Symbol:
Nabp1
Name:
nucleic acid binding protein 1
RGD ID:
1306658
Description:
Predicted to enable RNA binding activity and single-stranded DNA binding activity. Predicted to be involved in double-strand break repair via homologous recombination; mitotic G2/M transition checkpoint; and response to ionizing radiation. Predicted to be located in chromosome; cytosol; and nucleoplasm. Predicted to be part of SOSS complex. Orthologous to human NABP1 (nucleic acid binding protein 1); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC363227; MGC108887; nucleic acid-binding protein 1; Obfc2a; oligonucleotide/oligosaccharide-binding fold containing 2A; oligonucleotide/oligosaccharide-binding fold-containing protein 2A; RGD1306658; sensor of single-strand DNA complex subunit B2; sensor of ssDNA subunit B2; similar to 5830411E10Rik protein; single-stranded DNA-binding protein 2; SOSS complex subunit B2; SOSS-B2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 57,570,326 - 57,625,926 (+) NCBI GRCr8 mRatBN7.2 9 50,098,552 - 50,133,982 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 50,126,726 - 50,134,107 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 58,676,153 - 58,683,138 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 63,798,993 - 63,805,978 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 62,094,976 - 62,101,961 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 55,049,893 - 55,057,784 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 55,050,203 - 55,057,658 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 54,749,751 - 54,757,646 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 47,194,891 - 47,201,876 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 47,196,304 - 47,203,289 (+) NCBI Celera 9 47,773,210 - 47,780,195 (+) NCBI Celera Cytogenetic Map 9 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nabp1 Rat (-)-demecolcine increases expression ISO RGD:1603967 6480464 Demecolcine results in increased expression of NABP1 mRNA CTD PMID:23649840 Nabp1 Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:1331947 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of NABP1 mRNA CTD PMID:36331819 Nabp1 Rat 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions ISO RGD:1331947 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Nabp1 Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1331947 6480464 1,2-Dimethylhydrazine results in decreased expression of NABP1 mRNA CTD PMID:22206623 Nabp1 Rat 17beta-estradiol affects expression ISO RGD:1603967 6480464 Estradiol affects the expression of NABP1 mRNA CTD PMID:22574217 Nabp1 Rat 17beta-estradiol increases expression ISO RGD:1331947 6480464 Estradiol results in increased expression of NABP1 mRNA CTD PMID:39298647 Nabp1 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of NABP1 mRNA CTD PMID:32145629 Nabp1 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO RGD:1331947 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Nabp1 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO RGD:1331947 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Nabp1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1331947 6480464 Tetrachlorodibenzodioxin results in decreased expression of NABP1 mRNA CTD PMID:19770486 Nabp1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of NABP1 mRNA CTD PMID:34747641 Nabp1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1331947 6480464 Tetrachlorodibenzodioxin affects the expression of NABP1 mRNA CTD PMID:21570461 Nabp1 Rat 2,4,4'-trichlorobiphenyl multiple interactions ISO RGD:1331947 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Nabp1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO RGD:1331947 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of NABP1 mRNA CTD PMID:38648751 Nabp1 Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO RGD:1331947 6480464 tetrabromobisphenol A results in increased expression of NABP1 mRNA CTD PMID:25172293 Nabp1 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of NABP1 mRNA CTD PMID:28522335 Nabp1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:1603967 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Nabp1 Rat 4,4'-sulfonyldiphenol multiple interactions ISO RGD:1603967 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Nabp1 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1331947 6480464 bisphenol S results in increased expression of NABP1 mRNA CTD PMID:39298647 Nabp1 Rat 4-hydroxyphenyl retinamide decreases expression ISO RGD:1331947 6480464 Fenretinide results in decreased expression of NABP1 mRNA CTD PMID:28973697 Nabp1 Rat acetaldehyde decreases expression ISO RGD:1603967 6480464 Acetaldehyde results in decreased expression of NABP1 mRNA CTD PMID:23416264 Nabp1 Rat acrolein multiple interactions ISO RGD:1603967 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of more ... CTD PMID:32699268 Nabp1 Rat acrylamide increases expression ISO RGD:1603967 6480464 Acrylamide results in increased expression of NABP1 mRNA CTD PMID:32763439 Nabp1 Rat aflatoxin B1 