Advanced Search (OLGA)

Gene: Setsip (SET like protein) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Setsip

Name:

SET like protein

RGD ID:

1307467

Description:

Predicted to enable chromatin binding activity and histone binding activity. Predicted to be involved in endothelial cell differentiation and positive regulation of transcription by RNA polymerase II. Predicted to be located in several cellular components, including lipid droplet; nucleoplasm; and perinuclear region of cytoplasm. Predicted to be active in chromatin and nucleus. Human ortholog(s) of this gene implicated in autosomal dominant intellectual developmental disorder 58. Orthologous to several human genes including SET (SET nuclear proto-oncogene); INTERACTS WITH acetamide; bisphenol A; thioacetamide.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Ab1-115; I-2PP2A; liver regeneration-related protein LRRGR00002; LOC307947; phosphatase 2A inhibitor I2PP2A; Set; SET nuclear oncogene; SET nuclear proto-oncogene; SET translocation; TAF-I; template-activating factor I

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SETSIP (SET like protein)	RGD	RGD
Pan paniscus (bonobo/pygmy chimpanzee):	SET (SET nuclear proto-oncogene)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SET (SET nuclear proto-oncogene)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SET (SET nuclear proto-oncogene)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Set (SET nuclear proto-oncogene)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SET (SET nuclear proto-oncogene)	HGNC	HomoloGene, Panther
Alliance orthologs ³
Homo sapiens (human):	SET (SET nuclear proto-oncogene)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	Set (SET nuclear oncogene)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	SETSIP (SET like protein)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER)
Danio rerio (zebrafish):	setb (SET nuclear proto-oncogene b)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	seta (SET nuclear proto-oncogene a)	Alliance	DIOPT (Hieranoid\|InParanoid\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Set	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	VPS75	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	spr-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	set	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	70,458,604 - 70,460,122 (+)	NCBI		GRCr8
mRatBN7.2	19	53,561,262 - 53,562,780 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	53,561,190 - 53,563,819 (+)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	19	58,420,635 - 58,422,153 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	58,419,961 - 58,421,504 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	69,119,722 - 69,121,240 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	55,797,060 - 55,798,578 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	55,801,940 - 55,803,459 (+)	NCBI
Celera	19	52,922,285 - 52,923,803 (+)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Setsip	Rat	autosomal dominant intellectual developmental disorder 58		ISO	SETSIP (Homo sapiens)	8554872	ClinVar Annotator: match by term: INTELLECTUAL DEVELOPMENTAL DISORDER and AUTOSOMAL DOMINANT 58	ClinVar	PMID:25741868

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Setsip	Rat	17beta-estradiol	increases expression	ISO	SETSIP (Homo sapiens)	6480464	Estradiol results in increased expression of SETSIP mRNA	CTD	PMID:31614463
Setsip	Rat	acetamide	increases expression	EXP		6480464	acetamide results in increased expression of SETSIP mRNA	CTD	PMID:31881176
Setsip	Rat	arsane	multiple interactions	ISO	SETSIP (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SETSIP mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SETSIP mRNA	CTD	PMID:39836092
Setsip	Rat	arsenic atom	multiple interactions	ISO	SETSIP (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SETSIP mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SETSIP mRNA	CTD	PMID:39836092
Setsip	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with tributyltin] results in decreased expression of SETSIP mRNA	CTD	PMID:31129395
Setsip	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of SETSIP mRNA	CTD	PMID:25181051
Setsip	Rat	cadmium dichloride	increases expression	ISO	SETSIP (Homo sapiens)	6480464	Cadmium Chloride results in increased expression of SETSIP mRNA	CTD	PMID:26472689
Setsip	Rat	manganese atom	multiple interactions	ISO	SETSIP (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SETSIP mRNA	CTD	PMID:39836092
Setsip	Rat	manganese(0)	multiple interactions	ISO	SETSIP (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SETSIP mRNA	CTD	PMID:39836092
Setsip	Rat	manganese(II) chloride	multiple interactions	ISO	SETSIP (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SETSIP mRNA	CTD	PMID:39836092
Setsip	Rat	sodium arsenite	multiple interactions	ISO	SETSIP (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SETSIP mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SETSIP mRNA	CTD	PMID:39836092
Setsip	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of SETSIP mRNA	CTD	PMID:23411599
Setsip	Rat	tributylstannane	multiple interactions	EXP		6480464	[bisphenol A co-treated with tributyltin] results in decreased expression of SETSIP mRNA	CTD	PMID:31129395
Setsip	Rat	trichloroethene	increases methylation	EXP		6480464	Trichloroethylene results in increased methylation of SETSIP gene	CTD	PMID:27618143

