prg4 Rat isoprenaline increases expression ISO Prg4 (Mus musculus) 6480464 Isoproterenol results in increased expression of PRG4 mRNA CTD PMID:20003209 Prg4 Rat lipopolysaccharide increases expression ISO Prg4 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of PRG4 mRNA CTD PMID:27339419 Prg4 Rat lovastatin increases expression ISO PRG4 (Homo sapiens) 6480464 Lovastatin results in increased expression of PRG4 mRNA and Lovastatin results in increased expression of PRG4 protein CTD PMID:38432573 Prg4 Rat methamphetamine multiple interactions EXP 6480464 [Methamphetamine co-treated with SCH 23390] affects the expression of PRG4 mRNA CTD PMID:19564919 Prg4 Rat methamphetamine affects expression EXP 6480464 Methamphetamine affects the expression of PRG4 mRNA CTD PMID:19564919 Prg4 Rat monosodium L-glutamate multiple interactions ISO Prg4 (Mus musculus) 6480464 [Trans Fatty Acids co-treated with Sodium Glutamate] results in increased expression of PRG4 mRNA CTD PMID:22078008 Prg4 Rat monosodium L-glutamate decreases expression ISO Prg4 (Mus musculus) 6480464 Sodium Glutamate results in decreased expression of PRG4 mRNA CTD PMID:22078008 Prg4 Rat nicotine decreases expression ISO Prg4 (Mus musculus) 6480464 Nicotine results in decreased expression of PRG4 mRNA CTD PMID:33640489 Prg4 Rat paracetamol multiple interactions ISO Prg4 (Mus musculus) 6480464 PANX1 gene mutant form inhibits the reaction [Acetaminophen results in increased expression of PRG4 mRNA] CTD PMID:29246445 Prg4 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of PRG4 mRNA CTD PMID:33387578 Prg4 Rat paracetamol decreases expression ISO PRG4 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of PRG4 mRNA CTD PMID:29067470 Prg4 Rat paracetamol increases expression ISO Prg4 (Mus musculus) 6480464 Acetaminophen results in increased expression of PRG4 mRNA CTD PMID:29246445 Prg4 Rat perfluorooctane-1-sulfonic acid decreases expression ISO PRG4 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of PRG4 mRNA CTD PMID:32588087 Prg4 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Prg4 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PRG4 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of PRG4 mRNA CTD PMID:36331819 Prg4 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of PRG4 mRNA CTD PMID:35163327 Prg4 Rat phenobarbital affects expression ISO PRG4 (Homo sapiens) 6480464 Phenobarbital affects the expression of PRG4 mRNA CTD PMID:19159669 Prg4 Rat phenobarbital affects expression ISO Prg4 (Mus musculus) 6480464 Phenobarbital affects the expression of PRG4 mRNA CTD PMID:23091169 Prg4 Rat pirinixic acid multiple interactions ISO Prg4 (Mus musculus) 6480464 [pirinixic acid co-treated with PPARA] results in decreased expression of PRG4 mRNA CTD PMID:20813756 Prg4 Rat pirinixic acid decreases expression ISO Prg4 (Mus musculus) 6480464 pirinixic acid results in decreased expression of PRG4 mRNA CTD PMID:20813756 and PMID:23811191 Prg4 Rat potassium bromate affects expression ISO Prg4 (Mus musculus) 6480464 potassium bromate affects the expression of PRG4 mRNA CTD PMID:27082013 Prg4 Rat potassium bromate multiple interactions ISO Prg4 (Mus musculus) 6480464 [potassium bromate co-treated with bisphenol A] affects the expression of PRG4 mRNA more ... CTD PMID:27082013 Prg4 Rat pregnenolone 16alpha-carbonitrile increases expression ISO Prg4 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in increased expression of PRG4 mRNA CTD PMID:27413110 and PMID:28903501 Prg4 Rat propiconazole increases expression ISO Prg4 (Mus musculus) 6480464 propiconazole results in increased expression of PRG4 mRNA CTD PMID:21278054 and PMID:22334560 Prg4 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of PRG4 mRNA CTD PMID:28374803 Prg4 Rat SCH 23390 affects