increases expression ISO RGD:1331947 6480464 Aflatoxin B1 results in increased expression of NABP1 mRNA CTD PMID:19770486 Nabp1 Rat aflatoxin B1 decreases methylation ISO RGD:1603967 6480464 Aflatoxin B1 results in decreased methylation of NABP1 gene CTD PMID:27153756 Nabp1 Rat aflatoxin B1 increases expression ISO RGD:1603967 6480464 Aflatoxin B1 results in increased expression of NABP1 mRNA CTD PMID:21632981|PMID:27153756 Nabp1 Rat aflatoxin B1 affects expression ISO RGD:1603967 6480464 Aflatoxin B1 affects the expression of NABP1 protein CTD PMID:20106945 Nabp1 Rat all-trans-retinoic acid increases expression ISO RGD:1603967 6480464 Tretinoin results in increased expression of NABP1 mRNA CTD PMID:33167477 Nabp1 Rat alpha-pinene multiple interactions ISO RGD:1603967 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of more ... CTD PMID:32699268 Nabp1 Rat antirheumatic drug decreases expression ISO RGD:1603967 6480464 Antirheumatic Agents results in decreased expression of NABP1 mRNA CTD PMID:24449571 Nabp1 Rat arsane multiple interactions ISO RGD:1603967 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Nabp1 Rat arsenic atom multiple interactions ISO RGD:1603967 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Nabp1 Rat arsenous acid multiple interactions ISO RGD:1603967 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to NABP1 protein] CTD PMID:26598702 Nabp1 Rat azathioprine increases expression ISO RGD:1603967 6480464 Azathioprine results in increased expression of NABP1 mRNA CTD PMID:22623647 Nabp1 Rat benzo[a]pyrene decreases expression ISO RGD:1603967 6480464 Benzo(a)pyrene results in decreased expression of NABP1 mRNA CTD PMID:20064835 Nabp1 Rat benzo[a]pyrene increases expression ISO RGD:1603967 6480464 Benzo(a)pyrene results in increased expression of NABP1 mRNA CTD PMID:20106945|PMID:21632981|PMID:21871943|PMID:22316170|PMID:32234424 Nabp1 Rat benzo[a]pyrene diol epoxide I affects expression ISO RGD:1603967 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide affects the expression of NABP1 mRNA CTD PMID:20382639 Nabp1 Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:1603967 6480464 Diethylhexyl Phthalate results in increased expression of NABP1 mRNA CTD PMID:31163220 Nabp1 Rat bisphenol A increases expression ISO RGD:1331947 6480464 bisphenol A results in increased expression of NABP1 mRNA CTD PMID:21932408 Nabp1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of NABP1 mRNA CTD PMID:32145629 Nabp1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of NABP1 gene CTD PMID:28505145 Nabp1 Rat bisphenol A multiple interactions ISO RGD:1603967 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Nabp1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NABP1 mRNA CTD PMID:25181051|PMID:26982218|PMID:31129395|PMID:34947998 Nabp1 Rat Bisphenol A diglycidyl ether affects splicing ISO RGD:1331947 6480464 bisphenol A diglycidyl ether affects the splicing of NABP1 mRNA CTD PMID:36464114 Nabp1 Rat bisphenol AF affects splicing ISO RGD:1331947 6480464 bisphenol AF affects the splicing of NABP1 mRNA CTD PMID:36464114 Nabp1 Rat bortezomib increases expression ISO RGD:1603967 6480464 Bortezomib results in increased expression of NABP1 mRNA CTD PMID:20977926 Nabp1 Rat cadmium atom increases expression ISO RGD:1603967 6480464 Cadmium results in increased expression of NABP1 mRNA CTD PMID:23369406 Nabp1 Rat cadmium dichloride affects expression EXP 6480464 Cadmium Chloride affects the expression of NABP1 mRNA CTD PMID:22110744 Nabp1 Rat cadmium dichloride decreases expression ISO RGD:1603967 6480464 Cadmium Chloride results in decreased expression of NABP1 mRNA CTD PMID:38568856 Nabp1 Rat carbamazepine affects expression ISO RGD:1603967 6480464 Carbamazepine affects the expression of NABP1 mRNA CTD PMID:25979313 Nabp1 Rat CGP 52608 multiple interactions ISO RGD:1603967 6480464 CGP 52608 promotes the reaction [RORA protein binds to NABP1 gene] CTD PMID:28238834 Nabp1 Rat cisplatin increases expression ISO RGD:1603967 6480464 Cisplatin results in increased expression of NABP1 mRNA CTD PMID:27594783 Nabp1 Rat cobalt dichloride decreases expression ISO RGD:1603967 6480464 cobaltous chloride results in decreased expression of NABP1 mRNA CTD PMID:19320972 Nabp1 Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of NABP1 mRNA CTD PMID:24386269 Nabp1 Rat copper(II) sulfate increases expression ISO RGD:1603967 6480464 Copper Sulfate results in increased expression of NABP1 mRNA CTD PMID:19549813 Nabp1 Rat crocidolite asbestos increases expression ISO RGD:1603967 6480464 Asbestos, Crocidolite results in increased expression of NABP1 mRNA CTD PMID:18687144 Nabp1 Rat crocidolite asbestos decreases expression ISO RGD:1331947 6480464 Asbestos, Crocidolite results in decreased expression of NABP1 mRNA CTD PMID:29279043 Nabp1 Rat cyclosporin A increases expression ISO RGD:1603967 6480464 Cyclosporine results in increased expression of NABP1 mRNA CTD PMID:20106945|PMID:21632981|PMID:25562108 Nabp1 Rat cyclosporin A decreases expression ISO RGD:1603967 