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Setsip	Rat	endothelial cell differentiation	involved_in	ISO	SETSIP (Homo sapiens)	1624291	PMID:22869753	RGD	PMID:22869753
Setsip	Rat	nucleosome assembly	involved_in	IEA	InterPro:IPR002164	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Setsip	Rat	positive regulation of transcription by RNA polymerase II	involved_in	ISO	SETSIP (Homo sapiens)	1624291	PMID:22869753	RGD	PMID:22869753

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Setsip	Rat	chromatin	is_active_in	IBA	PANTHER:PTN000221934 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Setsip	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Setsip	Rat	cytoplasm	located_in	ISO	SETSIP (Homo sapiens)	1624291	PMID:22869753	RGD	PMID:22869753
Setsip	Rat	cytoplasm	located_in	ISS	UniProtKB:Q01105	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Setsip	Rat	cytosol	located_in	IEA	UniProtKB-SubCell:SL-0091	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Setsip	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB-SubCell:SL-0095	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Setsip	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB-KW:KW-0256	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Setsip	Rat	endoplasmic reticulum	located_in	ISS	UniProtKB:Q01105	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Setsip	Rat	lipid droplet	located_in	ISO	SETSIP (Homo sapiens)	1624291		RGD	GO_REF:0000052
Setsip	Rat	nucleoplasm	located_in	IEA	UniProtKB-SubCell:SL-0190	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Setsip	Rat	nucleoplasm	located_in	ISO	SETSIP (Homo sapiens)	1624291		RGD	GO_REF:0000052
Setsip	Rat	nucleus	located_in	ISO	SETSIP (Homo sapiens)	1624291	PMID:22869753	RGD	PMID:22869753
Setsip	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Setsip	Rat	nucleus	located_in	IEA	InterPro:IPR002164	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Setsip	Rat	nucleus	is_active_in	IBA	FB:FBgn0015268 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Setsip	Rat	perinuclear region of cytoplasm	located_in	ISS	UniProtKB:Q01105	1600115	GO_REF:0000024	UniProt	GO_REF:0000024

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Setsip	Rat	chromatin binding	enables	ISO	SETSIP (Homo sapiens)	1624291	PMID:22869753	RGD	PMID:22869753
Setsip	Rat	chromatin binding	enables	IBA	MGI:106654 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Setsip	Rat	DNA binding	enables	IEA	UniProtKB-KW:KW-0238	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Setsip	Rat	histone binding	enables	IBA	FB:FBgn0015268 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Setsip	Rat	protein binding	enables	IPI	UniProtKB:Q9R0N3	8693368	PMID:24882364	ParkinsonsUK-UCL

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Synaptotagmin 11 interacts with components of the RNA-induced silencing complex RISC in clonal pancreatic beta-cells.	Milochau A, etal., FEBS Lett. 2014 Jun 27;588(14):2217-22. doi: 10.1016/j.febslet.2014.05.031. Epub 2014 May 29.
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:7508204	PMID:8889548	PMID:10715114	PMID:10716735	PMID:11078917	PMID:11555662	PMID:11909973	PMID:12477932	PMID:12524539	PMID:16162853	PMID:16396499	PMID:16791210
PMID:17065150	PMID:18374643	PMID:19343227	PMID:20651003	PMID:23233674