expression EXP 6480464 SCH 23390 affects the expression of PRG4 mRNA CTD PMID:19564919 Prg4 Rat SCH 23390 multiple interactions EXP 6480464 [Methamphetamine co-treated with SCH 23390] affects the expression of PRG4 mRNA CTD PMID:19564919 Prg4 Rat senecionine decreases expression ISO Prg4 (Mus musculus) 6480464 senecionine results in decreased expression of PRG4 protein CTD PMID:35357534 Prg4 Rat silicon dioxide increases expression ISO Prg4 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of PRG4 mRNA CTD PMID:23221170 Prg4 Rat sodium arsenite decreases expression ISO Prg4 (Mus musculus) 6480464 sodium arsenite results in decreased expression of PRG4 mRNA CTD PMID:33933676 and PMID:37682722 Prg4 Rat sodium arsenite increases expression ISO Prg4 (Mus musculus) 6480464 sodium arsenite results in increased expression of PRG4 mRNA CTD PMID:36209798 Prg4 Rat tetrachloromethane increases expression ISO Prg4 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of PRG4 mRNA CTD PMID:27339419 and PMID:31919559 Prg4 Rat titanium dioxide increases expression ISO Prg4 (Mus musculus) 6480464 titanium dioxide results in increased expression of PRG4 mRNA CTD PMID:35295148 Prg4 Rat trichloroethene decreases expression ISO Prg4 (Mus musculus) 6480464 Trichloroethylene results in decreased expression of PRG4 mRNA CTD PMID:28973375 Prg4 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of PRG4 mRNA CTD PMID:33387578 Prg4 Rat valproic acid increases expression ISO PRG4 (Homo sapiens) 6480464 Valproic Acid results in increased expression of PRG4 mRNA CTD PMID:29154799 Prg4 Rat valproic acid decreases methylation ISO PRG4 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of PRG4 gene CTD PMID:29154799 Prg4 Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of PRG4 mRNA CTD PMID:29427782
(1->4)-beta-D-glucan (ISO) (S)-nicotine (ISO) 1,2-dichloroethane (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 4,4'-sulfonyldiphenol (ISO) acetamide (EXP) acrylamide (EXP) aflatoxin B1 (ISO) alpha-Zearalanol (EXP) amphetamine (EXP) aristolochic acid A (ISO) arsenous acid (ISO) benzene-1,2,4-triol (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) Benzo[k]fluoranthene (ISO) berberine (ISO) bisphenol A (EXP,ISO) Butylbenzyl phthalate (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) cantharidin (ISO) carbon nanotube (ISO) CGP 52608 (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) cyproconazole (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) diclofenac (ISO) dioxygen (EXP) diquat (ISO) doxorubicin (ISO) epoxiconazole (ISO) flutamide (EXP) folic acid (ISO) furan (EXP) genistein (ISO) gentamycin (EXP) isoprenaline (ISO) lipopolysaccharide (ISO) lovastatin (ISO) methamphetamine (EXP) monosodium L-glutamate (ISO) nicotine (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phenobarbital (ISO) pirinixic acid (ISO) potassium bromate (ISO) pregnenolone 16alpha-carbonitrile (ISO) propiconazole (ISO) rotenone (EXP) SCH 23390 (EXP) senecionine (ISO) silicon dioxide (ISO) sodium arsenite (ISO) tetrachloromethane (ISO) titanium dioxide (ISO) trichloroethene (EXP,ISO) valproic acid (EXP,ISO)
Prg4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 65,037,363 - 65,054,764 (-) NCBI GRCr8 mRatBN7.2 13 62,487,257 - 62,504,657 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 62,487,257 - 62,504,119 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 65,133,642 - 65,150,474 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 66,404,875 - 66,421,792 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 63,666,116 - 63,683,057 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 67,672,588 - 67,688,902 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 67,672,878 - 67,688,477 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 72,637,409 - 72,653,723 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 64,753,316 - 64,769,533 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 64,767,685 - 64,783,195 (-) NCBI Celera 13 62,446,883 - 62,463,361 (-) NCBI Celera Cytogenetic Map 13 q21 NCBI
