Symbol:
Glyat
Name:
glycine-N-acyltransferase
RGD ID:
1307163
Description:
Predicted to enable glycine N-acyltransferase activity and glycine N-benzoyltransferase activity. Predicted to be involved in benzoyl-CoA metabolic process; glycine metabolic process; and monocarboxylic acid metabolic process. Predicted to be active in mitochondrion. Orthologous to human GLYAT (glycine-N-acyltransferase); INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,4,7,8-Pentachlorodibenzofuran.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
AAc; acyl-CoA:glycine N-acyltransferase; aralkyl acyl-CoA N-acyltransferase; aralkyl acyl-CoA:amino acid N-acyltransferase; benzoyl-coenzyme A:glycine N-acyltransferase; glycine N-acyltransferase; glycine N-benzoyltransferase; liver regeneration-related protein LRRG067; LOC293779; MGC93750
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
GLYAT (glycine-N-acyltransferase) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, OMA, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Glyat (glycine-N-acyltransferase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Glyat (glycine-N-acyltransferase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
GLYAT (glycine-N-acyltransferase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
GLYAT (glycine-N-acyltransferase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
LOC100517803 (glycine N-phenylacetyltransferase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
GLYAT (glycine-N-acyltransferase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
CEP95 (centrosomal protein 95) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
GLYAT (glycine-N-acyltransferase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Glyat (glycine-N-acyltransferase)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
si:dkey-76k16.6
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
si:ch73-106k19.2
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
si:dkey-76k16.5
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
ZK185.3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder)
Caenorhabditis elegans (roundworm):
T10B10.4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|PANTHER)
Caenorhabditis elegans (roundworm):
F43H9.4
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 219,128,798 - 219,149,615 (+) NCBI GRCr8 mRatBN7.2 1 209,704,213 - 209,724,949 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 209,704,268 - 209,724,942 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 218,085,147 - 218,098,962 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 225,016,795 - 225,030,610 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 217,839,615 - 217,853,430 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 229,060,125 - 229,081,113 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 229,063,714 - 229,080,410 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 236,219,894 - 236,240,842 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 215,653,254 - 215,666,991 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 215,805,312 - 215,825,975 (+) NCBI Celera 1 207,123,726 - 207,137,541 (+) NCBI Celera Cytogenetic Map 1 q43 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Glyat Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of GLYAT mRNA] CTD PMID:31150632 Glyat Rat 1,1-dichloroethene decreases expression ISO RGD:1316191 6480464 vinylidene chloride results in decreased expression of GLYAT mRNA CTD PMID:26682919 Glyat Rat 1,2-dichloroethane decreases expression ISO RGD:1316191 6480464 ethylene dichloride results in decreased expression of GLYAT mRNA CTD PMID:28189721|PMID:28960355 Glyat Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:1316191 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of GLYAT mRNA CTD PMID:17942748 Glyat Rat 17beta-estradiol affects expression ISO RGD:1316190 6480464 Estradiol affects the expression of GLYAT mRNA CTD PMID:14699072 Glyat Rat 17beta-estradiol decreases expression ISO RGD:1316191 6480464 Estradiol results in decreased expression of GLYAT mRNA CTD PMID:39298647 Glyat Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of GLYAT mRNA CTD