Advanced Search (OLGA)

Gene: Slamf8 (SLAM family member 8) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Slamf8

Name:

SLAM family member 8

RGD ID:

1306263

Description:

Predicted to enable identical protein binding activity and signaling receptor activity. Predicted to be involved in B-1 B cell lineage commitment; immune response; and regulation of B cell differentiation. Predicted to act upstream of or within several processes, including leukocyte chemotaxis involved in inflammatory response; negative regulation of leukocyte migration; and negative regulation of respiratory burst involved in inflammatory response. Predicted to be located in membrane. Orthologous to human SLAMF8 (SLAM family member 8); INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC289237; SLAM family member 8 precursor

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SLAMF8 (SLAM family member 8)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Slamf8 (SLAM family member 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Slamf8 (SLAM family member 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SLAMF8 (SLAM family member 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SLAMF8 (SLAM family member 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Slamf8 (SLAM family member 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SLAMF8 (SLAM family member 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LOC103223747 (SLAM family member 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Slamf8 (SLAM family member 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	IL19 (interleukin 19)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	SLAMF8 (SLAM family member 8)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Slamf8 (SLAM family member 8)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	slamf8	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	87,580,081 - 87,589,941 (-)	NCBI		GRCr8
mRatBN7.2	13	85,047,729 - 85,057,571 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	85,047,727 - 85,057,211 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	87,551,280 - 87,560,366 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	88,951,551 - 88,960,639 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	86,136,289 - 86,145,381 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	90,967,862 - 90,978,752 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	90,967,739 - 90,977,734 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	95,487,053 - 95,497,327 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	88,586,512 - 88,596,072 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	88,764,354 - 88,785,176 (-)	NCBI
Celera	13	84,657,034 - 84,666,075 (-)	NCBI		Celera
Cytogenetic Map	13	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Slamf8	Rat	autoimmune interstitial lung, joint, and kidney disease		ISO	SLAMF8 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Autoimmune interstitial lung disease-arthritis syndrome	ClinVar	PMID:28492532
Slamf8	Rat	gastrointestinal stromal tumor		ISO	SLAMF8 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Gastrointestinal stromal tumor	ClinVar	PMID:28492532
Slamf8	Rat	parathyroid carcinoma		ISO	SLAMF8 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Parathyroid carcinoma	ClinVar	PMID:28492532

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Slamf8	Rat	inflammatory bowel disease		ISO	SLAMF8 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:28067908