PRG4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 186,296,273 - 186,314,567 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 186,296,279 - 186,314,567 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 186,265,405 - 186,283,699 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 184,532,041 - 184,550,311 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 182,997,646 - 183,015,343 NCBI Celera 1 159,376,110 - 159,394,394 (+) NCBI Celera Cytogenetic Map 1 q31.1 NCBI HuRef 1 157,499,953 - 157,518,259 (+) NCBI HuRef CHM1_1 1 187,687,110 - 187,705,394 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 185,650,929 - 185,669,225 (+) NCBI T2T-CHM13v2.0
Prg4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 150,325,163 - 150,341,916 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 150,325,163 - 150,341,916 (-) Ensembl GRCm39 Ensembl GRCm38 1 150,449,412 - 150,466,221 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 150,449,412 - 150,466,165 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 152,296,542 - 152,313,295 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 Celera 1 152,888,564 - 152,905,057 (-) NCBI Celera Cytogenetic Map 1 G1 NCBI cM Map 1 63.84 NCBI
Prg4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955406 24,726,483 - 24,742,590 (+) NCBI ChiLan1.0 ChiLan1.0
PRG4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 63,405,212 - 63,422,384 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 63,086,639 - 63,103,818 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 161,824,271 - 161,842,031 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 165,977,437 - 165,994,170 (+) NCBI panpan1.1 PanPan1.1 panPan2
PRG4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 19,360,034 - 19,377,005 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 19,364,609 - 19,376,999 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 18,881,820 - 18,899,655 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 19,096,129 - 19,113,978 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 19,096,096 - 19,113,006 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 19,003,150 - 19,020,789 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 19,112,466 - 19,130,118 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 19,242,817 - 19,260,664 (+) NCBI UU_Cfam_GSD_1.0
Prg4
PRG4
PRG4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 43,120,523 - 43,138,886 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 43,120,618 - 43,137,441 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 44,310,416 - 44,327,902 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Prg4
.
Predicted Target Of
Count of predictions: 130 Count of miRNA genes: 98 Interacting mature miRNAs: 105 Transcripts: ENSRNOT00000068148 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1298066 Bp159 Blood pressure QTL 159 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 46088046 91088046 Rat 10755495 Bp387 Blood pressure QTL 387 3.78 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34663461 87525369 Rat 1354655 Bp241 Blood pressure QTL 241 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 56056920 101056920 Rat 70220 Bp55 Blood pressure QTL 55 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 71119 Thym2 Thymus enlargement QTL 2 3.8 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 13 46197976 84753113 Rat 61391 Bp5 Blood pressure QTL 5 5.6 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 13 22301875 67301875 Rat 4889861 Pur29 Proteinuria QTL 29 13.8 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 13 37415584 80753406 Rat 12879441 Bp396 Blood pressure QTL 396 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 45699983 90699983 Rat 619615 Bp80 Blood pressure QTL 80 0.0354 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 39754544 84754544 Rat 2303028 Bp329 Blood pressure QTL 329 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 58497872 73485113 Rat 1581570 Eae17 Experimental allergic encephalomyelitis QTL 17 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 8897350 101631289 Rat 70170 Eae14 Experimental allergic encephalomyelitis QTL 14 0.0024 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 23203448 68203448 Rat 61340 Bp25 Blood pressure QTL 25 4.2 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34535218 79535218 Rat 1581573 Uae36 Urinary albumin excretion QTL 36 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 1549897 Stresp12 Stress response QTL 12 3.35 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 13 38433408 83433408 Rat 724564 Uae11 Urinary albumin excretion QTL 11 5.7 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 13 59492522 77046890 Rat 7207885 Glom27 Glomerulus QTL 27 3.9 kidney glomerulus integrity trait (VT:0010546) kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139) 13 20605871 101339738 Rat 738026 Lnnr5 Liver neoplastic nodule remodeling QTL 5 3.29 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 13 59874408 85581182 Rat 1558644 Cm45 Cardiac mass QTL 45 3.6 0.002 heart mass (VT:0007028) heart wet weight (CMO:0000069) 13 23692969 68692969 Rat 70181 BpQTLcluster11 Blood pressure QTL cluster 11 6.922 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 13 31241331 93395974 Rat 61349 Bp31 Blood pressure QTL 31 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 2303563 Bw89 Body weight QTL 89 6 body mass (VT:0001259) body weight (CMO:0000012) 13 32284471 77284471 Rat 1354621 Rf47 Renal function QTL 47 3.7 kidney renin amount (VT:0010559) kidney renin level (CMO:0002166) 13 30395351 101056920 Rat 1581554 Pur11 Proteinuria QTL 11 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 12879477 Bp401 Blood pressure QTL 401 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 37262092 82262092 Rat 1331750 Bp220 Blood pressure QTL 220 2.98 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 13 37415584 82415584 Rat 6893338 Cm76 Cardiac mass QTL 76 0 0.99 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 13 23692969 68692969 Rat 1641901 Alcrsp6 Alcohol response QTL 6 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 13 52362171 97362171 Rat 12879475 Bp400 Blood pressure QTL 400 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 61825626 106807694 Rat 1354666 Bp244 Blood pressure QTL 244 4.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 1 101056920 Rat
RH138961
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 13 65,037,698 - 65,038,519 (+) Marker Load Pipeline mRatBN7.2 13 62,487,592 - 62,488,413 (+) MAPPER mRatBN7.2 Rnor_6.0 13 67,672,924 - 67,673,744 NCBI Rnor6.0 Rnor_5.0 13 72,637,745 - 72,638,565 UniSTS Rnor5.0 RGSC_v3.4 13 64,753,652 - 64,754,472 UniSTS RGSC3.4 Celera 13 62,447,219 - 62,448,039 UniSTS RH 3.4 Map 13 288.9 UniSTS Cytogenetic Map 13 q21 UniSTS
RH136904
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 62,488,975 - 62,489,188 (+) MAPPER mRatBN7.2 Rnor_6.0 13 67,674,307 - 67,674,519 NCBI Rnor6.0 Rnor_5.0 13 72,639,128 - 72,639,340 UniSTS Rnor5.0 RGSC_v3.4 13 64,755,035 - 64,755,247 UniSTS RGSC3.4 Celera 13 62,448,602 - 62,448,814 UniSTS Cytogenetic Map 13 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
89
91
90
59
25
59
6
218
97
69
45
56
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000068148 ⟹ ENSRNOP00000059900
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 62,487,257 - 62,504,119 (-) Ensembl Rnor_6.0 Ensembl 13 67,672,878 - 67,688,477 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000113690 ⟹ ENSRNOP00000086666
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 62,487,257 - 62,504,119 (-) Ensembl
RefSeq Acc Id:
NM_001105962 ⟹ NP_001099432
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 65,037,363 - 65,054,225 (-) NCBI mRatBN7.2 13 62,487,257 - 62,504,119 (-) NCBI Rnor_6.0 13 67,672,588 - 67,688,902 (-) NCBI Rnor_5.0 13 72,637,409 - 72,653,723 (-) NCBI RGSC_v3.4 13 64,753,316 - 64,769,533 (-) RGD Celera 13 62,446,883 - 62,463,361 (-) RGD
Sequence:
TGGAAAGACAACTCCACCGCTATCACTAAACTCGATTTTATTGAAGCTGCACATTTTTCTCTCCAGGACATGATTTAAGCCTCGCCCTGCAAGGGCGTTGCATCCAAGAACAACCATGGGGTGGAAAA
hide sequence
RefSeq Acc Id:
XM_039090463 ⟹ XP_038946391
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 65,037,538 - 65,054,764 (-) NCBI mRatBN7.2 13 62,487,386 - 62,504,657 (-) NCBI
RefSeq Acc Id:
XM_039090464 ⟹ XP_038946392
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 65,037,538 - 65,054,762 (-) NCBI mRatBN7.2 13 62,487,386 - 62,504,654 (-) NCBI
RefSeq Acc Id:
XM_039090465 ⟹ XP_038946393
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 65,037,538 - 65,054,763 (-) NCBI mRatBN7.2 13 62,487,386 - 62,504,656 (-) NCBI
RefSeq Acc Id:
XM_039090466 ⟹ XP_038946394
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 65,037,538 - 65,054,758 (-) NCBI mRatBN7.2 13 62,487,386 - 62,504,650 (-) NCBI
RefSeq Acc Id:
XM_039090467 ⟹ XP_038946395
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 65,037,538 - 65,054,756 (-) NCBI mRatBN7.2 13 62,487,386 - 62,504,648 (-) NCBI
RefSeq Acc Id:
NP_001099432 ⟸ NM_001105962
- Peptide Label:
precursor
- UniProtKB:
F1LRA5 (UniProtKB/TrEMBL)
- Sequence:
MGWKILPICLSMLLPVFLIQQVSSQDISSCAGRCGEGYSRDATCNCDYNCQHYMECCPDFKRVCTTELSCKGRCFESFARGRECDCDSQCKQYGKCCADYNSFCEEVHNPTSPPPKTAPPPPGASRTI
hide sequence
Ensembl Acc Id:
ENSRNOP00000059900 ⟸ ENSRNOT00000068148
RefSeq Acc Id:
XP_038946391 ⟸ XM_039090463
- Peptide Label:
isoform X1
- UniProtKB:
F1LRA5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038946393 ⟸ XM_039090465
- Peptide Label:
isoform X3
- UniProtKB:
F1LRA5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038946392 ⟸ XM_039090464
- Peptide Label:
isoform X2
- UniProtKB:
F1LRA5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038946394 ⟸ XM_039090466
- Peptide Label:
isoform X4
- UniProtKB:
A0A8I6A1N7 (UniProtKB/TrEMBL), F1LRA5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038946395 ⟸ XM_039090467
- Peptide Label:
isoform X5
- UniProtKB:
F1LRA5 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000086666 ⟸ ENSRNOT00000113690
RGD ID: 13698880 Promoter ID: EPDNEW_R9405 Type: single initiation site Name: Prg4_1 Description: proteoglycan 4 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 13 67,688,516 - 67,688,576 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-03-26
Prg4
proteoglycan 4
Prg4
proteoglycan 4, (megakaryocyte stimulating factor, articular superficial zone protein, camptodactyly, arthropathy, coxa vara, pericarditis syndrome)
Name changed
629549 APPROVED
2008-04-30
Prg4
proteoglycan 4, (megakaryocyte stimulating factor, articular superficial zone protein, camptodactyly, arthropathy, coxa vara, pericarditis syndrome)
Prg4_predicted
proteoglycan 4, (megakaryocyte stimulating factor, articular superficial zone protein, camptodactyly, arthropathy, coxa vara, pericarditis syndrome) (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Prg4_predicted
proteoglycan 4, (megakaryocyte stimulating factor, articular superficial zone protein, camptodactyly, arthropathy, coxa vara, pericarditis syndrome) (predicted)
Symbol and Name status set to approved
70820 APPROVED