PMID:32145629 Glyat Rat 17beta-estradiol multiple interactions ISO RGD:1316190 6480464 [Progesterone co-treated with Estradiol] results in increased expression of GLYAT mRNA CTD PMID:17404688 Glyat Rat 17beta-estradiol decreases expression ISO RGD:1316190 6480464 Estradiol results in decreased expression of GLYAT mRNA CTD PMID:20106945 Glyat Rat 2,3,4,7,8-Pentachlorodibenzofuran decreases expression EXP 6480464 2,3,4,7,8-pentachlorodibenzofuran results in decreased expression of GLYAT mRNA CTD PMID:21724226 Glyat Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1316190 6480464 Tetrachlorodibenzodioxin results in decreased expression of GLYAT mRNA CTD PMID:20106945 Glyat Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1316190 6480464 [Endosulfan co-treated with Tetrachlorodibenzodioxin] results in decreased expression of GLYAT mRNA CTD PMID:26159488 Glyat Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of GLYAT mRNA CTD PMID:21215274|PMID:21724226 Glyat Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1316191 6480464 Tetrachlorodibenzodioxin affects the expression of GLYAT mRNA CTD PMID:21570461 Glyat Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of GLYAT mRNA CTD PMID:22298810 Glyat Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1316191 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of GLYAT mRNA CTD PMID:17942748 Glyat Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2,3,7,8-tetrachlorodibenzofuran results in decreased expression of GLYAT mRNA CTD PMID:21724226 Glyat Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO RGD:1316191 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of GLYAT mRNA CTD PMID:38648751 Glyat Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of GLYAT protein CTD PMID:34915118 Glyat Rat 4-hydroxyphenyl retinamide increases expression ISO RGD:1316191 6480464 Fenretinide results in increased expression of GLYAT mRNA CTD PMID:28973697 Glyat Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of GLYAT mRNA CTD PMID:31881176 Glyat Rat aflatoxin B1 affects expression ISO RGD:1316190 6480464 Aflatoxin B1 affects the expression of GLYAT protein CTD PMID:20106945 Glyat Rat aflatoxin B1 decreases methylation ISO RGD:1316190 6480464 Aflatoxin B1 results in decreased methylation of GLYAT gene CTD PMID:27153756 Glyat Rat aflatoxin B1 decreases expression ISO RGD:1316190 6480464 Aflatoxin B1 results in decreased expression of GLYAT mRNA CTD PMID:22100608|PMID:27153756 Glyat Rat aflatoxin B1 decreases expression ISO RGD:1316191 6480464 Aflatoxin B1 results in decreased expression of GLYAT mRNA CTD PMID:19770486 Glyat Rat asbestos decreases expression ISO RGD:1316190 6480464 Asbestos results in decreased expression of GLYAT mRNA CTD PMID:22076105 Glyat Rat benomyl increases expression EXP 6480464 Benomyl results in increased expression of GLYAT mRNA CTD PMID:15885261 Glyat Rat benzo[a]pyrene decreases expression ISO RGD:1316190 6480464 Benzo(a)pyrene results in decreased expression of GLYAT mRNA CTD PMID:20106945|PMID:32234424 Glyat Rat benzo[a]pyrene increases methylation ISO RGD:1316190 6480464 Benzo(a)pyrene results in increased methylation of GLYAT 3' UTR; Benzo(a)pyrene results in increased methylation of more ... CTD PMID:27901495 Glyat Rat benzo[a]pyrene affects methylation ISO RGD:1316190 6480464 Benzo(a)pyrene affects the methylation of GLYAT exon CTD PMID:27901495 Glyat Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GLYAT mRNA CTD PMID:25181051|PMID:32145629 Glyat Rat bisphenol A increases expression ISO RGD:1316191 6480464 bisphenol A results in increased expression of GLYAT mRNA CTD PMID:33221593 Glyat Rat buspirone increases expression EXP 6480464 Buspirone results in increased expression of GLYAT mRNA CTD PMID:24136188 Glyat Rat buta-1,3-diene decreases expression ISO RGD:1316191 6480464 1,3-butadiene results in decreased expression of GLYAT mRNA CTD PMID:29038090 Glyat Rat carbon nanotube decreases expression ISO RGD:1316190 6480464 Nanotubes, Carbon results in decreased expression of GLYAT mRNA CTD PMID:22076105 Glyat Rat CGP 52608 multiple interactions ISO RGD:1316190 6480464 CGP 52608 promotes the reaction [RORA protein