6480464 Cyclosporine results in decreased expression of NABP1 mRNA CTD PMID:27989131 Nabp1 Rat dexamethasone increases expression ISO RGD:1603967 6480464 Dexamethasone results in increased expression of NABP1 mRNA CTD PMID:25047013 Nabp1 Rat dexamethasone multiple interactions ISO RGD:1603967 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Nabp1 Rat diallyl trisulfide increases expression ISO RGD:1603967 6480464 diallyl trisulfide results in increased expression of NABP1 mRNA CTD PMID:34995734 Nabp1 Rat diarsenic trioxide multiple interactions ISO RGD:1603967 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to NABP1 protein] CTD PMID:26598702 Nabp1 Rat Dibutyl phosphate affects expression ISO RGD:1603967 6480464 di-n-butylphosphoric acid affects the expression of NABP1 mRNA CTD PMID:37042841 Nabp1 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of NABP1 mRNA CTD PMID:21266533 Nabp1 Rat diuron increases expression EXP 6480464 Diuron results in increased expression of NABP1 mRNA CTD PMID:21551480 Nabp1 Rat dorsomorphin multiple interactions ISO RGD:1603967 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Nabp1 Rat doxorubicin decreases expression ISO RGD:1603967 6480464 Doxorubicin results in decreased expression of NABP1 mRNA CTD PMID:29803840 Nabp1 Rat entinostat increases expression ISO RGD:1603967 6480464 entinostat results in increased expression of NABP1 mRNA CTD PMID:27188386 Nabp1 Rat epoxiconazole decreases expression ISO RGD:1331947 6480464 epoxiconazole results in decreased expression of NABP1 mRNA CTD PMID:35436446 Nabp1 Rat ethanol increases expression ISO RGD:1331947 6480464 Ethanol results in increased expression of NABP1 mRNA CTD PMID:30319688 Nabp1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of NABP1 mRNA CTD PMID:24136188 Nabp1 Rat formaldehyde decreases expression ISO RGD:1603967 6480464 Formaldehyde results in decreased expression of NABP1 mRNA CTD PMID:20655997 Nabp1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of NABP1 mRNA CTD PMID:33387578 Nabp1 Rat GSK-J4 decreases expression ISO RGD:1603967 6480464 GSK-J4 results in decreased expression of NABP1 mRNA CTD PMID:29301935 Nabp1 Rat hydrogen peroxide affects expression ISO RGD:1603967 6480464 Hydrogen Peroxide affects the expression of NABP1 mRNA CTD PMID:20044591 Nabp1 Rat indometacin multiple interactions ISO RGD:1603967 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Nabp1 Rat indometacin increases expression ISO RGD:1603967 6480464 Indomethacin results in increased expression of NABP1 mRNA CTD PMID:24737281 Nabp1 Rat isoprenaline decreases expression ISO RGD:1331947 6480464 Isoproterenol results in decreased expression of NABP1 mRNA CTD PMID:20003209 Nabp1 Rat ketamine decreases expression EXP 6480464 Ketamine results in decreased expression of NABP1 mRNA CTD PMID:20080153 Nabp1 Rat leflunomide increases expression ISO RGD:1603967 6480464 leflunomide results in increased expression of NABP1 mRNA CTD PMID:28988120 Nabp1 Rat manganese atom multiple interactions ISO RGD:1603967 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Nabp1 Rat manganese(0) multiple interactions ISO RGD:1603967 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Nabp1 Rat manganese(II) chloride multiple interactions ISO RGD:1603967 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Nabp1 Rat menadione affects expression ISO RGD:1603967 6480464 Vitamin K 3 affects the expression of NABP1 mRNA CTD PMID:20044591 Nabp1 Rat mercury dibromide increases expression ISO RGD:1603967 6480464 mercuric bromide results in increased expression of NABP1 mRNA CTD PMID:26272509 Nabp1 Rat mercury dibromide multiple interactions ISO RGD:1603967 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Nabp1 Rat methylisothiazolinone increases expression ISO RGD:1603967 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of NABP1 mRNA CTD PMID:31629900 Nabp1 Rat methylmercury chloride increases expression ISO RGD:1603967 6480464 methylmercuric chloride results in increased expression of NABP1 mRNA CTD PMID:28001369 Nabp1 Rat methylphenidate increases expression ISO RGD:1331947 6480464 Methylphenidate results in increased expression of NABP1 mRNA CTD PMID:22470460 Nabp1 Rat N(4)-hydroxycytidine decreases expression ISO RGD:1331947 6480464 N(4)-hydroxycytidine results in decreased expression of NABP1 mRNA CTD PMID:37748715 Nabp1 Rat nickel atom increases expression ISO RGD:1603967 6480464 Nickel results in increased expression of NABP1 mRNA CTD PMID:24768652|PMID:25583101 Nabp1 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of NABP1 mRNA CTD PMID:22110744 Nabp1 Rat okadaic acid decreases expression ISO RGD:1603967 6480464 Okadaic Acid results in decreased expression of NABP1 mRNA CTD PMID:38832940 Nabp1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of NABP1 mRNA CTD PMID:25729387 Nabp1 Rat ozone multiple interactions ISO RGD:1603967 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of more ... CTD PMID:32699268|PMID:35430440 Nabp1 Rat ozone multiple interactions ISO RGD:1331947 