Setsip
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	70,458,604 - 70,460,122 (+)	NCBI		GRCr8
mRatBN7.2	19	53,561,262 - 53,562,780 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	53,561,190 - 53,563,819 (+)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	19	58,420,635 - 58,422,153 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	58,419,961 - 58,421,504 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	69,119,722 - 69,121,240 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	55,797,060 - 55,798,578 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	55,801,940 - 55,803,459 (+)	NCBI
Celera	19	52,922,285 - 52,923,803 (+)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI

SETSIP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	92,074,533 - 92,075,411 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	92,074,533 - 92,075,411 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	92,540,090 - 92,540,968 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	92,311,800 - 92,313,616 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	1	90,786,534 - 90,787,409 (-)	NCBI		Celera
Cytogenetic Map	1	p22.1	ENTREZGENE
HuRef	1	90,660,347 - 90,661,222 (-)	NCBI		HuRef
CHM1_1	1	92,654,917 - 92,655,792 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	91,919,389 - 91,920,267 (-)	NCBI		T2T-CHM13v2.0

SET
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	10,654,526 - 10,675,049 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	10,656,876 - 10,677,399 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	99,806,876 - 99,819,825 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	128,473,334 - 128,486,295 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	128,473,806 - 128,484,563 (+)	Ensembl	panpan1.1		panPan2

SET
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	54,896,464 - 54,907,698 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	54,091,882 - 54,098,081 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	55,817,522 - 55,828,773 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	55,817,525 - 55,840,176 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	54,578,083 - 54,584,281 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	54,890,770 - 54,896,963 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	54,984,276 - 54,990,463 (-)	NCBI		UU_Cfam_GSD_1.0

SET
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	9,446,265 - 9,453,991 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666096	7,724 - 21,521 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Set
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624760	6,293,452 - 6,304,237 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Setsip
5 total Variants

Assembly: RGSC_v3.4

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain	Variant Page
19	55797305	55797306	G	T	snv	SS/JrHsdMcwi (MCW)	View more Information
19	55797394	55797395	A	T	snv	WN/N (KNAW), M520/N (KNAW), MR/N (KNAW), SHR/OlaIpcv (ICL), LEW/Crl (ICL), GK/Ox (ICL), GH/OmrMcwi (MCW), COP/CrCrl (MCW & UW), SS/JrHsdMcwi (MCW), ACI/EurMcwi (MCW)	View more Information
19	55797409	55797410	A	T	snv	ACI/EurMcwi (ICL), LE/Stm (ICL), SBN/Ygl (ICL), SBH/Ygl (ICL), GH/OmrMcwi (MCW), ACI/EurMcwi (MCW), COP/CrCrl (MCW & UW), WKY/NCrl (ICL), SHR/OlaIpcv (ICL), LEW/Crl (ICL), LL/MavRrrc (ICL)	View more Information