binds to GLYAT gene] CTD PMID:28238834 Glyat Rat ciguatoxin CTX1B affects expression ISO RGD:1316191 6480464 Ciguatoxins affects the expression of GLYAT mRNA CTD PMID:18353800 Glyat Rat cyclosporin A decreases expression ISO RGD:1316190 6480464 Cyclosporine results in decreased expression of GLYAT mRNA CTD PMID:20106945|PMID:23830897|PMID:27989131 Glyat Rat cyclosporin A decreases expression ISO RGD:1316191 6480464 Cyclosporine results in decreased expression of GLYAT mRNA CTD PMID:23830897 Glyat Rat DDE increases expression EXP 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of GLYAT mRNA CTD PMID:15885261 Glyat Rat dibenzofurans increases expression ISO RGD:1316191 6480464 Dibenzofurans results in increased expression of GLYAT mRNA CTD PMID:34254344 Glyat Rat endosulfan multiple interactions ISO RGD:1316190 6480464 [Endosulfan co-treated with Tetrachlorodibenzodioxin] results in decreased expression of GLYAT mRNA CTD PMID:26159488 Glyat Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of GLYAT mRNA CTD PMID:29391264 Glyat Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of GLYAT mRNA CTD PMID:23962444 Glyat Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of GLYAT mRNA CTD PMID:15885261 Glyat Rat gamma-hexachlorocyclohexane affects expression EXP 6480464 Hexachlorocyclohexane affects the expression of GLYAT mRNA CTD PMID:17785943 Glyat Rat genistein decreases expression ISO RGD:1316191 6480464 Genistein results in decreased expression of GLYAT mRNA CTD PMID:32186404 Glyat Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of GLYAT mRNA CTD PMID:24136188 Glyat Rat Heliotrine decreases expression ISO RGD:1316190 6480464 heliotrine results in decreased expression of GLYAT mRNA CTD PMID:26100227 Glyat Rat N-nitrosodiethylamine decreases expression EXP 6480464 Diethylnitrosamine results in decreased expression of GLYAT mRNA CTD PMID:19638242 Glyat Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of GLYAT mRNA CTD PMID:24136188 Glyat Rat O-methyleugenol decreases expression ISO RGD:1316190 6480464 methyleugenol results in decreased expression of GLYAT mRNA CTD PMID:32234424 Glyat Rat ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of GLYAT mRNA CTD PMID:18417182 Glyat Rat okadaic acid decreases expression ISO RGD:1316190 6480464 Okadaic Acid results in decreased expression of GLYAT mRNA; Okadaic Acid results in decreased expression more ... CTD PMID:38832940 Glyat Rat paracetamol affects expression ISO RGD:1316191 6480464 Acetaminophen affects the expression of GLYAT mRNA CTD PMID:17562736 Glyat Rat paracetamol decreases expression ISO RGD:1316190 6480464 Acetaminophen results in decreased expression of GLYAT mRNA CTD PMID:26690555|PMID:29067470 Glyat Rat perfluorononanoic acid decreases expression ISO RGD:1316190 6480464 perfluoro-n-nonanoic acid results in decreased expression of GLYAT mRNA CTD PMID:32588087 Glyat Rat pirinixic acid multiple interactions ISO RGD:1316191 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Glyat Rat pirinixic acid increases expression ISO RGD:1316191 6480464 pirinixic acid results in increased expression of GLYAT mRNA CTD PMID:17426115|PMID:18301758 Glyat Rat pirinixic acid decreases expression ISO RGD:1316191 6480464 pirinixic acid results in decreased expression of GLYAT mRNA CTD PMID:18445702 Glyat Rat progesterone multiple interactions ISO RGD:1316190 6480464 [Progesterone co-treated with Estradiol] results in increased expression of GLYAT mRNA CTD PMID:17404688 Glyat Rat progesterone increases expression ISO RGD:1316190 6480464 Progesterone results in increased expression of GLYAT mRNA CTD PMID:17404688 Glyat Rat raloxifene affects expression ISO RGD:1316190 6480464 Raloxifene Hydrochloride affects the expression of GLYAT mRNA CTD PMID:14699072 Glyat Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of GLYAT mRNA CTD PMID:28374803 Glyat Rat senecionine decreases expression ISO RGD:1316190 6480464 senecionine results in decreased expression of GLYAT mRNA CTD PMID:26100227 Glyat Rat Senkirkine decreases expression ISO RGD:1316190 6480464 senkirkine results in decreased expression of GLYAT mRNA CTD PMID:26100227 Glyat Rat silicon