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of NABP1 more ... CTD PMID:34911549 Nabp1 Rat p-chloromercuribenzoic acid increases expression ISO RGD:1603967 6480464 p-Chloromercuribenzoic Acid results in increased expression of NABP1 mRNA CTD PMID:26272509 Nabp1 Rat p-chloromercuribenzoic acid multiple interactions ISO RGD:1603967 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Nabp1 Rat panobinostat increases expression ISO RGD:1603967 6480464 panobinostat results in increased expression of NABP1 mRNA CTD PMID:26272509 Nabp1 Rat panobinostat multiple interactions ISO RGD:1603967 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Nabp1 Rat paracetamol affects expression ISO RGD:1331947 6480464 Acetaminophen affects the expression of NABP1 mRNA CTD PMID:17562736 Nabp1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of NABP1 mRNA CTD PMID:33387578 Nabp1 Rat paracetamol decreases expression ISO RGD:1603967 6480464 Acetaminophen results in decreased expression of NABP1 mRNA CTD PMID:21420995 Nabp1 Rat paracetamol increases expression ISO RGD:1603967 6480464 Acetaminophen results in increased expression of NABP1 mRNA CTD PMID:22230336|PMID:29067470 Nabp1 Rat paraquat increases expression ISO RGD:1603967 6480464 Paraquat results in increased expression of NABP1 mRNA CTD PMID:23613995 Nabp1 Rat PCB138 multiple interactions ISO RGD:1331947 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Nabp1 Rat pentachlorophenol increases expression ISO RGD:1331947 6480464 Pentachlorophenol results in increased expression of NABP1 mRNA CTD PMID:23892564 Nabp1 Rat perfluorooctane-1-sulfonic acid decreases expression ISO RGD:1603967 6480464 perfluorooctane sulfonic acid results in decreased expression of NABP1 mRNA CTD PMID:27153767 Nabp1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1331947 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of NABP1 mRNA; [perfluorooctane sulfonic more ... CTD PMID:36331819 Nabp1 Rat phenobarbital multiple interactions ISO RGD:1331947 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of NABP1 mRNA] CTD PMID:19482888 Nabp1 Rat phenobarbital increases expression ISO RGD:1331947 6480464 Phenobarbital results in increased expression of NABP1 mRNA CTD PMID:19482888 Nabp1 Rat phenylmercury acetate increases expression ISO RGD:1603967 6480464 Phenylmercuric Acetate results in increased expression of NABP1 mRNA CTD PMID:26272509 Nabp1 Rat phenylmercury acetate multiple interactions ISO RGD:1603967 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Nabp1 Rat pregnenolone 16alpha-carbonitrile decreases expression ISO RGD:1331947 6480464 Pregnenolone Carbonitrile results in decreased expression of NABP1 mRNA CTD PMID:28903501 Nabp1 Rat propanal increases expression ISO RGD:1603967 6480464 propionaldehyde results in increased expression of NABP1 mRNA CTD PMID:26079696 Nabp1 Rat propiconazole increases expression ISO RGD:1331947 6480464 propiconazole results in increased expression of NABP1 mRNA CTD PMID:21278054 Nabp1 Rat protein kinase inhibitor multiple interactions ISO RGD:1603967 6480464 Protein Kinase Inhibitors inhibits the reaction [gardiquimod results in increased expression of NABP1 mRNA] CTD PMID:28003376 Nabp1 Rat quercetin increases expression ISO RGD:1603967 6480464 Quercetin results in increased expression of NABP1 mRNA CTD PMID:21632981 Nabp1 Rat resveratrol increases expression ISO RGD:1603967 6480464 resveratrol results in increased expression of NABP1 mRNA CTD PMID:17257620 Nabp1 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of NABP1 mRNA CTD PMID:28374803 Nabp1 Rat SB 431542 multiple interactions ISO RGD:1603967 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Nabp1 Rat silicon dioxide increases expression ISO RGD:1603967 6480464 Silicon Dioxide analog results in increased expression of NABP1 mRNA CTD PMID:25895662 Nabp1 Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of NABP1 mRNA CTD PMID:22431001 Nabp1 Rat silicon dioxide increases expression ISO RGD:1331947 6480464 Silicon Dioxide results in increased expression of NABP1 mRNA CTD PMID:19073995|PMID:23221170 Nabp1 Rat silver atom increases expression ISO RGD:1603967 6480464 Silver results in increased expression of NABP1 mRNA CTD PMID:26014281 Nabp1 Rat silver(0) increases expression ISO RGD:1603967 6480464 Silver results in increased expression of NABP1 mRNA CTD PMID:26014281 Nabp1 Rat sodium arsenite increases expression ISO RGD:1603967 6480464 sodium arsenite results in increased expression of NABP1 mRNA CTD PMID:29301061|PMID:32844245 Nabp1 Rat sodium arsenite multiple interactions ISO RGD:1603967 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Nabp1 Rat sodium arsenite affects expression ISO RGD:1603967 6480464 sodium arsenite affects the expression of NABP1 mRNA CTD PMID:34032870 Nabp1 Rat succimer multiple interactions ISO RGD:1331947 6480464 [Succimer binds to Magnetite Nanoparticles] which results in increased expression of NABP1 mRNA CTD PMID:21641980 Nabp1 Rat sunitinib increases expression ISO RGD:1603967 6480464 Sunitinib