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Slamf8	Rat	1,2-dichloroethane	increases expression	ISO	Slamf8 (Mus musculus)	6480464	ethylene dichloride results in increased expression of SLAMF8 mRNA	CTD	PMID:28960355
Slamf8	Rat	1-chloro-2,4-dinitrobenzene	decreases expression	ISO	SLAMF8 (Homo sapiens)	6480464	Dinitrochlorobenzene results in decreased expression of SLAMF8 mRNA	CTD	PMID:17374397
Slamf8	Rat	17beta-estradiol	multiple interactions	ISO	SLAMF8 (Homo sapiens)	6480464	[Estradiol co-treated with TGFB1 protein] results in increased expression of SLAMF8 mRNA	CTD	PMID:30165855
Slamf8	Rat	17beta-estradiol	decreases expression	ISO	Slamf8 (Mus musculus)	6480464	Estradiol results in decreased expression of SLAMF8 mRNA	CTD	PMID:39298647
Slamf8	Rat	17beta-estradiol	multiple interactions	EXP		6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of SLAMF8 mRNA	CTD	PMID:32741896
Slamf8	Rat	17beta-estradiol 3-benzoate	multiple interactions	EXP		6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of SLAMF8 mRNA	CTD	PMID:32741896
Slamf8	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Slamf8 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of SLAMF8 mRNA	CTD	PMID:26377647
Slamf8	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of SLAMF8 mRNA	CTD	PMID:33387578
Slamf8	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of SLAMF8 mRNA	CTD	PMID:34747641
Slamf8	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of SLAMF8 mRNA	CTD	PMID:32109520
Slamf8	Rat	2,4-dibromophenyl 2,4,5-tribromophenyl ether	affects expression	ISO	Slamf8 (Mus musculus)	6480464	2 more ...	CTD	PMID:38648751
Slamf8	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	Slamf8 (Mus musculus)	6480464	bisphenol S results in decreased expression of SLAMF8 mRNA	CTD	PMID:39298647
Slamf8	Rat	4,4'-sulfonyldiphenol	increases methylation	ISO	Slamf8 (Mus musculus)	6480464	bisphenol S results in increased methylation of SLAMF8 exon	CTD	PMID:33297965
Slamf8	Rat	4-(ethoxymethylene)-2-phenyloxazol-5-one	decreases expression	ISO	SLAMF8 (Homo sapiens)	6480464	Oxazolone results in decreased expression of SLAMF8 mRNA	CTD	PMID:17374397
Slamf8	Rat	acetamide	increases expression	EXP		6480464	acetamide results in increased expression of SLAMF8 mRNA	CTD	PMID:31881176
Slamf8	Rat	acrylamide	increases expression	EXP		6480464	Acrylamide results in increased expression of SLAMF8 mRNA	CTD	PMID:28959563
Slamf8	Rat	aldehydo-D-glucose	multiple interactions	ISO	Slamf8 (Mus musculus)	6480464	[lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of SLAMF8 mRNA	CTD	PMID:37567420
Slamf8	Rat	all-trans-retinoic acid	increases expression	ISO	SLAMF8 (Homo sapiens)	6480464	Tretinoin results in increased expression of SLAMF8 mRNA	CTD	PMID:33167477
Slamf8	Rat	antirheumatic drug	decreases expression	ISO	SLAMF8 (Homo sapiens)	6480464	Antirheumatic Agents results in decreased expression of SLAMF8 mRNA	CTD	PMID:24449571
Slamf8	Rat	benzo[a]pyrene	decreases expression	ISO	SLAMF8 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased expression of SLAMF8 mRNA	CTD	PMID:20064835
Slamf8	Rat	benzo[a]pyrene	increases expression	ISO	Slamf8 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of SLAMF8 mRNA	CTD	PMID:22228805
Slamf8	Rat	benzo[a]pyrene	multiple interactions	ISO	Slamf8 (Mus musculus)	6480464	AHR protein affects the reaction [Benzo(a)pyrene affects the expression of SLAMF8 mRNA]	CTD	PMID:22228805
Slamf8	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of SLAMF8 mRNA	CTD	PMID:30816183 and PMID:32528016
Slamf8	Rat	bisphenol A	decreases methylation	ISO	SLAMF8 (Homo sapiens)	6480464	bisphenol A results in decreased methylation of SLAMF8 gene	CTD	PMID:31601247
Slamf8	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of SLAMF8 mRNA	CTD	PMID:34947998
Slamf8	Rat	cadmium atom	decreases expression	ISO	SLAMF8 (Homo sapiens)	6480464	Cadmium results in decreased expression of SLAMF8 mRNA	CTD	PMID:24376830
Slamf8	Rat	cadmium dichloride	increases expression	ISO	SLAMF8 (Homo sapiens)	6480464	Cadmium Chloride results in increased expression of SLAMF8 mRNA	CTD	PMID:38382870
Slamf8	Rat	calcitriol	decreases expression	ISO	SLAMF8 (Homo sapiens)	6480464	Calcitriol results in decreased expression of SLAMF8 mRNA	CTD	PMID:26485663
Slamf8	Rat	carbon nanotube	increases expression	ISO	Slamf8 (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25554681
Slamf8	Rat	D-glucose	multiple interactions	ISO	Slamf8 (Mus musculus)	6480464	[lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of SLAMF8 mRNA	CTD	PMID:37567420
Slamf8	Rat	diquat	decreases expression	ISO	Slamf8 (Mus musculus)	6480464	Diquat results in decreased expression of SLAMF8 mRNA	CTD	PMID:36851058
Slamf8	Rat	diuron	decreases expression	ISO	SLAMF8 (Homo sapiens)	6480464	Diuron results in decreased expression of SLAMF8 mRNA	CTD	PMID:35967413
Slamf8	Rat	ferric oxide	increases expression	ISO	Slamf8 (Mus musculus)	6480464	ferric oxide analog results in increased expression of SLAMF8 mRNA	CTD	PMID:24525745
Slamf8	Rat	fructose	multiple interactions	ISO	Slamf8 (Mus musculus)	6480464	[lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of SLAMF8 mRNA	CTD	PMID:37567420
Slamf8	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of SLAMF8 mRNA	CTD	PMID:33387578
Slamf8	Rat	glucose	multiple interactions	ISO	Slamf8 (Mus musculus)	6480464	[lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of SLAMF8 mRNA	CTD	PMID:37567420
Slamf8	Rat	glyphosate	multiple interactions	ISO	Slamf8 (Mus musculus)	6480464	[lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of SLAMF8 mRNA	CTD	PMID:37567420
Slamf8	Rat	nickel atom	increases expression	ISO	SLAMF8 (Homo sapiens)	6480464	Nickel results in increased expression of SLAMF8 mRNA	CTD	PMID:25583101
Slamf8	Rat	nickel sulfate	decreases expression	ISO	SLAMF8 (Homo sapiens)	6480464	nickel sulfate results in decreased expression of SLAMF8 mRNA	CTD	PMID:16780908 and PMID:17374397
Slamf8	Rat	paracetamol	affects expression	ISO	Slamf8 (Mus musculus)	6480464	Acetaminophen affects the expression of SLAMF8 mRNA	CTD	PMID:17562736
Slamf8	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of SLAMF8 mRNA	CTD	PMID:33387578
Slamf8	Rat	paraquat	increases expression	EXP		6480464	Paraquat results in increased expression of SLAMF8 mRNA	CTD	PMID:32680482
Slamf8	Rat	silicon dioxide	increases expression	ISO	Slamf8 (Mus musculus)	6480464	Silicon Dioxide results in increased expression of SLAMF8 mRNA	CTD	PMID:29341224
Slamf8	Rat	sodium dichromate	decreases expression	ISO	SLAMF8 (Homo sapiens)	6480464	sodium bichromate results in decreased expression of SLAMF8 mRNA	CTD	PMID:17685462
Slamf8	Rat	testosterone	multiple interactions	EXP		6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of SLAMF8 mRNA	CTD	PMID:32741896
Slamf8	Rat	Theaflavin 3,3'-digallate	affects expression	ISO	SLAMF8 (Homo sapiens)	6480464	theaflavin-3 and 3'-digallate affects the expression of SLAMF8 mRNA	CTD	PMID:34925699
Slamf8	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of SLAMF8 mRNA	CTD	PMID:34492290
Slamf8	Rat	titanium dioxide	affects expression	ISO	Slamf8 (Mus musculus)	6480464	titanium dioxide affects the expression of SLAMF8 mRNA	CTD	PMID:17656681
Slamf8	Rat	titanium dioxide	increases expression	EXP		6480464	titanium dioxide results in increased expression of SLAMF8 mRNA	CTD	PMID:30012374