dioxide decreases expression ISO RGD:1316190 6480464 Silicon Dioxide analog results in decreased expression of GLYAT mRNA CTD PMID:25895662 Glyat Rat sodium arsenite decreases expression ISO RGD:1316190 6480464 sodium arsenite results in decreased expression of GLYAT mRNA CTD PMID:29301061 Glyat Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of GLYAT protein CTD PMID:29459688 Glyat Rat tamoxifen affects expression ISO RGD:1316190 6480464 Tamoxifen affects the expression of GLYAT mRNA CTD PMID:14699072 Glyat Rat testosterone increases expression ISO RGD:1316190 6480464 Testosterone results in increased expression of GLYAT mRNA CTD PMID:33359661 Glyat Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of GLYAT mRNA] CTD PMID:31150632 Glyat Rat tetrachloromethane decreases expression ISO RGD:1316191 6480464 Carbon Tetrachloride results in decreased expression of GLYAT mRNA CTD PMID:31919559 Glyat Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of GLYAT mRNA CTD PMID:31150632 Glyat Rat tetracycline decreases expression ISO RGD:1316191 6480464 Tetracycline results in decreased expression of GLYAT mRNA CTD PMID:24489787 Glyat Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of GLYAT mRNA CTD PMID:34492290 Glyat Rat triptonide increases expression ISO RGD:1316191 6480464 triptonide results in increased expression of GLYAT mRNA CTD PMID:33045310 Glyat Rat trovafloxacin increases expression EXP 6480464 trovafloxacin results in increased expression of GLYAT mRNA CTD PMID:24136188 Glyat Rat vancomycin increases expression ISO RGD:1316191 6480464 Vancomycin results in increased expression of GLYAT mRNA CTD PMID:18930951
(+)-schisandrin B (EXP) 1,1-dichloroethene (ISO) 1,2-dichloroethane (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,3,4,7,8-Pentachlorodibenzofuran (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3-chloropropane-1,2-diol (EXP) 4-hydroxyphenyl retinamide (ISO) acetamide (EXP) aflatoxin B1 (ISO) asbestos (ISO) benomyl (EXP) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) buspirone (EXP) buta-1,3-diene (ISO) carbon nanotube (ISO) CGP 52608 (ISO) ciguatoxin CTX1B (ISO) cyclosporin A (ISO) DDE (EXP) dibenzofurans (ISO) endosulfan (EXP,ISO) fipronil (EXP) flutamide (EXP) gamma-hexachlorocyclohexane (EXP) genistein (ISO) glafenine (EXP) Heliotrine (ISO) N-nitrosodiethylamine (EXP) nimesulide (EXP) O-methyleugenol (ISO) ochratoxin A (EXP) okadaic acid (ISO) paracetamol (ISO) perfluorononanoic acid (ISO) pirinixic acid (ISO) progesterone (ISO) raloxifene (ISO) rotenone (EXP) senecionine (ISO) Senkirkine (ISO) silicon dioxide (ISO) sodium arsenite (EXP,ISO) tamoxifen (ISO) testosterone (ISO) tetrachloromethane (EXP,ISO) tetracycline (ISO) thioacetamide (EXP) triptonide (ISO) trovafloxacin (EXP) vancomycin (ISO)
Glyat Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 219,128,798 - 219,149,615 (+) NCBI GRCr8 mRatBN7.2 1 209,704,213 - 209,724,949 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 209,704,268 - 209,724,942 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 218,085,147 - 218,098,962 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 225,016,795 - 225,030,610 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 217,839,615 - 217,853,430 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 229,060,125 - 229,081,113 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 229,063,714 - 229,080,410 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 236,219,894 - 236,240,842 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 215,653,254 - 215,666,991 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 215,805,312 - 215,825,975 (+) NCBI Celera 1 207,123,726 - 207,137,541 (+) NCBI Celera Cytogenetic Map 1 q43 NCBI
GLYAT Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 58,708,757 - 58,731,943 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 58,640,426 - 58,731,974 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 58,476,230 - 58,499,416 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 58,232,806 - 58,256,023 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 58,232,806 - 58,256,023 NCBI Celera 11 55,835,316 - 55,858,530 (-) NCBI Celera Cytogenetic Map 11 q12.1 NCBI HuRef 11 54,824,088 - 54,847,302 (-) NCBI HuRef CHM1_1 11 58,341,787 - 58,365,009 (-) NCBI CHM1_1 T2T-CHM13v2.0 11 58,658,251 - 58,681,452 (-) NCBI T2T-CHM13v2.0