results in increased expression of NABP1 mRNA CTD PMID:31533062 Nabp1 Rat tamoxifen affects expression ISO RGD:1331947 6480464 Tamoxifen affects the expression of NABP1 mRNA CTD PMID:20937368 Nabp1 Rat temozolomide decreases expression ISO RGD:1603967 6480464 Temozolomide results in decreased expression of NABP1 mRNA CTD PMID:31758290 Nabp1 Rat testosterone decreases expression ISO RGD:1603967 6480464 Testosterone results in decreased expression of NABP1 mRNA CTD PMID:33359661 Nabp1 Rat tetrachloromethane increases expression ISO RGD:1331947 6480464 Carbon Tetrachloride results in increased expression of NABP1 mRNA CTD PMID:27339419|PMID:31919559 Nabp1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of NABP1 mRNA CTD PMID:34492290 Nabp1 Rat thiram decreases expression ISO RGD:1603967 6480464 Thiram results in decreased expression of NABP1 mRNA CTD PMID:38568856 Nabp1 Rat titanium dioxide decreases methylation ISO RGD:1331947 6480464 titanium dioxide results in decreased methylation of NABP1 gene; titanium dioxide results in decreased methylation more ... CTD PMID:35295148 Nabp1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of NABP1 mRNA CTD PMID:25729387 Nabp1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of NABP1 mRNA CTD PMID:33387578 Nabp1 Rat trichostatin A increases expression ISO RGD:1603967 6480464 trichostatin A results in increased expression of NABP1 mRNA CTD PMID:24935251|PMID:26272509 Nabp1 Rat trichostatin A multiple interactions ISO RGD:1603967 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Nabp1 Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of NABP1 mRNA CTD PMID:30589522 Nabp1 Rat triphenyl phosphate affects expression ISO RGD:1603967 6480464 triphenyl phosphate affects the expression of NABP1 mRNA CTD PMID:37042841 Nabp1 Rat triptonide increases expression ISO RGD:1331947 6480464 triptonide results in increased expression of NABP1 mRNA CTD PMID:33045310 Nabp1 Rat tris(2-butoxyethyl) phosphate affects expression ISO RGD:1603967 6480464 tris(2-butoxyethyl) phosphate affects the expression of NABP1 mRNA CTD PMID:29024780 Nabp1 Rat troglitazone increases expression ISO RGD:1331947 6480464 troglitazone results in increased expression of NABP1 mRNA CTD PMID:28973697 Nabp1 Rat valproic acid decreases expression ISO RGD:1603967 6480464 Valproic Acid results in decreased expression of NABP1 mRNA CTD PMID:29154799 Nabp1 Rat valproic acid increases expression ISO RGD:1603967 6480464 Valproic Acid results in increased expression of NABP1 mRNA CTD PMID:19101580|PMID:23179753|PMID:24383497|PMID:24935251|PMID:26272509|PMID:27188386|PMID:28001369 Nabp1 Rat valproic acid multiple interactions ISO RGD:1603967 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Nabp1 Rat valproic acid affects expression ISO RGD:1603967 6480464 Valproic Acid affects the expression of NABP1 mRNA CTD PMID:25979313 Nabp1 Rat valproic acid decreases methylation ISO RGD:1603967 6480464 Valproic Acid results in decreased methylation of NABP1 gene CTD PMID:29154799 Nabp1 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of NABP1 mRNA CTD PMID:23034163 Nabp1 Rat vincristine increases expression ISO RGD:1603967 6480464 Vincristine results in increased expression of NABP1 mRNA CTD PMID:23649840 Nabp1 Rat vorinostat multiple interactions ISO RGD:1603967 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Nabp1 Rat vorinostat increases expression ISO RGD:1603967 6480464 vorinostat results in increased expression of NABP1 mRNA CTD PMID:26272509|PMID:27188386 Nabp1 Rat zinc atom multiple interactions ISO RGD:1603967 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of NABP1 mRNA CTD PMID:18593933 Nabp1 Rat zinc(0) multiple interactions ISO RGD:1603967 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of NABP1 mRNA CTD PMID:18593933
(-)-demecolcine (ISO) (1->4)-beta-D-glucan (ISO) 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,4'-trichlorobiphenyl (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) acetaldehyde (ISO) acrolein (ISO) acrylamide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) azathioprine (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) Bisphenol A diglycidyl ether (ISO) bisphenol AF (ISO) bortezomib (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) carbamazepine (ISO) CGP 52608 (ISO) cisplatin (ISO) cobalt dichloride (EXP,ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) dexamethasone (ISO) diallyl trisulfide (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) entinostat (ISO) epoxiconazole (ISO) ethanol (ISO) flutamide (EXP) formaldehyde (ISO) gentamycin (EXP) GSK-J4 (ISO) hydrogen peroxide (ISO) indometacin (ISO) isoprenaline (ISO) ketamine (EXP) leflunomide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) menadione (ISO) mercury dibromide (ISO) methylisothiazolinone (ISO) methylmercury chloride (ISO) methylphenidate (ISO) N(4)-hydroxycytidine (ISO) nickel atom (ISO) nickel dichloride (EXP) okadaic acid (ISO) oxaliplatin (EXP) ozone (ISO) p-chloromercuribenzoic acid (ISO) panobinostat (ISO) paracetamol (EXP,ISO) paraquat (ISO) PCB138 (ISO) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) pregnenolone 16alpha-carbonitrile (ISO) propanal (ISO) propiconazole (ISO) protein kinase inhibitor (ISO) quercetin (ISO) resveratrol (ISO) rotenone (EXP) SB 431542 (ISO) silicon dioxide (EXP,ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) succimer (ISO) sunitinib (ISO) tamoxifen (ISO) temozolomide (ISO) testosterone (ISO) tetrachloromethane (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) topotecan (EXP) trichloroethene (EXP) trichostatin A (ISO) triphenyl phosphate (EXP,ISO) triptonide (ISO) tris(2-butoxyethyl) phosphate (ISO) troglitazone (ISO) valproic acid (ISO) vinclozolin (EXP) vincristine (ISO) vorinostat (ISO) zinc atom (ISO) zinc(0) (ISO)
Biological Process
DNA damage response (IEA,ISO,ISS) DNA repair (IEA,ISO,ISS) double-strand break repair via homologous recombination (IBA,ISO,ISS) mitotic G2/M transition checkpoint (IBA,ISO,ISS) response to ionizing radiation (IBA,ISO,ISS)
Nabp1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 57,570,326 - 57,625,926 (+) NCBI GRCr8 mRatBN7.2 9 50,098,552 - 50,133,982 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 50,126,726 - 50,134,107 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 58,676,153 - 58,683,138 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 63,798,993 - 63,805,978 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 62,094,976 - 62,101,961 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 55,049,893 - 55,057,784 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 55,050,203 - 55,057,658 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 54,749,751 - 54,757,646 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 47,194,891 - 47,201,876 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 47,196,304 - 47,203,289 (+) NCBI Celera 9 47,773,210 - 47,780,195 (+) NCBI Celera Cytogenetic Map 9 q22 NCBI
NABP1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 191,678,136 - 191,686,943 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 191,678,068 - 191,741,097 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 192,542,862 - 192,551,669 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 192,251,503 - 192,259,906 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 2 186,137,910 - 186,148,360 (+) NCBI Celera Cytogenetic Map 2 q32.3 NCBI HuRef 2 184,402,149 - 184,412,599 (+) NCBI HuRef CHM1_1 2 192,548,739 - 192,559,189 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 192,167,017 - 192,175,824 (+) NCBI T2T-CHM13v2.0
Nabp1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 51,504,127 - 51,517,634 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 51,505,021 - 51,517,584 (-) Ensembl GRCm39 Ensembl GRCm38 1 51,464,968 - 51,478,475 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 51,465,862 - 51,478,425 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 51,526,332 - 51,535,243 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 51,413,235 - 51,422,944 (-) NCBI MGSCv36 mm8 Celera 1 51,767,306 - 51,776,203 (-) NCBI Celera Cytogenetic Map 1 C1.1 NCBI cM Map 1 26.58 NCBI
Nabp1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955403 7,604,144 - 7,611,042 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955403 7,603,002 - 7,610,925 (-) NCBI ChiLan1.0 ChiLan1.0
NABP1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 94,357,402 - 94,370,067 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 94,372,354 - 94,383,615 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 78,980,156 - 78,989,309 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2B 196,895,143 - 196,905,547 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2B 196,895,166 - 196,903,977 (+) Ensembl panpan1.1 panPan2
NABP1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 37 2,157,357 - 2,163,812 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 37 2,157,356 - 2,161,091 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 37 3,101,888 - 3,111,539 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 37 2,042,381 - 2,056,370 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 37 2,041,496 - 2,051,976 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 37 2,051,987 - 2,065,978 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 37 2,019,594 - 2,033,559 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 37 2,032,137 - 2,046,116 (+) NCBI UU_Cfam_GSD_1.0
Nabp1
NABP1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 96,313,903 - 96,335,191 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 96,313,884 - 96,322,108 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 107,658,457 - 107,666,681 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NABP1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 10 77,210,624 - 77,222,340 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 10 77,210,702 - 77,218,289 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 122,262,012 - 122,273,817 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Nabp1
.