Assembly: Rnor_5.0

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain	Variant Page
19	69120056	69120057	A	T	snv	ACI/EurMcwi (MCW), ZF (KyushuU), KFRS3B/Kyo (KyushuU), BDIX.Cg-Tal/NemOda (KyushuU), DOB/Oda (KyushuU), BDIX/NemOda (KyushuU), F344/Jcl (KyushuU), LEC/Tj (KyushuU), HWY/Slc (KyushuU), F344/Stm (KyushuU), IS-Tlk/Kyo (KyushuU), RCS/Kyo (KyushuU), BN/SsNSlc (KyushuU), F344/NSlc (KyushuU), HTX/Kyo (KyushuU), LE/Stm (KyushuU), F344/DuCrlCrlj (KyushuU), NIG-III/Hok (KyushuU), BUF/MNa (KyushuU), SDLEF7/Barth (UDEL), SS/JrHsdMcwi (MCW), SBN/Ygl (MCW), SBH/Ygl (MCW), GH/OmrMcwi (MCW), COP/CrCrl (MCW & UW), ZFDM (KyushuU)	View more Information
19	69120071	69120072	A	T	snv	F344/NSlc (KyushuU), DOB/Oda (KyushuU), COP/CrCrl (MCW & UW), F344/Stm (KyushuU), GH/OmrMcwi (MCW), ZF (KyushuU), SBH/Ygl (MCW), HWY/Slc (KyushuU), SBN/Ygl (MCW), BDIX.Cg-Tal/NemOda (KyushuU), ACI/EurMcwi (MCW), KFRS3B/Kyo (KyushuU), BN/SsNSlc (KyushuU), BDIX/NemOda (KyushuU), RCS/Kyo (KyushuU), ZFDM (KyushuU), IS-Tlk/Kyo (KyushuU), HTX/Kyo (KyushuU), LE/Stm (KyushuU), F344/DuCrlCrlj (KyushuU), NIG-III/Hok (KyushuU), F344/Jcl (KyushuU), BUF/MNa (KyushuU), SDLEF7/Barth (UDEL), LEC/Tj (KyushuU), SS/JrHsdMcwi (MCW)	View more Information
19	69120370	69120371	G	C	snv	F344/Jcl (KyushuU)	View more Information
19	69120389	69120390	A	G	snv	F344/Jcl (KyushuU), F344/DuCrlCrlj (KyushuU)	View more Information
19	69120397	69120398	C	T	snv	F344/DuCrlCrlj (KyushuU), F344/Jcl (KyushuU), F344/NSlc (KyushuU)	View more Information
19	69120403	69120404	C	T	snv	F344/NSlc (KyushuU), ZFDM (KyushuU), F344/DuCrlCrlj (KyushuU), F344/Jcl (KyushuU)	View more Information

Assembly: Rnor_6.0

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain	Variant Page
19	58420969	58420970	A	T	snv	ACI/EurMcwi (MCW), WKY/N (2020), GH/OmrMcwi (MCW), SBH/Ygl (MCW), FHH/EurMcwi (MCW), SBN/Ygl (MCW), SR/JrHsd (MCW), SS/JrHsdMcwi (MCW), CDR, CDS, M520/N (MCW), MR/N (MCW), WN/N (MCW), ACI/EurMcwi (2019), BXH3/CubMcwi (2020), F344/Stm (2019), HXB2/IpcvMcwi (2019), LEW/Crl (2019), LEXF1C/Stm (2019), LEXF2B/Stm (2019), LEXF10A/StmMcwi (2020), MWF/Hsd (2019), SHRSP/A3NCrl (2019), SHR/OlalpcvMcwi (2019), WKY/NCrl (2019), COP/CrCrl (MCW & UW)	View more Information
19	58420984	58420985	A	T	snv	ACI/EurMcwi (MCW), COP/CrCrl (MCW & UW), GH/OmrMcwi (MCW), SBH/Ygl (MCW), FHH/EurMcwi (MCW), SR/JrHsd (MCW), SS/JrHsdMcwi (MCW), CDR, CDS, ACI/EurMcwi (2019), BXH3/CubMcwi (2020), F344/Stm (2019), HXB2/IpcvMcwi (2019), LEW/Crl (2019), LEXF1C/Stm (2019), LEXF2B/Stm (2019), LEXF3/Stm (2020), LE/Stm (2019), LEXF10A/StmMcwi (2020), MWF/Hsd (2019), SHRSP/A3NCrl (2019), SHR/OlalpcvMcwi (2019), WKY/NCrl (2019), WKY/N (2020)	View more Information
19	58421247	58421248	T	C	snv	SBN/Ygl (MCW)	View more Information
19	58421283	58421284	G	C	snv	SBN/Ygl (MCW), SS/JrHsdMcwi (MCW), FHH/EurMcwi (MCW), SBH/Ygl (MCW), GH/OmrMcwi (MCW), SR/JrHsd (MCW), COP/CrCrl (MCW & UW)	View more Information
19	58421302	58421303	A	G	snv	COP/CrCrl (MCW & UW), ACI/EurMcwi (MCW), SBH/Ygl (MCW), FHH/EurMcwi (MCW), SR/JrHsd (MCW), SBN/Ygl (MCW), SS/JrHsdMcwi (MCW), FHL/EurMcwi (MCW), GH/OmrMcwi (MCW)	View more Information
19	58421310	58421311	C	T	snv	SS/JrHsdMcwi (MCW), SR/JrHsd (MCW), SBN/Ygl (MCW), FHL/EurMcwi (MCW), SBH/Ygl (MCW), GH/OmrMcwi (MCW), COP/CrCrl (MCW & UW), ACI/EurMcwi (MCW), FHH/EurMcwi (MCW)	View more Information