Glyat Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 12,610,672 - 12,629,101 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 12,610,672 - 12,631,275 (+) Ensembl GRCm39 Ensembl GRCm38 19 12,633,308 - 12,651,737 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 12,633,308 - 12,653,911 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 12,707,798 - 12,726,227 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 12,700,353 - 12,718,782 (+) NCBI MGSCv36 mm8 Celera 19 13,297,911 - 13,316,476 (+) NCBI Celera Cytogenetic Map 19 A NCBI cM Map 19 8.73 NCBI
Glyat Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955511 3,667,607 - 3,683,886 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955511 3,670,736 - 3,683,751 (-) NCBI ChiLan1.0 ChiLan1.0
GLYAT Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 59,871,072 - 59,895,934 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 60,897,611 - 60,922,382 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 53,963,676 - 53,985,965 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 57,422,421 - 57,445,649 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 57,423,438 - 57,438,213 (-) Ensembl panpan1.1 panPan2
GLYAT Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 18 37,689,076 - 37,715,614 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 18 37,656,675 - 37,715,063 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 18 37,225,600 - 37,252,145 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 18 38,341,706 - 38,368,316 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 18 38,255,983 - 38,368,313 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 18 37,941,246 - 37,967,818 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 18 37,510,598 - 37,537,545 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 18 38,133,865 - 38,160,440 (+) NCBI UU_Cfam_GSD_1.0
LOC100517803 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa10.2 2 12,057,606 - 12,070,867 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GLYAT Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 14,644,308 - 14,668,440 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 14,653,030 - 14,669,030 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 111,976,494 - 111,992,361 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
.
Predicted Target Of
Count of predictions: 44 Count of miRNA genes: 38 Interacting mature miRNAs: 42 Transcripts: ENSRNOT00000016454 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
8693637 Alc29 Alcohol consumption QTL 29 2.7 0.258 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 1 207987464 234238494 Rat 1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1357335 Bw39 Body weight QTL 39 3.3 body mass (VT:0001259) body weight (CMO:0000012) 1 197814409 242814409 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 2302375 Bw83 Body weight QTL 83 4.87 0.0002 body mass (VT:0001259) body weight (CMO:0000012) 1 197697768 242697768 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2293674 Bss39 Bone structure and strength QTL 39 7.1 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 1 201554356 246554356 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1354653 Despr9 Despair related QTL 9 0.00019 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 167909849 212909849 Rat 2293673 Bss27 Bone structure and strength QTL 27 18.63 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 1 171629477 216629477 Rat 2293677 Bss41 Bone structure and strength QTL 41 9.38 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 1 171629477 216629477 Rat 1302787 Stl25 Serum triglyceride level QTL 25 2.7 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 180359209 210702199 Rat 1549830 Bss1 Bone structure and strength QTL 1 4.8 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 172609619 217609619 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 70163 Bw20 Body weight QTL 20 5.1 body mass (VT:0001259) body