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Slamf8	Rat	B-1 B cell lineage commitment	involved_in	ISO	Slamf8 (Mus musculus)	1624291	PMID:11313408	RGD	PMID:11313408
Slamf8	Rat	cellular response to xenobiotic stimulus	acts_upstream_of_or_within	ISO	Slamf8 (Mus musculus)	1624291	MGI:5442794 PMID:22593622	RGD	PMID:22593622
Slamf8	Rat	defense response to bacterium	acts_upstream_of_or_within	ISO	Slamf8 (Mus musculus)	1624291	MGI:5442794 PMID:22593622	RGD	PMID:22593622
Slamf8	Rat	immune response	involved_in	IBA	MGI:109294 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Slamf8	Rat	leukocyte chemotaxis involved in inflammatory response	acts_upstream_of_or_within	ISO	Slamf8 (Mus musculus)	1624291	MGI:5442794 PMID:25799045	RGD	PMID:25799045
Slamf8	Rat	negative regulation of dendritic cell chemotaxis	acts_upstream_of_or_within	ISO	Slamf8 (Mus musculus)	1624291	MGI:5442794 PMID:25799045	RGD	PMID:25799045
Slamf8	Rat	negative regulation of macrophage chemotaxis	acts_upstream_of_or_within	ISO	Slamf8 (Mus musculus)	1624291	MGI:5442794 PMID:25799045	RGD	PMID:25799045
Slamf8	Rat	negative regulation of monocyte chemotaxis	acts_upstream_of_or_within	ISO	Slamf8 (Mus musculus)	1624291	MGI:5442794 PMID:25799045	RGD	PMID:25799045
Slamf8	Rat	negative regulation of neutrophil migration	acts_upstream_of_or_within	ISO	Slamf8 (Mus musculus)	1624291	MGI:5442794 PMID:25799045	RGD	PMID:25799045
Slamf8	Rat	negative regulation of respiratory burst involved in inflammatory response	acts_upstream_of_or_within	ISO	Slamf8 (Mus musculus)	1624291	MGI:5442794 PMID:25799045	RGD	PMID:25799045
Slamf8	Rat	phagosome acidification	acts_upstream_of_or_within	ISO	Slamf8 (Mus musculus)	1624291	MGI:5442794 PMID:22593622	RGD	PMID:22593622
Slamf8	Rat	regulation of B cell differentiation	involved_in	ISO	Slamf8 (Mus musculus)	1624291	PMID:11313408	RGD	PMID:11313408
Slamf8	Rat	regulation of kinase activity	acts_upstream_of_or_within	ISO	Slamf8 (Mus musculus)	1624291	MGI:5442794 PMID:22593622	RGD	PMID:22593622
Slamf8	Rat	regulation of NAD(P)H oxidase activity	acts_upstream_of_or_within	ISO	Slamf8 (Mus musculus)	1624291	MGI:5442794 PMID:22593622	RGD	PMID:22593622