Predicted Target Of
Count of predictions: 217 Count of miRNA genes: 140 Interacting mature miRNAs: 185 Transcripts: ENSRNOT00000021403 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
7411571 Bw138 Body weight QTL 138 14.3 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 9 32535505 77535505 Rat 1300180 Bw14 Body weight QTL 14 3.776 body mass (VT:0001259) body weight (CMO:0000012) 9 23754024 61381613 Rat 11353957 Bmd92 Bone mineral density QTL 92 0.01 tibia mineral mass (VT:1000283) volumetric bone mineral density (CMO:0001553) 9 46114199 91114199 Rat 631680 Cm11 Cardiac mass QTL 11 3.1 0.00089 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 9 20430519 65430519 Rat 70218 Cm28 Cardiac mass QTL 28 8.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 9 25268044 79271759 Rat 724544 Uae9 Urinary albumin excretion QTL 9 4.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 9 25268044 114175309 Rat 7207805 Bmd88 Bone mineral density QTL 88 4 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 9 23754024 58157242 Rat 631643 Bp120 Blood pressure QTL 120 3 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 22071200 67071200 Rat 12879506 Pur33 Proteinuria QTL 33 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 9 44649921 89649921 Rat 731164 Uae25 Urinary albumin excretion QTL 25 3.5 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 9 25661188 100929786 Rat 1598849 Memor17 Memory QTL 17 2.2 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) 9 49968546 71098346 Rat 10058949 Gmadr5 Adrenal mass QTL 5 2 0.014 adrenal gland mass (VT:0010420) both adrenal glands wet weight to body weight ratio (CMO:0002411) 9 42791513 87976209 Rat 9589133 Insul26 Insulin level QTL 26 17.96 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 9 8952560 53952560 Rat 631656 Bp108 Blood pressure QTL 108 5.97 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 48598251 93598251 Rat 631211 Bw4 Body weight QTL4 5.31 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 9 5109826 50109826 Rat 7411609 Foco16 Food consumption QTL 16 25.6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 9 8952560 53952560 Rat 8662828 Vetf6 Vascular elastic tissue fragility QTL 6 3.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 9 36962359 92058970 Rat 61352 Bp34 Blood pressure QTL 34 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 42495343 79271511 Rat 6903937 Bp356 Blood pressure QTL 356 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 47902208 52283252 Rat 1598834 Memor11 Memory QTL 11 2.5 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 9 36962359 77814038 Rat 70186 Niddm26 Non-insulin dependent diabetes mellitus QTL 26 3.87 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 9 22071169 86369743 Rat 7207814 Bmd91 Bone mineral density QTL 91 3.5 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 9 23754144 83851531 Rat 6903941 Pur31 Proteinuria QTL 31 0.036 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 9 40194188 85194188 Rat 2290450 Scl57 Serum cholesterol level QTL 57 4.15 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 9 36962359 95410867 Rat 11353949 Bp393 Blood pressure QTL 393 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 40194188 85194188 Rat 11353951 Bp394 Blood pressure QTL 394 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 44649921 89649921 Rat 10054125 Srcrt7 Stress Responsive Cort QTL 7 3.33 0.0011 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 9 1 87073594 Rat 11353947 Bp392 Blood pressure QTL 392 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 7283252 52283252 Rat 1331757 Cdexp1 CD45RC expression in CD8 T cells QTL 1 4.3 CD8-positive T cell quantity (VT:0008077) blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990) 9 1024537 67509080 Rat 7411656 Foco26 Food consumption QTL 26 9.8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 9 32535505 77535505 Rat 1641894 Alcrsp12 Alcohol response QTL 12 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 9 27468639 72468639 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000021403 ⟹ ENSRNOP00000021403
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 50,126,726 - 50,134,107 (+) Ensembl Rnor_6.0 Ensembl 9 55,050,203 - 55,057,658 (+) Ensembl
RefSeq Acc Id:
NM_001014216 ⟹ NP_001014238
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 57,618,941 - 57,625,926 (+) NCBI mRatBN7.2 9 50,126,997 - 50,133,982 (+) NCBI Rnor_6.0 9 55,050,194 - 55,057,659 (+) NCBI Rnor_5.0 9 54,749,751 - 54,757,646 (+) NCBI RGSC_v3.4 9 47,194,891 - 47,201,876 (+) RGD Celera 9 47,773,210 - 47,780,195 (+) RGD
Sequence:
CTTTTTTTTTTTTTTTCCCCCTTTCGGCTTGGCGCCTCTAGGGCTGGTTTCCCCGGCCCCTGAATAACCGCTTCCCGACTCTGGTCGCCAGGCCTGCCTCAGGTTGCCCCCGGCTCTGCCCCTGGCCT
hide sequence
RefSeq Acc Id:
XM_017596514 ⟹ XP_017452003
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 57,618,610 - 57,625,226 (+) NCBI mRatBN7.2 9 50,126,666 - 50,133,630 (+) NCBI Rnor_6.0 9 55,049,893 - 55,057,784 (+) NCBI
Sequence:
ATAAAGCTGAGGGCGCATTCGCCGGTTGCTGTTTCGGACGCGGGCTGCGTGGTTGGTGTACAGC
hide sequence
RefSeq Acc Id:
XM_039083849 ⟹ XP_038939777
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 57,618,631 - 57,624,427 (+) NCBI mRatBN7.2 9 50,126,694 - 50,132,380 (+) NCBI
RefSeq Acc Id:
XM_039083850 ⟹ XP_038939778
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 57,618,561 - 57,625,226 (+) NCBI mRatBN7.2 9 50,126,634 - 50,133,630 (+) NCBI
RefSeq Acc Id:
XM_039083851 ⟹ XP_038939779
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 57,618,673 - 57,625,226 (+) NCBI mRatBN7.2 9 50,126,721 - 50,133,630 (+) NCBI
RefSeq Acc Id:
XM_063267373 ⟹ XP_063123443
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 57,570,326 - 57,625,226 (+) NCBI
RefSeq Acc Id:
NP_001014238 ⟸ NM_001014216
- UniProtKB:
Q5FVP2 (UniProtKB/Swiss-Prot), A6INX2 (UniProtKB/TrEMBL)
- Sequence:
MHGVNDPPLFIKDIKAGLKNLNVVFIVLEIGRVTKTKDGHEVRSCKVADRTGSITISVWDEIGGLIQTGDIIRLTRGYASMWKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPDYRGQQNRVVQ
hide sequence
RefSeq Acc Id:
XP_017452003 ⟸ XM_017596514
- Peptide Label:
isoform X1
- UniProtKB:
A6INX4 (UniProtKB/TrEMBL)
- Sequence:
MWKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPDYRGQQNRVVQNEQKDKMNTSIFGTVGNGVQTGPESRGYPLQYGRSNGPGPISPQLPGEPSNQTVRTTISNARDPRRAFKR
hide sequence
Ensembl Acc Id:
ENSRNOP00000021403 ⟸ ENSRNOT00000021403
RefSeq Acc Id:
XP_038939778 ⟸ XM_039083850
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_038939777 ⟸ XM_039083849
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038939779 ⟸ XM_039083851
- Peptide Label:
isoform X1
- UniProtKB:
A6INX4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063123443 ⟸ XM_063267373
- Peptide Label:
isoform X1
- UniProtKB:
A6INX4 (UniProtKB/TrEMBL)
RGD ID: 13696660 Promoter ID: EPDNEW_R7185 Type: single initiation site Name: Nabp1_1 Description: nucleic acid binding protein 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 9 55,050,253 - 55,050,313 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2012-10-05
Nabp1
nucleic acid binding protein 1
Obfc2a
oligonucleotide/oligosaccharide-binding fold containing 2A
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-07
Obfc2a
oligonucleotide/oligosaccharide-binding fold containing 2A
RGD1306658
similar to 5830411E10Rik protein
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
RGD1306658
similar to 5830411E10Rik protein
RGD1306658_predicted
similar to 5830411E10Rik protein (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-20
RGD1306658_predicted
similar to 5830411E10Rik protein (predicted)
LOC363227_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC363227_predicted
similar to 5830411E10Rik protein (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