Predicted Target Of

	Summary Value
Count of predictions:	224
Count of miRNA genes:	152
Interacting mature miRNAs:	161
Transcripts:	ENSRNOT00000051397
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	15630201	57337602	Rat
61350	Bp32	Blood pressure QTL 32		0.012	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	19	20483575	57337602	Rat
5135224	Leukc1	Leukocyte quantity QTL 1			eosinophil quantity (VT:0002602)	blood eosinophil count (CMO:0000033)	19	44340214	55283277	Rat
724546	Kidm3	Kidney mass QTL 3	3.1		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	19	29322490	57337602	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	15455860	57337602	Rat
1358200	Insglur2	Insulin/glucose ratio QTL 2	4.1		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	19	33838214	55283146	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2187927	56457239	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	4096155	55283277	Rat
2298478	Eau8	Experimental allergic uveoretinitis QTL 8		0.0163	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	19	17154433	57337602	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
15	11	55	144	125	120	77	31	77	12	276	121	112	55	79	43


RefSeq Transcripts	NM_001012504	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY325137	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BQ782936	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BU758850	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	S68589	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000051397 ⟹ ENSRNOP00000039454

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	19	58,419,961 - 58,421,504 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000102684 ⟹ ENSRNOP00000078925

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	53,561,190 - 53,563,819 (+)	Ensembl

RefSeq Acc Id:

NM_001012504 ⟹ NP_001012522

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	70,458,604 - 70,460,122 (+)	NCBI
mRatBN7.2	19	53,561,262 - 53,562,780 (+)	NCBI
Rnor_6.0	19	58,420,635 - 58,422,153 (+)	NCBI
Rnor_5.0	19	69,119,722 - 69,121,240 (+)	NCBI
RGSC_v3.4	19	55,797,060 - 55,798,578 (+)	RGD
Celera	19	52,922,285 - 52,923,803 (+)	RGD

Sequence:

show sequence

ATGGCCCCGAAGCGGCAATCTGCGATCCTGCCTCAGCCCAAGAAACCCAGACCCGTTGCTGCCCCGAAGCTGGAGGACAAGTCGGCCTCTCCCGGCCTGCCGAAGGGAGAAAAAGAACAGCAAGAAGC
AATTGAACATATTGATGAAGTACAAAATGAAATAGACAGGCTTAATGAACAAGCCAGTGAGGAAATTTTGAAAGTAGAACAAAAATATAACAAACTCCGCCAACCATTTTTTCAGAAGAGGTCAGAAT
TGATCACCAAAATCCCAAATTTTTGGGTAACAACATTTGTCAACCATCCACAAGTGTCTGCACTGCTTGGGGAGGAAGACGAGGAGGCCCTGCACTATTTGACCAGAGTTGAAGTGACAGAATTTGAA
GACATTAAATCAGGTTACAGAATAGATTTTTATTTTGATGAAAATCCTTACTTTGAAAATAAAGTTCTCTCCAAAGAATTTCATCTGAATGAGAGCGGTGACCCATCTTCAAAGTCCACCGAAATCAA
ATGGAAATCTGGAAAGGATTTGACAAAATGCTCAAGTCAAACGCAGAATAAGGCCAGCAGGAAGAGGCAGCACGAAGAGCCAGAGAGCTTCTTTACCTGGTTTACTGACCATTCAGACGCAGGTGCTG
ACGAGTTAGGAGAGGTCATCAAAGATGATATTTGGCCAAATCCTTTGCAGTACTATTTGGTTCCCGATATGGATGATGAAGAAGGAGAGGCAGAGGATGATGATGACGACGATGAAGAGGAGGAAGGG
TTGGAAGACATTGATGAAGAAGGAGACGAGGACGAAGGTGAAGAAGACAATGATGAGGATGAAGGGGAGGAAGGAGAGGAGGATGAAGGCGAGGATGACTAGCACAGAAGACCGATGGATCCAACCTT
CTTTTTCATTTTCTTTTTATTTTTTAAATTTCCCCAGTCCCTGGGAGCGAGTTGCAGTCCTTTCCTCCCTGTCCCTCTGTGCTCAGCCGCCCTGTTTTTGAGGTCTCAACATCATGGTTCTCAACTAA
TTTGGGGGGAAAATATCTTGAGCAAAATACAACAGGAAAAGAATCTTCACGTTTCTGTTCTAAATTCATTTTTATCCTTGTCTCAAACTGTGGATTCAACACCACCACCATGCTCTGTGGGAAGAAAG
AAAAGCCCTCCAGTTCCCTTGGCTCTGCTGGAGGCTGGAGGGTGCTAGGCCCCTGTGTAGTAGTGCATAGAATTCTAGCTTTTTCTTTTCTCTGTATATTGGGCTCAGAGATTACACTGTGTCTCTAT
GTGAATACAGACAGTTAGCATTTACCAACATGGATCTGTCTACTTTCTCTTGTTTAATAAAAAGGAAAAAAAAAGAAAAAGGGGGGGGATAGACAGTGAGCAAGGGTGGGATCGAGGTGTCGGGGGGG
TATGTGGGCATCTGACAACATGGCTTCTCCTTTGGCATGTTTCATTGTGACGTTTAACAGACATCCTTGCCGTTTAAGGTGACACTTAAATAAAATAAAACTCTCCTGATG