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Slamf8	Rat	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Slamf8	Rat	membrane	located_in	IEA	InterPro:IPR015631	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Slamf8	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Slamf8	Rat	identical protein binding	enables	ISO	Slamf8 (Mus musculus)	1624291	PMID:25799045	RGD	PMID:25799045
Slamf8	Rat	protein binding	enables	ISO	SLAMF8 (Homo sapiens)	1624291	UniProtKB:P54852 more ...	RGD	PMID:32296183 and PMID:33961781
Slamf8	Rat	signaling receptor activity	enables	IBA	MGI:1921998 and PANTHER:PTN000249467	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Slamf8	Rat	signaling receptor activity	enables	ISO	Slamf8 (Mus musculus)	1624291	PMID:25799045	RGD	PMID:25799045

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:11313408	PMID:22593622	PMID:25799045	PMID:38158136

Slamf8
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	87,580,081 - 87,589,941 (-)	NCBI		GRCr8
mRatBN7.2	13	85,047,729 - 85,057,571 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	85,047,727 - 85,057,211 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	87,551,280 - 87,560,366 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	88,951,551 - 88,960,639 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	86,136,289 - 86,145,381 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	90,967,862 - 90,978,752 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	90,967,739 - 90,977,734 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	95,487,053 - 95,497,327 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	88,586,512 - 88,596,072 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	88,764,354 - 88,785,176 (-)	NCBI
Celera	13	84,657,034 - 84,666,075 (-)	NCBI		Celera
Cytogenetic Map	13	q24	NCBI

SLAMF8
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	159,826,873 - 159,837,492 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	159,826,811 - 159,837,492 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	159,796,663 - 159,807,282 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	158,063,103 - 158,073,906 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	156,609,673 - 156,620,354	NCBI
Celera	1	132,864,904 - 132,875,709 (+)	NCBI		Celera
Cytogenetic Map	1	q23.2	NCBI
HuRef	1	131,152,909 - 131,163,714 (+)	NCBI		HuRef
CHM1_1	1	161,191,825 - 161,202,629 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	158,963,866 - 158,974,492 (+)	NCBI		T2T-CHM13v2.0

Slamf8
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	172,408,944 - 172,418,482 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	172,409,325 - 172,418,135 (-)	Ensembl		GRCm39 Ensembl
GRCm38	1	172,581,377 - 172,590,873 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	172,581,758 - 172,590,568 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	174,511,508 - 174,520,699 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	174,418,433 - 174,427,163 (-)	NCBI		MGSCv36	mm8
Celera	1	175,435,779 - 175,444,985 (-)	NCBI		Celera
Cytogenetic Map	1	H3	NCBI
cM Map	1	79.99	NCBI