weight (CMO:0000012) 1 174133260 219133260 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1558658 Bw59 Body weight QTL 59 3.5 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 1 178784622 223784622 Rat 1600397 Edcs4 Endometrial carcinoma susceptibility QTL 4 2.2 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 1 206081677 251081677 Rat 631838 Niddm36 Non-insulin dependent diabetes mellitus QTL 36 0.01 insulin secretion trait (VT:0003564) calculated pancreatic islet insulin release measurement (CMO:0001217) 1 184550676 229550676 Rat 8693661 Alc34 Alcohol consumption QTL 34 2.2 0.611 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 1 207987464 228627600 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 2293689 Bss47 Bone structure and strength QTL 47 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 1 171629477 216629477 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 2293694 Bss38 Bone structure and strength QTL 38 7.05 0.0001 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 1 201554356 246554356 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 61341 Bp26 Blood pressure QTL 26 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 169537671 214537671 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 2293693 Bss22 Bone structure and strength QTL 22 33.52 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 1 171629477 216629477 Rat 2300161 Bmd43 Bone mineral density QTL 43 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 1300145 Rf7 Renal function QTL 7 2.96 urine creatinine amount (VT:0010540) urine creatinine level (CMO:0000125) 1 185145134 221264292 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631214 Bw61 Body weight QTL61 3.4 0.0001 intramuscular adipose amount (VT:0010044) intramuscular fat area (CMO:0001162) 1 173108781 218108781 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 2300175 Bmd40 Bone mineral density QTL 40 15.4 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 1 201554356 246554356 Rat 2300174 Bmd42 Bone mineral density QTL 42 8.4 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 1 171629477 216629477 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 737977 Bp160 Blood pressure QTL 160 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 181133855 226133855 Rat 2293654 Bss30 Bone structure and strength QTL 30 32.65 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 1 171629477 216629477 Rat 2293655 Bss36 Bone structure and strength QTL 36 10.66 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 201554356 246554356 Rat 1298084 Thym4 Thymus enlargement QTL 4 10.68 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 197814409 242814409 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 2300187 Bmd41 Bone mineral density QTL 41 8.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 8552891 Epfw5 Epididymal fat weight QTL 5 4.4 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 1 193113876 238113876 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358292 Cm37 Cardiac mass QTL 37 6.2 8e-07 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 1 196248093 241248093 Rat 61376 Bp42 Blood pressure QTL 42 23.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 197814409 242814409 Rat 634313 Niddm43 Non-insulin dependent diabetes mellitus QTL 43 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 199050459 259647894 Rat 634312 Bp143 Blood pressure QTL 143 3 0.0002 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 182623426 219932796 Rat 1358294 Bw37 Body weight QTL 37 5 0.000011 body mass (VT:0001259) body weight (CMO:0000012) 1 171310381 216310381 Rat 1357399 Bw45 Body weight QTL 45 3.05 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 1 206329708 251329708 Rat 724559 Pancm1 Pancreatic morphology QTL 1 7.1 islet of Langerhans morphology trait (VT:0005215) pancreatic islet damage composite score (CMO:0001156) 1 181759564 214537555 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 1357404 Bw42 Body weight QTL 42 4.49 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 1 206329708 251329708 Rat 10059600 Bp378 Blood pressure QTL 378 3.08 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 176869060 221869060 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 619613 Bp77 Blood pressure QTL 77 0.01 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 164747424 209747424 Rat 2312564 Glom18 Glomerulus QTL 18 2.4 0.003 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 185356336 231689108 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 2292218 Kidm35 Kidney mass QTL 35 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 199368955 224569684 Rat 724562 Rends1 Renal damage susceptibility QTL 1 0.05 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 1 169537671 214537671 Rat 1331790 Bp201 Blood pressure QTL 201 3.127 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 198211513 225126682 Rat 10059587 Bw173 Body weight QTL 173 3.23 0.025 body mass (VT:0001259) body weight (CMO:0000012) 1 202069611 247069611 Rat 61403 Niddm4 Non-insulin dependent diabetes mellitus QTL 4 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 206329708 222745518 Rat 1300168 Bp170 Blood pressure QTL 170 2.76 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 207702246 228581766 Rat 2292222 Bp307 Blood pressure QTL 307 3.06 0.0014 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 213533942 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 10059590 Kidm44 Kidney mass QTL 44 3.42 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 191033875 236033875 Rat 1641926 Teswt2 Testicular weight QTL 2 2.82 testis mass (VT:1000644) both testes wet weight (CMO:0000175) 1 197697768 238755659 Rat 631658 Cm7 Cardiac mass QTL 7 5.32 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 1 196248093 241248093 Rat 1600380 Niddm70 Non-insulin dependent diabetes mellitus QTL 70 3.1 0.0008 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 176550523 221550523 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1582206 Kidm33 Kidney mass QTL 33 6.9 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 188377360 224054420 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 634338 Hcar4 Hepatocarcinoma resistance QTL 4 4.6 liver integrity trait (VT:0010547) liver tumorous lesion number to liver area ratio (CMO:0001210) 1 193422268 214537671 Rat 6903303 Scl34 Serum cholesterol QTL 34 2.5 0.0033 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 180359209 218108781 Rat 1600374 Mcs17 Mammary carcinoma susceptibility QTL 17 3 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 197670404 242670404 Rat 1600363 Hc6 Hypercalciuria QTL 6 2.7 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 203995416 244113296 Rat 8693618 Alc25 Alcohol consumption QTL 25 3 0.28 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 1 207987464 228627600 Rat 2293083 Iddm25 Insulin dependent diabetes mellitus QTL 25 4.18 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 181829673 224569684 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 7394701 Uae46 Urinary albumin excretion QTL 46 3.6 0.0056 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 201554356 246554356 Rat
D1Got209
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 209,704,654 - 209,704,904 (+) MAPPER mRatBN7.2 Rnor_6.0 1 229,060,640 - 229,060,889 NCBI Rnor6.0 Rnor_5.0 1 236,220,370 - 236,220,619 UniSTS Rnor5.0 RGSC_v3.4 1 215,647,269 - 215,647,519 RGD RGSC3.4 RGSC_v3.4 1 215,647,270 - 215,647,519 UniSTS RGSC3.4 RGSC_v3.1 1 215,805,699 - 215,805,949 RGD Celera 1 207,117,825 - 207,118,074 UniSTS RH 3.4 Map 1 1496.3 UniSTS RH 3.4 Map 1 1496.3 RGD RH 2.0 Map 1 1154.7 RGD Cytogenetic Map 1 q43 UniSTS
AI233103
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 209,724,711 - 209,724,873 (+) MAPPER mRatBN7.2 Rnor_6.0 1 229,080,553 - 229,080,714 NCBI Rnor6.0 Rnor_5.0 1 236,240,283 - 236,240,444 UniSTS Rnor5.0 RGSC_v3.4 1 215,667,332 - 215,667,493 UniSTS RGSC3.4 Celera 1 207,137,882 - 207,138,043 UniSTS RH 3.4 Map 1 1492.8 UniSTS Cytogenetic Map 1 q43 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
10
20
50
87
85
55
25
55
6
184
67
30
45
44
30
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000016454 ⟹ ENSRNOP00000016454