hide sequence


Protein RefSeqs	NP_001012522	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC60681	(Get FASTA)	NCBI Sequence Viewer
	AAP92538	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000077721.1
	ENSRNOP00000078925
	ENSRNOP00000078925.1
GenBank Protein	Q63945	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001012522 ⟸ NM_001012504

- UniProtKB:

A0A8I6G2K3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAPKRQSAILPQPKKPRPVAAPKLEDKSASPGLPKGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELITKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFE
DIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKCSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDDEEGEAEDDDDDDEEEEG
LEDIDEEGDEDEGEEDNDEDEGEEGEEDEGEDD

hide sequence

Ensembl Acc Id:

ENSRNOP00000039454 ⟸ ENSRNOT00000051397

Ensembl Acc Id:

ENSRNOP00000078925 ⟸ ENSRNOT00000102684

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q63945-F1-model_v2	AlphaFold	Q63945	1-289	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-5209	BioCyc
Ensembl Genes	ENSRNOG00000025892	UniProtKB/Swiss-Prot
	ENSRNOG00000034241	Ensembl
	ENSRNOG00000062793	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000102290.1	UniProtKB/Swiss-Prot
	ENSRNOT00000102684	ENTREZGENE
	ENSRNOT00000102684.1	UniProtKB/TrEMBL
Gene3D-CATH	1.20.5.1500	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Nucleosome assembly protein	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:9089104	IMAGE-MGC_LOAD
InterPro	NAP-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NAP_family	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:307947	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:187306	IMAGE-MGC_LOAD
NCBI Gene	307947	ENTREZGENE
PANTHER	PTHR11875	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	NAP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Setsip	PhenoGen
RatGTEx	ENSRNOG00000025892	RatGTEx
	ENSRNOG00000034241	RatGTEx
	ENSRNOG00000062793	RatGTEx
Superfamily-SCOP	SSF143113	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6G2K3	ENTREZGENE, UniProtKB/TrEMBL
	Q63945	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	Q7TPA3	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-03-17	Setsip	SET like protein	Set	SET nuclear proto-oncogene	Name and Symbol changed	629549	APPROVED
2014-07-10	Set	SET nuclear proto-oncogene	Set	SET nuclear oncogene	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-11-14	Set	SET nuclear oncogene	Set	SET translocation	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Set	SET translocation	Set_predicted	SET translocation (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Set_predicted	SET translocation (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar