Symbol:
Mrpl50
Name:
mitochondrial ribosomal protein L50
RGD ID:
1308008
Description:
Predicted to be located in cytosol and mitochondrion. Predicted to be part of mitochondrial large ribosomal subunit. Orthologous to human MRPL50 (mitochondrial ribosomal protein L50); INTERACTS WITH alpha-Zearalanol; amitrole; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
39S ribosomal protein L50, mitochondrial; large ribosomal subunit protein mL50; LOC362517
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 68,662,933 - 68,668,087 (-) NCBI GRCr8 mRatBN7.2 5 63,867,437 - 63,872,591 (-) NCBI mRatBN7.2 mRatBN7.2 UTH_Rnor_SHR_Utx 5 65,798,163 - 65,803,310 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 67,617,495 - 67,622,642 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 67,586,875 - 67,592,022 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 64,784,164 - 64,789,318 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 64,784,170 - 64,789,318 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 69,275,573 - 69,280,730 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 66,261,553 - 66,266,710 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 66,267,116 - 66,271,803 (-) NCBI Celera 5 63,735,392 - 63,740,545 (+) NCBI Celera Cytogenetic Map 5 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mrpl50 Rat (+)-dexrazoxane multiple interactions ISO Mrpl50 (Mus musculus) 6480464 [Doxorubicin co-treated with Dexrazoxane] results in increased expression of MRPL50 mRNA CTD PMID:26873546 Mrpl50 Rat (1->4)-beta-D-glucan multiple interactions ISO Mrpl50 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of MRPL50 mRNA CTD PMID:36331819 Mrpl50 Rat 1,2-dimethylhydrazine multiple interactions ISO Mrpl50 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of MRPL50 mRNA CTD PMID:22206623 Mrpl50 Rat 1,2-dimethylhydrazine decreases expression ISO Mrpl50 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of MRPL50 mRNA CTD PMID:22206623 Mrpl50 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Mrpl50 (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to MRPL50 promoter] CTD PMID:19654925 Mrpl50 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO MRPL50 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of MRPL50 mRNA CTD PMID:20106945 and PMID:21632981 Mrpl50 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Mrpl50 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MRPL50 mRNA CTD PMID:21570461 Mrpl50 Rat 4,4'-sulfonyldiphenol increases expression ISO Mrpl50 (Mus musculus) 6480464 bisphenol S results in increased expression of MRPL50 mRNA CTD PMID:39298647 Mrpl50 Rat 4,4'-sulfonyldiphenol multiple interactions ISO MRPL50 (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in increased methylation of MRPL50 gene CTD PMID:31601247 Mrpl50 Rat aflatoxin B1 increases methylation ISO MRPL50 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of MRPL50 gene CTD PMID:27153756 Mrpl50 Rat all-trans-retinoic acid decreases expression ISO MRPL50 (Homo sapiens) 6480464 Tretinoin results in decreased expression of MRPL50 mRNA CTD PMID:21934132 and PMID:33167477 Mrpl50 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of MRPL50 mRNA CTD PMID:35163327 Mrpl50 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of MRPL50 mRNA CTD PMID:30047161 Mrpl50 Rat Aroclor 1254 decreases expression ISO Mrpl50 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of MRPL50 mRNA CTD PMID:23650126 Mrpl50 Rat arsenite(3-) increases expression ISO Mrpl50 (Mus musculus) 6480464 arsenite results in increased expression of MRPL50 protein CTD PMID:37955338 Mrpl50 Rat arsenite(3-) multiple interactions ISO MRPL50 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to MRPL50 mRNA] CTD PMID:32406909 Mrpl50 Rat benzo[a]pyrene decreases expression ISO MRPL50 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of MRPL50 mRNA CTD PMID:26238291 Mrpl50 Rat benzo[a]pyrene diol epoxide I decreases expression ISO MRPL50 (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 Mrpl50 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Mrpl50 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of MRPL50 mRNA CTD PMID:28085963 Mrpl50 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MRPL50 mRNA CTD PMID:25181051 Mrpl50 Rat bisphenol A decreases expression ISO MRPL50 (Homo sapiens) 6480464 bisphenol A results in decreased expression of MRPL50 mRNA CTD PMID:29275510 Mrpl50 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of MRPL50 gene CTD PMID:28505145 Mrpl50 Rat cadmium dichloride increases expression ISO MRPL50 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of MRPL50 mRNA CTD PMID:26472689 Mrpl50 Rat cadmium dichloride decreases expression ISO MRPL50 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of MRPL50 mRNA CTD PMID:38568856 Mrpl50 Rat carbon nanotube increases expression ISO Mrpl50 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Mrpl50 Rat chloropicrin decreases expression ISO MRPL50 (Homo sapiens) 6480464 chloropicrin results in decreased expression of MRPL50 mRNA CTD PMID:28476498 Mrpl50 Rat chromium(6+) affects expression ISO Mrpl50 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of MRPL50 mRNA CTD PMID:28472532 Mrpl50 Rat ciguatoxin CTX1B affects expression ISO Mrpl50 (Mus musculus) 6480464 Ciguatoxins affects the expression of MRPL50 mRNA CTD PMID:18353800 Mrpl50 Rat cyclosporin A decreases expression ISO MRPL50 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of MRPL50 mRNA CTD PMID:25562108 Mrpl50 Rat cylindrospermopsin increases expression ISO MRPL50 (Homo sapiens) 6480464 cylindrospermopsin results in increased expression of MRPL50 mRNA CTD PMID:24921660 Mrpl50 Rat Dibutyl phosphate affects expression ISO MRPL50 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of MRPL50 mRNA CTD PMID:37042841 Mrpl50 Rat dicrotophos decreases expression ISO MRPL50 (Homo sapiens) 6480464 dicrotophos results in decreased expression of MRPL50 mRNA CTD PMID:28302478 Mrpl50 Rat dorsomorphin multiple interactions ISO MRPL50 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Mrpl50 Rat doxorubicin multiple interactions ISO Mrpl50 (Mus musculus) 6480464 [Doxorubicin co-treated with Dexrazoxane] results in increased expression of MRPL50 mRNA CTD PMID:26873546 Mrpl50 Rat doxorubicin decreases expression ISO Mrpl50 (Mus musculus) 6480464 Doxorubicin results in decreased expression of MRPL50 mRNA CTD PMID:26873546 Mrpl50 Rat enzyme inhibitor multiple interactions ISO MRPL50 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of MRPL50 protein CTD PMID:23301498 Mrpl50 Rat ethanol affects expression ISO Mrpl50 (Mus musculus) 6480464 Ethanol affects the expression of MRPL50 mRNA CTD PMID:30319688 Mrpl50 Rat ethyl methanesulfonate decreases expression ISO MRPL50 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of MRPL50 mRNA CTD PMID:23649840 Mrpl50 Rat fenthion decreases expression ISO Mrpl50 (Mus musculus) 6480464 Fenthion results in decreased expression of MRPL50 mRNA CTD PMID:34813904 Mrpl50 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of MRPL50 mRNA CTD PMID:24136188 Mrpl50 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of MRPL50 mRNA CTD PMID:24136188 Mrpl50 Rat folic acid decreases expression ISO Mrpl50 (Mus musculus) 6480464 Folic Acid results in decreased expression of MRPL50 mRNA CTD PMID:25629700 Mrpl50 Rat folic acid multiple interactions ISO Mrpl50 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of MRPL50 mRNA CTD PMID:22206623 Mrpl50 Rat fulvestrant multiple interactions ISO MRPL50 (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in increased methylation of MRPL50 gene CTD PMID:31601247 Mrpl50 Rat ivermectin decreases expression ISO MRPL50 (Homo sapiens) 6480464 Ivermectin results in decreased expression of MRPL50 protein CTD PMID:32959892 Mrpl50 Rat ketamine decreases expression EXP 6480464 Ketamine results in decreased expression of MRPL50 mRNA CTD PMID:20080153 Mrpl50 Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of MRPL50 mRNA CTD PMID:24136188 Mrpl50 Rat lipopolysaccharide increases expression ISO MRPL50 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of MRPL50 mRNA CTD PMID:31059760 Mrpl50 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of MRPL50 mRNA CTD PMID:30047161 Mrpl50 Rat methyl methanesulfonate decreases expression ISO MRPL50 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of MRPL50 mRNA CTD PMID:23649840 Mrpl50 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of MRPL50 mRNA CTD PMID:24136188 Mrpl50 Rat nickel atom increases expression ISO MRPL50 (Homo sapiens) 6480464 Nickel results in increased expression of MRPL50 mRNA CTD PMID:25583101 Mrpl50 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of MRPL50 mRNA CTD PMID:24136188 Mrpl50 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of MRPL50 mRNA CTD PMID:25729387 Mrpl50 Rat paracetamol affects expression ISO Mrpl50 (Mus musculus) 6480464 Acetaminophen affects the expression of MRPL50 mRNA CTD PMID:17562736 Mrpl50 Rat paracetamol increases expression ISO MRPL50 (Homo sapiens) 6480464 Acetaminophen results in increased expression of MRPL50 mRNA CTD PMID:31059760 Mrpl50 Rat paracetamol decreases expression ISO MRPL50 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of MRPL50 mRNA CTD PMID:25704631 Mrpl50 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Mrpl50 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of MRPL50 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of MRPL50 mRNA CTD PMID:36331819 Mrpl50 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of MRPL50 mRNA CTD PMID:35163327 Mrpl50 Rat phenobarbital affects expression ISO MRPL50 (Homo sapiens) 6480464 Phenobarbital affects the expression of MRPL50 mRNA CTD PMID:19159669 Mrpl50 Rat pirinixic acid decreases expression ISO Mrpl50 (Mus musculus) 6480464 pirinixic acid results in decreased expression of MRPL50 mRNA CTD PMID:18445702 Mrpl50 Rat propiconazole increases expression ISO Mrpl50 (Mus musculus) 6480464 propiconazole results in increased expression of MRPL50 mRNA CTD PMID:21278054 Mrpl50 Rat quercetin decreases expression ISO MRPL50 (Homo sapiens) 6480464 Quercetin results in decreased expression of MRPL50 mRNA CTD PMID:21632981 Mrpl50 Rat resorcinol increases expression ISO MRPL50 (Homo sapiens) 6480464 resorcinol results in increased expression of MRPL50 mRNA CTD PMID:22623647 Mrpl50 Rat SB 431542 multiple interactions ISO MRPL50 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Mrpl50 Rat silicon dioxide decreases expression ISO Mrpl50 (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of MRPL50 mRNA CTD PMID:19073995 Mrpl50 Rat sodium arsenite decreases expression ISO MRPL50 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of MRPL50 mRNA CTD PMID:38568856 Mrpl50 Rat succimer multiple interactions ISO Mrpl50 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of MRPL50 mRNA CTD PMID:21641980 Mrpl50 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of MRPL50 mRNA CTD PMID:30047161 Mrpl50 Rat sunitinib decreases expression ISO MRPL50 (Homo sapiens) 6480464 Sunitinib results in decreased expression of MRPL50 mRNA CTD PMID:31533062 Mrpl50 Rat thimerosal increases expression ISO MRPL50 (Homo sapiens) 6480464 Thimerosal results in increased expression of MRPL50 mRNA CTD PMID:27188386 Mrpl50 Rat thiram decreases expression ISO MRPL50 (Homo sapiens) 6480464 Thiram results in decreased expression of MRPL50 mRNA CTD PMID:38568856 Mrpl50 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of MRPL50 mRNA CTD PMID:25729387 Mrpl50 Rat trichloroethene decreases expression ISO Mrpl50 (Mus musculus) 6480464 Trichloroethylene results in decreased expression of MRPL50 mRNA CTD PMID:19448997 Mrpl50 Rat trichostatin A decreases expression ISO MRPL50 (Homo sapiens) 6480464 trichostatin A results in decreased expression of MRPL50 mRNA CTD PMID:26272509 Mrpl50 Rat trichostatin A multiple interactions ISO MRPL50 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of MRPL50 mRNA CTD PMID:27188386 Mrpl50 Rat triphenyl phosphate affects expression ISO MRPL50 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of MRPL50 mRNA CTD PMID:37042841 Mrpl50 Rat urethane decreases expression ISO MRPL50 (Homo sapiens) 6480464 Urethane results in decreased expression of MRPL50 mRNA CTD PMID:28818685 Mrpl50 Rat valproic acid affects expression ISO Mrpl50 (Mus musculus) 6480464 Valproic Acid affects the expression of MRPL50 mRNA CTD PMID:17292431 Mrpl50 Rat valproic acid multiple interactions ISO MRPL50 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of MRPL50 mRNA CTD PMID:27188386 Mrpl50 Rat valproic acid decreases expression ISO MRPL50 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of MRPL50 mRNA CTD PMID:23179753 and PMID:26272509 Mrpl50 Rat valproic acid decreases methylation ISO MRPL50 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of MRPL50 gene CTD PMID:29154799 Mrpl50 Rat vincristine decreases expression ISO MRPL50 (Homo sapiens) 6480464 Vincristine results in decreased expression of MRPL50 mRNA CTD PMID:23649840
Mrpl50 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 68,662,933 - 68,668,087 (-) NCBI GRCr8 mRatBN7.2 5 63,867,437 - 63,872,591 (-) NCBI mRatBN7.2 mRatBN7.2 UTH_Rnor_SHR_Utx 5 65,798,163 - 65,803,310 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 67,617,495 - 67,622,642 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 67,586,875 - 67,592,022 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 64,784,164 - 64,789,318 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 64,784,170 - 64,789,318 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 69,275,573 - 69,280,730 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 66,261,553 - 66,266,710 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 66,267,116 - 66,271,803 (-) NCBI Celera 5 63,735,392 - 63,740,545 (+) NCBI Celera Cytogenetic Map 5 q22 NCBI
MRPL50 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 101,387,633 - 101,398,618 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 101,387,633 - 101,398,618 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 104,149,915 - 104,160,900 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 103,192,070 - 103,200,717 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 101,231,803 - 101,240,451 NCBI Celera 9 74,665,854 - 74,674,524 (-) NCBI Celera Cytogenetic Map 9 q31.1 NCBI HuRef 9 73,751,699 - 73,760,369 (-) NCBI HuRef CHM1_1 9 104,298,663 - 104,307,332 (-) NCBI CHM1_1 T2T-CHM13v2.0 9 113,559,613 - 113,570,593 (-) NCBI T2T-CHM13v2.0
Mrpl50 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 49,512,597 - 49,521,083 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 49,512,596 - 49,521,093 (-) Ensembl GRCm39 Ensembl GRCm38 4 49,512,597 - 49,521,083 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 49,512,596 - 49,521,093 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 49,525,469 - 49,533,955 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 49,533,697 - 49,542,183 (-) NCBI MGSCv36 mm8 Celera 4 49,540,851 - 49,549,337 (-) NCBI Celera Cytogenetic Map 4 B1 NCBI cM Map 4 26.54 NCBI
Mrpl50 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955419 24,416,556 - 24,425,288 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955419 24,416,556 - 24,425,288 (+) NCBI ChiLan1.0 ChiLan1.0
MRPL50 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 37,963,998 - 37,974,042 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 37,966,381 - 37,976,417 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 72,598,030 - 72,607,297 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 100,592,607 - 100,601,435 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 100,592,607 - 100,601,435 (-) Ensembl panpan1.1 panPan2
MRPL50 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 11 58,126,242 - 58,129,171 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 11 58,126,547 - 58,129,123 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 11 56,571,953 - 56,574,915 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 11 59,263,004 - 59,265,966 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 11 59,263,072 - 59,265,911 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 11 57,772,750 - 57,775,710 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 11 57,785,796 - 57,788,783 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 11 58,483,375 - 58,486,338 (-) NCBI UU_Cfam_GSD_1.0
Mrpl50 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 173,010,718 - 173,016,859 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936524 9,558,835 - 9,564,452 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936524 9,558,298 - 9,564,414 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MRPL50 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 243,100,372 - 243,107,084 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 243,100,365 - 243,106,831 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 271,655,691 - 271,660,590 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MRPL50 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 12 38,042,285 - 38,050,896 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 38,042,317 - 38,050,527 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666035 4,503,857 - 4,511,616 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mrpl50
.
Predicted Target Of
Count of predictions: 313 Count of miRNA genes: 188 Interacting mature miRNAs: 211 Transcripts: ENSRNOT00000009678 Prediction methods: Microtar, Miranda Result types: miRGate_prediction
1578776 Stresp18 Stress response QTL 18 2.9 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 5 27955440 72955440 Rat 1298067 Scl15 Serum cholesterol level QTL 15 4.8 0.001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 33215665 78215665 Rat 1300115 Hrtrt7 Heart rate QTL 7 2.76 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 5 47869062 90099692 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 1358353 Srcrtb2 Stress Responsive Cort Basal QTL 2 3.48 0.003 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 18873947 74251464 Rat 1598814 Mcs13 Mammary carcinoma susceptibility QTL 13 0.0001 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 63190890 69927503 Rat 634305 Mamtr1 Mammary tumor resistance QTL 1 0.0001 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 12789751 113558310 Rat 61386 Bp49 Blood pressure QTL 49 16.6 cerebrum integrity trait (VT:0010549) brain infarction volume (CMO:0001013) 5 60293434 98603051 Rat 1331801 Rf33 Renal function QTL 33 4.149 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 43726656 129132602 Rat 1598807 Glom12 Glomerulus QTL 12 2.7 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 5 33215665 78215665 Rat 1302786 Kidm8 Kidney mass QTL 8 28.15 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 5 33215665 78215665 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 6903292 Stl28 Serum triglyceride level QTL 28 2.6 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 5 28515489 73515489 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 1578767 Stresp17 Stress response QTL 17 4.3 0.01 blood aldosterone amount (VT:0005346) plasma aldosterone level (CMO:0000551) 5 27955440 72955440 Rat 7411561 Bw134 Body weight QTL 134 24 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 49463600 94463600 Rat 1641922 Alcrsp8 Alcohol response QTL 8 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 5 35189153 68564008 Rat 2303615 Vencon7 Ventilatory control QTL 7 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 5 50983895 95983895 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 6903306 Scl35 Serum cholesterol QTL 35 2.6 0.0073 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 28515489 73515489 Rat 1576317 Eutr2 Estrogen induced uterine response QTL 2 0.01 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 34730116 104251008 Rat 7394712 Emca13 Estrogen-induced mammary cancer QTL 13 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 9823266 99753708 Rat 1331773 Scl26 Serum cholesterol level QTL 26 3.065 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 43726656 86724018 Rat 70189 Mcs5 Mammary carcinoma susceptibility QTL 5 10.51 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 55805606 132207589 Rat 1331771 Rf35 Renal function QTL 35 4.36965 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 729470 86724018 Rat 61359 Eaex Experimental allergic encephalomyelitis QTL x 3 nervous system integrity trait (VT:0010566) post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422) 5 55715622 100715622 Rat 8662454 Vetf3 Vascular elastic tissue fragility QTL 3 27.4 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 5 2282226 69540447 Rat 2290448 Scl54 Serum cholesterol level QTL 54 2.93 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 31663789 131345958 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 9589025 Epfw7 Epididymal fat weight QTL 7 20.66 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 5 49463600 94463600 Rat 2303574 Gluco42 Glucose level QTL 42 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 53496719 98496719 Rat 1331756 Rf34 Renal function QTL 34 4.16275 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 1 90450412 Rat 8552954 Pigfal14 Plasma insulin-like growth factor 1 level QTL 14 9 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 21226744 66226744 Rat 2316954 Rf57 Renal function QTL 57 0 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 5 59793528 90450144 Rat 1358895 Bp254 Blood pressure QTL 254 3.6 0.0003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 58829236 128034027 Rat 2316959 Gluco59 Glucose level QTL 59 4.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 34944474 113558310 Rat 1600358 Mamtr5 Mammary tumor resistance QTL 5 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 18873947 63873947 Rat 2316957 Pur21 Proteinuria QTL 21 6.2 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 5 59793528 113558156 Rat
RH127654
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 51,209,874 - 51,210,093 (+) MAPPER mRatBN7.2 mRatBN7.2 5 63,867,959 - 63,868,161 (+) MAPPER mRatBN7.2 Rnor_6.0 5 64,784,687 - 64,784,888 NCBI Rnor6.0 Rnor_6.0 7 58,576,579 - 58,576,797 NCBI Rnor6.0 Rnor_5.0 7 58,585,045 - 58,585,263 UniSTS Rnor5.0 Rnor_5.0 5 69,276,096 - 69,276,300 UniSTS Rnor5.0 RGSC_v3.4 5 66,262,076 - 66,262,280 UniSTS RGSC3.4 RGSC_v3.4 7 54,862,074 - 54,862,292 UniSTS RGSC3.4 Celera 7 47,998,278 - 47,998,496 UniSTS Celera 5 63,739,822 - 63,740,023 UniSTS RH 3.4 Map 5 563.39 UniSTS Cytogenetic Map 7 q22 UniSTS Cytogenetic Map 5 q22 UniSTS
RH137145
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 51,210,570 - 51,210,778 (+) MAPPER mRatBN7.2 mRatBN7.2 5 63,868,653 - 63,868,861 (+) MAPPER mRatBN7.2 Rnor_6.0 5 64,785,381 - 64,785,588 NCBI Rnor6.0 Rnor_6.0 7 58,577,275 - 58,577,482 NCBI Rnor6.0 Rnor_5.0 7 58,585,741 - 58,585,948 UniSTS Rnor5.0 Rnor_5.0 5 69,276,793 - 69,277,000 UniSTS Rnor5.0 RGSC_v3.4 5 66,262,773 - 66,262,980 UniSTS RGSC3.4 RGSC_v3.4 7 54,862,770 - 54,862,977 UniSTS RGSC3.4 Celera 7 47,998,974 - 47,999,181 UniSTS Celera 5 63,739,122 - 63,739,329 UniSTS Cytogenetic Map 7 q22 UniSTS Cytogenetic Map 5 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000078957 ⟹ ENSRNOP00000071446
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 5 64,784,170 - 64,789,318 (-) Ensembl
RefSeq Acc Id:
NM_001108665 ⟹ NP_001102135
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 68,662,933 - 68,668,087 (-) NCBI mRatBN7.2 5 63,867,437 - 63,872,591 (-) NCBI Rnor_6.0 5 64,784,164 - 64,789,318 (-) NCBI Rnor_5.0 5 69,275,573 - 69,280,730 (-) NCBI RGSC_v3.4 5 66,261,553 - 66,266,710 (-) RGD Celera 5 63,735,392 - 63,740,545 (+) RGD
Sequence:
ACGTCGGCGCTTTGGGGAGCTTGTCGAAGATGGCGGCGCTGTGTGTGTGTCGGTTTGCAAGAAGAGGCTGGCTGTGGAAGCCTCCCTTGGCTACACGTAGAGAATTCTGGTCTAGATCCAGGAAGGAG
hide sequence
RefSeq Acc Id:
NP_001102135 ⟸ NM_001108665
- UniProtKB:
A6KJE4 (UniProtKB/TrEMBL)
- Sequence:
MAALCVCRFARRGWLWKPPLATRREFWSRSRKEKELVVAETVEEVKKAPALVCPPLRSRAYTPPSDLQSRLESHIKEVLGSSLPNNWQDISLDDGHVKFRLLANLADDLGHAVPNSRLHQMCRVRDVL
hide sequence
Ensembl Acc Id:
ENSRNOP00000071446 ⟸ ENSRNOT00000078957
RGD ID: 13693729 Promoter ID: EPDNEW_R4254 Type: multiple initiation site Name: Mrpl50_1 Description: mitochondrial ribosomal protein L50 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 64,789,296 - 64,789,356 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Mrpl50
mitochondrial ribosomal protein L50
Mrpl50_predicted
mitochondrial ribosomal protein L50 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Mrpl50_predicted
mitochondrial ribosomal protein L50 (predicted)
Symbol and Name status set to approved
70820 APPROVED