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 209,704,268 - 209,724,942 (+) Ensembl Rnor_6.0 Ensembl 1 229,066,045 - 229,080,410 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000087526 ⟹ ENSRNOP00000069894
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 209,707,729 - 209,724,372 (+) Ensembl Rnor_6.0 Ensembl 1 229,063,714 - 229,080,209 (+) Ensembl
RefSeq Acc Id:
NM_001009648 ⟹ NP_001009648
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 219,128,926 - 219,149,615 (+) NCBI mRatBN7.2 1 209,704,260 - 209,724,949 (+) NCBI Rnor_6.0 1 229,066,541 - 229,080,212 (+) NCBI Rnor_5.0 1 236,219,894 - 236,240,842 (+) NCBI RGSC_v3.4 1 215,653,254 - 215,666,991 (+) RGD Celera 1 207,123,726 - 207,137,541 (+) RGD
Sequence:
ATGATTGTTCCATTACAAGGTGCACAGATGCTACAAATGCTGGAGAAATCCTTGAAGAAGTACCTTCCTGAATCCTTAAAGGTCTATGGGACCATCTATCATGTGAACCATGGAAACCCATTCAATCT
hide sequence
RefSeq Acc Id:
NM_001412553 ⟹ NP_001399482
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 219,128,926 - 219,149,615 (+) NCBI mRatBN7.2 1 209,704,260 - 209,724,949 (+) NCBI
RefSeq Acc Id:
NR_178215
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 219,128,926 - 219,149,615 (+) NCBI mRatBN7.2 1 209,704,260 - 209,724,949 (+) NCBI
RefSeq Acc Id:
XM_039108703 ⟹ XP_038964631
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 219,135,208 - 219,149,615 (+) NCBI mRatBN7.2 1 209,715,467 - 209,724,946 (+) NCBI
RefSeq Acc Id:
XM_039108704 ⟹ XP_038964632
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 219,135,208 - 219,149,615 (+) NCBI mRatBN7.2 1 209,710,542 - 209,724,946 (+) NCBI
RefSeq Acc Id:
XM_063286978 ⟹ XP_063143048
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 219,128,798 - 219,149,615 (+) NCBI
RefSeq Acc Id:
XM_063286979 ⟹ XP_063143049
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 219,128,798 - 219,149,615 (+) NCBI
RefSeq Acc Id:
XM_063286980 ⟹ XP_063143050
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 219,128,798 - 219,149,615 (+) NCBI
RefSeq Acc Id:
XM_063286982 ⟹ XP_063143052
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 219,129,031 - 219,149,615 (+) NCBI
RefSeq Acc Id:
NP_001009648 ⟸ NM_001009648
- UniProtKB:
Q7TP56 (UniProtKB/Swiss-Prot), Q5PQT3 (UniProtKB/Swiss-Prot), A4PB92 (UniProtKB/TrEMBL), A0A0G2JWI5 (UniProtKB/TrEMBL)
- Sequence:
MIVPLQGAQMLQMLEKSLKKYLPESLKVYGTIYHVNHGNPFNLKALVDKWPDFNTVVVRPQEQEMKDDLDFYTNTYQIYSKDPENCQEFLGSSEVINWKQHLQIQSSQSHLNKAIQNLASIHSLQVKH
hide sequence
Ensembl Acc Id:
ENSRNOP00000069894 ⟸ ENSRNOT00000087526
Ensembl Acc Id:
ENSRNOP00000016454 ⟸ ENSRNOT00000016454
RefSeq Acc Id:
XP_038964632 ⟸ XM_039108704
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038964631 ⟸ XM_039108703
- Peptide Label:
isoform X2
RefSeq Acc Id:
NP_001399482 ⟸ NM_001412553
- UniProtKB:
Q5PQT3 (UniProtKB/Swiss-Prot), Q7TP56 (UniProtKB/Swiss-Prot), A0A0G2JWI5 (UniProtKB/TrEMBL), A4PB92 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063143048 ⟸ XM_063286978
- Peptide Label:
isoform X1
- UniProtKB:
Q7TP56 (UniProtKB/Swiss-Prot), Q5PQT3 (UniProtKB/Swiss-Prot), A0A0G2JWI5 (UniProtKB/TrEMBL), A4PB92 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063143050 ⟸ XM_063286980
- Peptide Label:
isoform X1
- UniProtKB:
Q7TP56 (UniProtKB/Swiss-Prot), Q5PQT3 (UniProtKB/Swiss-Prot), A0A0G2JWI5 (UniProtKB/TrEMBL), A4PB92 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063143049 ⟸ XM_063286979
- Peptide Label:
isoform X1
- UniProtKB:
Q7TP56 (UniProtKB/Swiss-Prot), Q5PQT3 (UniProtKB/Swiss-Prot), A0A0G2JWI5 (UniProtKB/TrEMBL), A4PB92 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063143052 ⟸ XM_063286982
- Peptide Label:
isoform X1
- UniProtKB:
Q7TP56 (UniProtKB/Swiss-Prot), Q5PQT3 (UniProtKB/Swiss-Prot), A0A0G2JWI5 (UniProtKB/TrEMBL), A4PB92 (UniProtKB/TrEMBL)
RGD ID: 13690816 Promoter ID: EPDNEW_R1323 Type: multiple initiation site Name: Glyat_1 Description: glycine-N-acyltransferase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 229,063,750 - 229,063,810 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-12-06
Glyat
glycine-N-acyltransferase
Glyat_predicted
glycine-N-acyltransferase (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Glyat_predicted
glycine-N-acyltransferase (predicted)
Symbol and Name status set to approved
70820 APPROVED
