Symbol:
Ncbp1
Name:
nuclear cap binding protein subunit 1
RGD ID:
1308973
Description:
Predicted to enable RNA 7-methylguanosine cap binding activity; mRNA binding activity; and molecular adaptor activity. Predicted to be involved in several processes, including RNA export from nucleus; mRNA metabolic process; and positive regulation of mRNA processing. Part of nuclear cap binding activity complex. Orthologous to human NCBP1 (nuclear cap binding protein subunit 1); PARTICIPATES IN 5'-end pre-mRNA capping pathway; RNA polymerase II transcription elongation pathway; mRNA decay pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
80 kDa nuclear cap-binding protein; CBP80; LOC298075; MGC105807; NCBP 80 kDa subunit; nuclear cap binding protein subunit 1, 80kDa; nuclear cap-binding protein subunit 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NCBP1 (nuclear cap binding protein subunit 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Ncbp1 (nuclear cap binding protein subunit 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ncbp1 (nuclear cap binding protein subunit 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NCBP1 (nuclear cap binding protein subunit 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NCBP1 (nuclear cap binding protein subunit 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ncbp1 (nuclear cap binding protein subunit 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NCBP1 (nuclear cap binding protein subunit 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NCBP1 (nuclear cap binding protein subunit 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ncbp1 (nuclear cap binding protein subunit 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
NCBP1 (nuclear cap binding protein subunit 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Ncbp1 (nuclear cap binding protein subunit 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
ncbp-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Cbp80
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
STO1
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
ncbp1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 65,211,632 - 65,244,532 (+) NCBI GRCr8 mRatBN7.2 5 60,416,023 - 60,449,004 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 60,415,982 - 60,449,089 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 62,388,411 - 62,420,896 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 64,207,914 - 64,240,399 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 64,177,167 - 64,209,652 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 61,734,118 - 61,767,098 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 61,734,118 - 61,766,481 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 66,250,579 - 66,283,560 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 62,691,068 - 62,723,436 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 62,691,246 - 62,723,612 (+) NCBI Celera 5 58,976,747 - 59,009,113 (+) NCBI Celera Cytogenetic Map 5 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ncbp1 Rat (-)-demecolcine decreases expression ISO NCBP1 (Homo sapiens) 6480464 Demecolcine results in decreased expression of NCBP1 mRNA CTD PMID:23649840 Ncbp1 Rat 1,2-dimethylhydrazine increases expression ISO Ncbp1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of NCBP1 mRNA CTD PMID:22206623 Ncbp1 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Ncbp1 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Ncbp1 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO NCBP1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Ncbp1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases phosphorylation EXP 6480464 Tetrachlorodibenzodioxin results in increased phosphorylation of NCBP1 protein CTD PMID:23298284 Ncbp1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of NCBP1 mRNA CTD PMID:33387578 Ncbp1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of NCBP1 mRNA CTD PMID:21346803 Ncbp1 Rat 2-hydroxypropanoic acid decreases expression ISO NCBP1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of NCBP1 mRNA CTD PMID:30851411 Ncbp1 Rat 2-methylcholine affects expression ISO NCBP1 (Homo sapiens) 6480464 beta-methylcholine affects the expression of NCBP1 mRNA CTD PMID:21179406 Ncbp1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of NCBP1 mRNA CTD PMID:30047161 Ncbp1 Rat actinomycin D multiple interactions ISO NCBP1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of NCBP1 protein CTD PMID:38460933 Ncbp1 Rat aflatoxin B1 decreases methylation ISO NCBP1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of NCBP1 gene CTD PMID:27153756 Ncbp1 Rat all-trans-retinoic acid decreases expression ISO NCBP1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of NCBP1 mRNA CTD PMID:23724009 Ncbp1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of NCBP1 mRNA CTD PMID:30047161 Ncbp1 Rat aristolochic acid A decreases expression ISO NCBP1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of NCBP1 mRNA CTD PMID:33212167 Ncbp1 Rat benzatropine decreases expression ISO NCBP1 (Homo sapiens) 6480464 Benztropine results in decreased expression of NCBP1 protein CTD PMID:34122009 Ncbp1 Rat benzo[a]pyrene affects methylation ISO NCBP1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of NCBP1 intron CTD PMID:30157460 Ncbp1 Rat benzo[e]pyrene increases methylation ISO NCBP1 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of NCBP1 intron CTD PMID:30157460 Ncbp1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of NCBP1 mRNA CTD PMID:25181051 Ncbp1 Rat bisphenol A multiple interactions ISO NCBP1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of NCBP1 gene CTD PMID:31601247 Ncbp1 Rat bisphenol A decreases expression ISO NCBP1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of NCBP1 mRNA and bisphenol A results in decreased expression of NCBP1 protein CTD PMID:29275510 and PMID:37567409 Ncbp1 Rat bisphenol AF increases expression ISO NCBP1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of NCBP1 protein CTD PMID:34186270 Ncbp1 Rat Bisphenol B increases expression ISO NCBP1 (Homo sapiens) 6480464 bisphenol B results in increased expression of NCBP1 protein CTD PMID:34186270 Ncbp1 Rat bisphenol F increases expression ISO NCBP1 (Homo sapiens) 6480464 bisphenol F results in increased expression of NCBP1 protein CTD PMID:34186270 Ncbp1 Rat carbon nanotube increases expression ISO Ncbp1 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of NCBP1 mRNA CTD PMID:25554681 Ncbp1 Rat chlorpyrifos decreases expression ISO Ncbp1 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of NCBP1 mRNA CTD PMID:37019170 Ncbp1 Rat chromium(6+) affects expression ISO Ncbp1 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of NCBP1 mRNA CTD PMID:28472532 Ncbp1 Rat clozapine decreases expression ISO NCBP1 (Homo sapiens) 6480464 Clozapine results in decreased expression of NCBP1 protein CTD PMID:34122009 Ncbp1 Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of NCBP1 mRNA CTD PMID:20187946 Ncbp1 Rat coumestrol increases expression ISO NCBP1 (Homo sapiens) 6480464 Coumestrol results in increased expression of NCBP1 mRNA CTD PMID:19167446 Ncbp1 Rat Cuprizon decreases expression ISO NCBP1 (Homo sapiens) 6480464 Cuprizone results in decreased expression of NCBP1 protein CTD PMID:34122009 Ncbp1 Rat DDE increases expression ISO NCBP1 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of NCBP1 mRNA CTD PMID:38568856 Ncbp1 Rat dibenzo[a,l]pyrene decreases expression ISO Ncbp1 (Mus musculus) 6480464 dibenzo(a and l)pyrene results in decreased expression of NCBP1 mRNA CTD PMID:25908611 Ncbp1 Rat dibutyl phthalate decreases expression ISO Ncbp1 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of NCBP1 mRNA CTD PMID:17361019 and PMID:21266533 Ncbp1 Rat enzyme inhibitor multiple interactions ISO NCBP1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of NCBP1 protein CTD PMID:23301498 Ncbp1 Rat ethanol affects splicing ISO Ncbp1 (Mus musculus) 6480464 Ethanol affects the splicing of NCBP1 mRNA CTD PMID:30319688 Ncbp1 Rat ethyl methanesulfonate decreases expression ISO NCBP1 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of NCBP1 mRNA CTD PMID:23649840 Ncbp1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of NCBP1 mRNA CTD PMID:24136188 Ncbp1 Rat formaldehyde decreases expression ISO NCBP1 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of NCBP1 mRNA CTD PMID:23649840 Ncbp1 Rat FR900359 decreases phosphorylation ISO NCBP1 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of NCBP1 protein CTD PMID:37730182 Ncbp1 Rat fulvestrant multiple interactions ISO NCBP1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of NCBP1 gene CTD PMID:31601247 Ncbp1 Rat gemcitabine increases expression ISO NCBP1 (Homo sapiens) 6480464 Gemcitabine results in increased expression of NCBP1 mRNA CTD PMID:17039268 Ncbp1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of NCBP1 mRNA CTD PMID:22061828 Ncbp1 Rat hydrogen peroxide affects expression ISO NCBP1 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of NCBP1 mRNA CTD PMID:20044591 Ncbp1 Rat inulin multiple interactions ISO Ncbp1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of NCBP1 mRNA CTD PMID:36331819 Ncbp1 Rat ivermectin decreases expression ISO NCBP1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of NCBP1 protein CTD PMID:32959892 Ncbp1 Rat lead(0) affects expression ISO NCBP1 (Homo sapiens) 6480464 Lead affects the expression of NCBP1 mRNA CTD PMID:28903495 Ncbp1 Rat mercury dichloride decreases expression EXP 6480464 Mercuric Chloride results in decreased expression of NCBP1 mRNA CTD PMID:16507785 Ncbp1 Rat methapyrilene increases methylation ISO NCBP1 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of NCBP1 intron CTD PMID:30157460 Ncbp1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of NCBP1 mRNA CTD PMID:30047161 Ncbp1 Rat methyl methanesulfonate decreases expression ISO NCBP1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of NCBP1 mRNA CTD PMID:23649840 Ncbp1 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of NCBP1 mRNA CTD PMID:24136188 Ncbp1 Rat nitrates multiple interactions ISO Ncbp1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of NCBP1 mRNA CTD PMID:35964746 Ncbp1 Rat Nutlin-3 multiple interactions ISO NCBP1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of NCBP1 protein CTD PMID:38460933 Ncbp1 Rat ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of NCBP1 mRNA CTD PMID:18417182 Ncbp1 Rat oxaliplatin decreases expression ISO NCBP1 (Homo sapiens) 6480464 oxaliplatin results in decreased expression of NCBP1 mRNA CTD PMID:17762391 Ncbp1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of NCBP1 mRNA CTD PMID:25729387 Ncbp1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Ncbp1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of NCBP1 mRNA CTD PMID:36331819 Ncbp1 Rat rac-lactic acid decreases expression ISO NCBP1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of NCBP1 mRNA CTD PMID:30851411 Ncbp1 Rat resveratrol decreases expression ISO Ncbp1 (Mus musculus) 6480464 resveratrol results in decreased expression of NCBP1 protein CTD PMID:25505154 Ncbp1 Rat resveratrol multiple interactions ISO NCBP1 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of NCBP1 mRNA CTD PMID:23557933 Ncbp1 Rat sodium arsenite decreases expression ISO NCBP1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of NCBP1 mRNA CTD PMID:38568856 Ncbp1 Rat sodium arsenite increases activity ISO NCBP1 (Homo sapiens) 6480464 sodium arsenite results in increased activity of NCBP1 protein CTD PMID:30528433 Ncbp1 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of NCBP1 mRNA CTD PMID:30047161 Ncbp1 Rat tetrachloromethane increases expression ISO Ncbp1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of NCBP1 mRNA CTD PMID:27339419 and PMID:31919559 Ncbp1 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of NCBP1 mRNA CTD PMID:31150632 Ncbp1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of NCBP1 mRNA CTD PMID:34492290 Ncbp1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of NCBP1 mRNA CTD PMID:25729387 Ncbp1 Rat Tributyltin oxide decreases phosphorylation ISO Ncbp1 (Mus musculus) 6480464 bis(tri-n-butyltin)oxide results in decreased phosphorylation of NCBP1 protein CTD PMID:22174045 Ncbp1 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of NCBP1 mRNA CTD PMID:33387578 Ncbp1 Rat trimellitic anhydride increases expression ISO Ncbp1 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of NCBP1 mRNA CTD PMID:19042947 Ncbp1 Rat triphenyl phosphate affects expression ISO NCBP1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of NCBP1 mRNA CTD PMID:37042841 Ncbp1 Rat Triptolide increases expression ISO Ncbp1 (Mus musculus) 6480464 triptolide results in increased expression of NCBP1 mRNA CTD PMID:32835833 Ncbp1 Rat urethane decreases expression ISO NCBP1 (Homo sapiens) 6480464 Urethane results in decreased expression of NCBP1 mRNA CTD PMID:28818685 Ncbp1 Rat valproic acid decreases methylation ISO NCBP1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of NCBP1 gene CTD PMID:29154799 Ncbp1 Rat valproic acid increases expression ISO NCBP1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of NCBP1 mRNA CTD PMID:23179753 Ncbp1 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of NCBP1 mRNA CTD PMID:23034163 Ncbp1 Rat vincristine decreases expression ISO NCBP1 (Homo sapiens) 6480464 Vincristine results in decreased expression of NCBP1 mRNA CTD PMID:23649840 Ncbp1 Rat Yessotoxin decreases expression ISO NCBP1 (Homo sapiens) 6480464 yessotoxin analog results in decreased expression of NCBP1 mRNA CTD PMID:30679557
Imported Annotations - KEGG (archival)
(-)-demecolcine (ISO) 1,2-dimethylhydrazine (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,6-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 2-methylcholine (ISO) 6-propyl-2-thiouracil (EXP) actinomycin D (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) aristolochic acid A (ISO) benzatropine (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) carbon nanotube (ISO) chlorpyrifos (ISO) chromium(6+) (ISO) clozapine (ISO) cocaine (EXP) coumestrol (ISO) Cuprizon (ISO) DDE (ISO) dibenzo[a,l]pyrene (ISO) dibutyl phthalate (ISO) enzyme inhibitor (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) flutamide (EXP) formaldehyde (ISO) FR900359 (ISO) fulvestrant (ISO) gemcitabine (ISO) gentamycin (EXP) hydrogen peroxide (ISO) inulin (ISO) ivermectin (ISO) lead(0) (ISO) mercury dichloride (EXP) methapyrilene (ISO) methimazole (EXP) methyl methanesulfonate (ISO) nefazodone (EXP) nitrates (ISO) Nutlin-3 (ISO) ochratoxin A (EXP) oxaliplatin (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) rac-lactic acid (ISO) resveratrol (ISO) sodium arsenite (ISO) sulfadimethoxine (EXP) tetrachloromethane (EXP,ISO) thioacetamide (EXP) topotecan (EXP) Tributyltin oxide (ISO) trichloroethene (EXP) trimellitic anhydride (ISO) triphenyl phosphate (ISO) Triptolide (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (EXP) vincristine (ISO) Yessotoxin (ISO)
Biological Process
7-methylguanosine mRNA capping (IEA,ISO,ISS) biological_process (ND) defense response to virus (ISO) histone mRNA metabolic process (ISO) mRNA export from nucleus (IBA,IEA,ISO,ISS) mRNA metabolic process (ISO,ISS) mRNA transcription by RNA polymerase II (ISO) nuclear-transcribed mRNA catabolic process, nonsense-mediated decay (IBA,ISO,ISS) positive regulation of cell growth (ISO,ISS) positive regulation of mRNA 3'-end processing (ISO,ISS) positive regulation of mRNA splicing, via spliceosome (ISO) regulation of mRNA processing (IBA) regulation of translational initiation (ISO,ISS) regulatory ncRNA-mediated gene silencing (IEA) RNA catabolic process (ISO) RNA metabolic process (IEA) RNA splicing (IEA) snRNA export from nucleus (ISO) spliceosomal complex assembly (ISO)
Cellular Component
cytoplasm (ISO) cytosol (IEA,ISO) mitochondrion (IEA,ISO) nuclear cap binding complex (IBA,IDA,IEA,ISO,ISS) nucleoplasm (IEA,ISO) nucleus (IBA,IEA,ISO,ISS) ribonucleoprotein complex (ISO,ISS) RNA cap binding complex (ISO)
Ncbp1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 65,211,632 - 65,244,532 (+) NCBI GRCr8 mRatBN7.2 5 60,416,023 - 60,449,004 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 60,415,982 - 60,449,089 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 62,388,411 - 62,420,896 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 64,207,914 - 64,240,399 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 64,177,167 - 64,209,652 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 61,734,118 - 61,767,098 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 61,734,118 - 61,766,481 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 66,250,579 - 66,283,560 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 62,691,068 - 62,723,436 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 62,691,246 - 62,723,612 (+) NCBI Celera 5 58,976,747 - 59,009,113 (+) NCBI Celera Cytogenetic Map 5 q22 NCBI
NCBP1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 97,633,821 - 97,673,748 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 97,633,668 - 97,673,748 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 100,396,103 - 100,436,030 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 99,435,526 - 99,475,851 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 97,475,462 - 97,513,466 NCBI Celera 9 70,909,962 - 70,950,264 (+) NCBI Celera Cytogenetic Map 9 q22.33 NCBI HuRef 9 69,996,714 - 70,037,070 (+) NCBI HuRef CHM1_1 9 100,542,138 - 100,582,465 (+) NCBI CHM1_1 T2T-CHM13v2.0 9 109,805,762 - 109,845,689 (+) NCBI T2T-CHM13v2.0
Ncbp1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 46,138,732 - 46,172,403 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 46,138,613 - 46,172,403 (+) Ensembl GRCm39 Ensembl GRCm38 4 46,138,511 - 46,172,403 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 46,138,613 - 46,172,403 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 46,151,383 - 46,185,275 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 46,159,622 - 46,193,157 (+) NCBI MGSCv36 mm8 Celera 4 46,160,651 - 46,194,542 (+) NCBI Celera Cytogenetic Map 4 B1 NCBI cM Map 4 24.49 NCBI
Ncbp1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955419 27,778,300 - 27,819,878 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955419 27,778,300 - 27,819,878 (-) NCBI ChiLan1.0 ChiLan1.0
NCBP1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 41,783,460 - 41,823,887 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 41,785,715 - 41,826,532 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 68,724,176 - 68,764,423 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 96,845,422 - 96,885,624 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 96,845,422 - 96,885,624 (+) Ensembl panpan1.1 panPan2
NCBP1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 11 54,938,250 - 54,974,536 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 11 54,938,372 - 54,974,547 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 11 53,372,453 - 53,408,740 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 11 56,050,831 - 56,087,132 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 11 56,050,630 - 56,087,132 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 11 54,547,195 - 54,583,482 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 11 54,577,067 - 54,613,371 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 11 55,273,732 - 55,310,040 (+) NCBI UU_Cfam_GSD_1.0
Ncbp1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 169,882,087 - 169,917,455 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936524 6,429,185 - 6,465,035 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936524 6,429,735 - 6,465,035 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NCBP1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 239,492,721 - 239,535,825 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 239,492,573 - 239,543,925 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 267,580,587 - 267,659,128 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NCBP1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 12 41,736,063 - 41,776,178 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 41,738,579 - 41,776,509 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 38,789,120 - 38,829,181 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ncbp1
.
Predicted Target Of
Count of predictions: 382 Count of miRNA genes: 222 Interacting mature miRNAs: 271 Transcripts: ENSRNOT00000030825 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578776 Stresp18 Stress response QTL 18 2.9 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 5 27955440 72955440 Rat 1298067 Scl15 Serum cholesterol level QTL 15 4.8 0.001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 33215665 78215665 Rat 1300115 Hrtrt7 Heart rate QTL 7 2.76 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 5 47869062 90099692 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 1358353 Srcrtb2 Stress Responsive Cort Basal QTL 2 3.48 0.003 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 18873947 74251464 Rat 634305 Mamtr1 Mammary tumor resistance QTL 1 0.0001 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 12789751 113558310 Rat 61386 Bp49 Blood pressure QTL 49 16.6 cerebrum integrity trait (VT:0010549) brain infarction volume (CMO:0001013) 5 60293434 98603051 Rat 1331801 Rf33 Renal function QTL 33 4.149 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 43726656 129132602 Rat 1598807 Glom12 Glomerulus QTL 12 2.7 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 5 33215665 78215665 Rat 1302786 Kidm8 Kidney mass QTL 8 28.15 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 5 33215665 78215665 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 6903292 Stl28 Serum triglyceride level QTL 28 2.6 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 5 28515489 73515489 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 1578767 Stresp17 Stress response QTL 17 4.3 0.01 blood aldosterone amount (VT:0005346) plasma aldosterone level (CMO:0000551) 5 27955440 72955440 Rat 7411561 Bw134 Body weight QTL 134 24 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 49463600 94463600 Rat 1641922 Alcrsp8 Alcohol response QTL 8 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 5 35189153 68564008 Rat 2303615 Vencon7 Ventilatory control QTL 7 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 5 50983895 95983895 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 6903306 Scl35 Serum cholesterol QTL 35 2.6 0.0073 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 28515489 73515489 Rat 1576317 Eutr2 Estrogen induced uterine response QTL 2 0.01 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 34730116 104251008 Rat 7394712 Emca13 Estrogen-induced mammary cancer QTL 13 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 9823266 99753708 Rat 1331773 Scl26 Serum cholesterol level QTL 26 3.065 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 43726656 86724018 Rat 70189 Mcs5 Mammary carcinoma susceptibility QTL 5 10.51 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 55805606 132207589 Rat 1331771 Rf35 Renal function QTL 35 4.36965 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 729470 86724018 Rat 61359 Eaex Experimental allergic encephalomyelitis QTL x 3 nervous system integrity trait (VT:0010566) post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422) 5 55715622 100715622 Rat 8662454 Vetf3 Vascular elastic tissue fragility QTL 3 27.4 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 5 2282226 69540447 Rat 2290448 Scl54 Serum cholesterol level QTL 54 2.93 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 31663789 131345958 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 9589025 Epfw7 Epididymal fat weight QTL 7 20.66 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 5 49463600 94463600 Rat 2303574 Gluco42 Glucose level QTL 42 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 53496719 98496719 Rat 1331756 Rf34 Renal function QTL 34 4.16275 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 1 90450412 Rat 8552954 Pigfal14 Plasma insulin-like growth factor 1 level QTL 14 9 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 21226744 66226744 Rat 2316954 Rf57 Renal function QTL 57 0 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 5 59793528 90450144 Rat 1358895 Bp254 Blood pressure QTL 254 3.6 0.0003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 58829236 128034027 Rat 2316959 Gluco59 Glucose level QTL 59 4.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 34944474 113558310 Rat 1600358 Mamtr5 Mammary tumor resistance QTL 5 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 18873947 63873947 Rat 2316957 Pur21 Proteinuria QTL 21 6.2 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 5 59793528 113558156 Rat
RH130418
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 60,448,117 - 60,448,322 (+) MAPPER mRatBN7.2 Rnor_6.0 5 61,766,212 - 61,766,416 NCBI Rnor6.0 Rnor_5.0 5 66,282,674 - 66,282,878 UniSTS Rnor5.0 RGSC_v3.4 5 62,723,164 - 62,723,368 UniSTS RGSC3.4 Celera 5 59,008,841 - 59,009,045 UniSTS RH 3.4 Map 5 381.7 UniSTS Cytogenetic Map 5 q22 UniSTS
RH132739
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 60,448,546 - 60,448,738 (+) MAPPER mRatBN7.2 Rnor_6.0 5 61,766,641 - 61,766,832 NCBI Rnor6.0 Rnor_5.0 5 66,283,103 - 66,283,294 UniSTS Rnor5.0 RGSC_v3.4 5 62,723,593 - 62,723,784 UniSTS RGSC3.4 Celera 5 59,009,270 - 59,009,461 UniSTS RH 3.4 Map 5 379.2 UniSTS Cytogenetic Map 5 q22 UniSTS
BE108357
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 60,448,117 - 60,448,273 (+) MAPPER mRatBN7.2 Rnor_6.0 5 61,766,212 - 61,766,367 NCBI Rnor6.0 Rnor_5.0 5 66,282,674 - 66,282,829 UniSTS Rnor5.0 RGSC_v3.4 5 62,723,164 - 62,723,319 UniSTS RGSC3.4 Celera 5 59,008,841 - 59,008,996 UniSTS RH 3.4 Map 5 389.2 UniSTS Cytogenetic Map 5 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000030825 ⟹ ENSRNOP00000038713
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 60,415,982 - 60,448,386 (+) Ensembl Rnor_6.0 Ensembl 5 61,734,118 - 61,766,481 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000094126 ⟹ ENSRNOP00000086621
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 60,421,777 - 60,449,089 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000109965 ⟹ ENSRNOP00000077595
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 60,415,987 - 60,449,089 (+) Ensembl
RefSeq Acc Id:
NM_001014785 ⟹ NP_001014785
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 65,211,632 - 65,243,998 (+) NCBI mRatBN7.2 5 60,416,023 - 60,448,390 (+) NCBI Rnor_6.0 5 61,734,118 - 61,766,484 (+) NCBI Rnor_5.0 5 66,250,579 - 66,283,560 (+) NCBI RGSC_v3.4 5 62,691,068 - 62,723,436 (+) RGD Celera 5 58,976,747 - 59,009,113 (+) RGD
Sequence:
CCGGCAGCCCGACGGTTCTGGTGTTGCAGGCGACCCGCAACTCAGATCCGCTGCGCATCAGCAAGCAGCATGTCGCGGAGGCGGCACAGCTACGAGAACGATGGTGGACAACCTCACAAAAGGAGGAA
hide sequence
RefSeq Acc Id:
XM_006238037 ⟹ XP_006238099
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 65,218,808 - 65,244,532 (+) NCBI mRatBN7.2 5 60,423,198 - 60,449,004 (+) NCBI Rnor_6.0 5 61,741,301 - 61,767,098 (+) NCBI Rnor_5.0 5 66,250,579 - 66,283,560 (+) NCBI
Sequence:
GCTCTTTAGAGAGCAATCTCGAAGGCCTGGCTGGTGTTTTAGAAGCTGATCTTCCTAACTACAA
hide sequence
RefSeq Acc Id:
NP_001014785 ⟸ NM_001014785
- UniProtKB:
Q56A27 (UniProtKB/Swiss-Prot), A6IJB1 (UniProtKB/TrEMBL), A0A8I6GF54 (UniProtKB/TrEMBL)
- Sequence:
MSRRRHSYENDGGQPHKRRKTSDANETEDHLESLICKVGEKSACSLESNLEGLAGVLEADLPNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYNFGGEFVEAMIRQLKESLKANNYNEAVYLV
hide sequence
RefSeq Acc Id:
XP_006238099 ⟸ XM_006238037
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6GF54 (UniProtKB/TrEMBL)
- Sequence:
MIRQLKESLKANNYNEAVYLVRFLSDLVNCHVIAAPSMVAMFENFVSVTQEEDVPQVRRDWYVY
hide sequence
Ensembl Acc Id:
ENSRNOP00000038713 ⟸ ENSRNOT00000030825
Ensembl Acc Id:
ENSRNOP00000086621 ⟸ ENSRNOT00000094126
Ensembl Acc Id:
ENSRNOP00000077595 ⟸ ENSRNOT00000109965
RGD ID: 13693710 Promoter ID: EPDNEW_R4234 Type: multiple initiation site Name: Ncbp1_1 Description: nuclear cap binding protein subunit 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 61,734,081 - 61,734,141 EPDNEW
BioCyc Gene G2FUF-41415 BioCyc
Ensembl Genes ENSRNOG00000023605 Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript ENSRNOT00000030825.5 UniProtKB/TrEMBL
ENSRNOT00000094126.1 UniProtKB/TrEMBL
ENSRNOT00000109965.1 UniProtKB/Swiss-Prot
Gene3D-CATH 1.25.40.180 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE IMAGE:7314745 IMAGE-MGC_LOAD
InterPro ARM-type_fold UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
CBP80 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MIF4G-like_typ-1 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MIF4G-like_typ-2 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MIF4G-like_typ-3 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report rno:298075 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE MGC:105807 IMAGE-MGC_LOAD
NCBI Gene 298075 ENTREZGENE
PANTHER NUCLEAR CAP-BINDING PROTEIN SUBUNIT 1 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PTHR12412 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam MIF4G UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MIF4G_like UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MIF4G_like_2 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen Ncbp1 PhenoGen
RatGTEx ENSRNOG00000023605 RatGTEx
SMART MIF4G UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP SSF48371 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt A0A8I6GF54 ENTREZGENE, UniProtKB/TrEMBL
A0A8L2QJC8_RAT UniProtKB/TrEMBL
A6IJB1 ENTREZGENE, UniProtKB/TrEMBL
NCBP1_RAT UniProtKB/Swiss-Prot, ENTREZGENE
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2011-04-27
Ncbp1
nuclear cap binding protein subunit 1
Ncbp1
nuclear cap binding protein subunit 1, 80kDa
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Ncbp1
nuclear cap binding protein subunit 1, 80kDa
Ncbp1_predicted
nuclear cap binding protein subunit 1, 80kDa (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Ncbp1_predicted
nuclear cap binding protein subunit 1, 80kDa (predicted)
Symbol and Name status set to approved
70820 APPROVED