Slamf8
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955468	11,623,197 - 11,632,573 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955468	11,623,092 - 11,632,566 (+)	NCBI	ChiLan1.0	ChiLan1.0

SLAMF8
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	90,017,255 - 90,027,775 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	89,757,279 - 89,767,800 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	135,178,241 - 135,189,005 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	139,098,929 - 139,109,725 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

SLAMF8
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	38	22,299,455 - 22,307,090 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	38	22,300,128 - 22,307,096 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	38	22,376,851 - 22,384,998 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	38	22,422,349 - 22,430,469 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	38	22,422,105 - 22,430,377 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UNSW_CanFamBas_1.0	38	22,721,713 - 22,729,848 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	38	23,132,591 - 23,140,763 (-)	NCBI		UU_Cfam_GSD_1.0

Slamf8
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	5,968,095 - 5,978,925 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936740	776,455 - 786,357 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936740	776,557 - 786,182 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SLAMF8
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	90,661,985 - 90,672,572 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	90,661,984 - 90,673,044 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	98,822,988 - 98,834,116 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103223747
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	4,114,403 - 4,127,122 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	4,116,630 - 4,124,988 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	3,218,491 - 3,230,109 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Slamf8
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624794	1,418,228 - 1,429,561 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624794	1,418,727 - 1,428,836 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Slamf8
20 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	109
Count of miRNA genes:	81
Interacting mature miRNAs:	97
Transcripts:	ENSRNOT00000011869
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	21120177	109350286	Rat
738027	Lnnr6	Liver neoplastic nodule remodeling QTL 6	3.3		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	65613454	109350286	Rat
1298066	Bp159	Blood pressure QTL 159		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	48639634	93639634	Rat
738026	Lnnr5	Liver neoplastic nodule remodeling QTL 5	3.29		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	62424592	88113509	Rat
2293702	Bss34	Bone structure and strength QTL 34	4.61	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	13	67635937	109350286	Rat
1576318	Schws5	Schwannoma susceptibility QTL 5		0.0351	nervous system integrity trait (VT:0010566)	post-insult time to trigeminal nerve neurilemmoma formation (CMO:0002019)	13	64497900	109350286	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	11081740	103588154	Rat
1581554	Pur11	Proteinuria QTL 11			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	38975045	103588154	Rat
8655951	Rf63	Renal function QTL 63	12.2		blood urea nitrogen amount (VT:0005265)	plasma urea nitrogen level (CMO:0000586)	13	71610804	109350286	Rat
4889606	Gluco63	Glucose level QTL 63	2.86	0.003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	83286150	109350286	Rat
8655945	Rf61	Renal function QTL 61	3.6		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	13	71610804	89333251	Rat
12879444	Bp397	Blood pressure QTL 397			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	47601426	92601426	Rat
1331783	Bp221	Blood pressure QTL 221	3.72886		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	71610804	89333251	Rat
8655959	Pur32	Proteinuria QTL 32	8.4		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	72984506	99745408	Rat
2293687	Bss26	Bone structure and strength QTL 26	4.6	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	13	67635937	109350286	Rat
1300166	Kidm6	Kidney mass QTL 6	3.93		kidney mass (VT:0002707)	single kidney wet weight to body weight ratio (CMO:0000622)	13	71610804	89333251	Rat
12879475	Bp400	Blood pressure QTL 400			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	64375743	109350286	Rat
1581573	Uae36	Urinary albumin excretion QTL 36			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	103588154	Rat
724564	Uae11	Urinary albumin excretion QTL 11	5.7		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	13	47354258	94285672	Rat
2293341	Glom15	Glomerulus QTL 15	9.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	13	67635937	109350286	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	43	105	89	88	57	25	57	6	210	91	85	45	58	31


RefSeq Transcripts	NM_001105973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001434029	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006250284	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473985	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000011869 ⟹ ENSRNOP00000011869

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	85,047,727 - 85,057,211 (-)	Ensembl
Rnor_6.0 Ensembl	13	90,967,739 - 90,977,734 (-)	Ensembl

RefSeq Acc Id:

NM_001105973 ⟹ NP_001099443

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	87,580,493 - 87,589,560 (-)	NCBI
mRatBN7.2	13	85,048,141 - 85,057,211 (-)	NCBI
Rnor_6.0	13	90,968,274 - 90,977,343 (-)	NCBI
Rnor_5.0	13	95,487,053 - 95,497,327 (-)	NCBI
RGSC_v3.4	13	88,586,512 - 88,596,072 (-)	RGD
Celera	13	84,657,034 - 84,666,075 (-)	RGD

Sequence:

show sequence

GACCACAGCTCCTTCCGAGCACTCCTTTGGCCTAGGATGGATATCCTGGTTTGTTGAGGGAGTCTTCCAAAGGAGGACATCGGCCATGTGGTCCCTCTGGAGTCTTCTTCTCTTCCAAGGCCTCCTTC
CCATTGTGGTTATCAGTGTCCAAGTGCTAAGCAAGGTAGGGGACTCCGGGCTGCTGGTGGCTGAGTGTCCTCCGGGCTTCCAAGTGCGTGAGGCTATCTGGCGATCTCTCTGGCCATCAGAGGAGCTC
CTGGCCACCTTTTTCCGGGGTTCCTTGGAGACTCTGTACCACTCTCGTTTCCTGGGCCGAGTCCAGCTCTATGACAACCTCAGCCTGGAGCTTGGGCCCCTGAGAACTGGAGACAGTGGCAATTTCTC
TGTGCTGATGGTGGATACAGGAGGTCAAACCTGGACCCAGACCCTGCATCTCAAGGTGTACGATGCAGTACCCAAGCCTGAGGTTCAAGTGTTCACGGCTGCAACAGAGGAGGCTCAACCTCTCAATA
CCTGTCAGGTCTTCTTGTCCTGCTGGGCCCCCAACATCAGCGACATAACCTACAGCTGGCGACGGGAGGGGACAATGGACTTTAATGGGGAACTGCGCAGCCTTTTCTCAAATGGACAGGTGTTAAGT
GTTTCACTGGGACTGGGGGACAAGGATGTGGCCTTTACCTGCATTGCCTCCAACCCTGTCAGCTGGGATATGACCACAGTCACCCCCTGGGAGAGCTGCCATCATGAGGCAGCCTCCTCTGGGAAGGC
CTCCTACAAGGACGTGCTCCTGGTTGTAATGCCAATTACACTGTTCCTGATTCTGGCTGGTCTCTTTGGGGCATGGCACCATGGCCTGTGCTCAGGGAAGAGGAAGGATGCCTGCACTGACAGAGCGC
TTCCAGAGACAGAGAGTGCCGTCGCATAGAGGATGTCATGAAAGACAGCATACACTGGTGCTTGGACCATGATGAGATGCCTGCCCAGCCACATGATGCTCCACGTCTGGACACCTCCAGGATCCTCC
TAACTTCCACAAGTCTGTCTGCCTCTGCTGGACAGCCAAGAAAACCACCATCCTGGAACATGGCCCTAGCCTAAACTTCCTCCCTCCTCCATTCAGTCTGCACGTGCTGGACGCTCTCTGGGCAAGGT
GGACTAATAGGACGCGTCCTTAAAAACACCGAACTTTCTCTAGGATCTACAGAGACATTGATTATCCAAGGCATCCATTCTTCTACCACTGTACATAAGGTCCATCTTACCCAACTGCCACCAAGAGA
TTGCCTCCAGGTCCTGGGCTCAAAGAGAGATCAGAAGTTTGAATGAACATAAGATGGAGCTCATCTCTGCCAACTGCACCCCCACCCCCAGAGTCTGAGGTCCTTATGTTCAAGATGTTGTCATAAGA
AAAGTCATAGAACAGGGAAAGATGGAGGGCAGGGCTTTCTCTTTCTGGCCTGAAGGACTTTAAGGTCATCTGAGTTCAAGGACCCTCAAAGGTAAGTTGAGGTTACAGATGACGAGGGATAGCTATTG
CGCCATGTTGGGATGGAAGCCATTTTTCTAGTAGCACCACATTAATAGACATCATAATTGCCAT

hide sequence

RefSeq Acc Id:

XM_006250284 ⟹ XP_006250346

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	87,580,081 - 87,589,941 (-)	NCBI
mRatBN7.2	13	85,047,729 - 85,057,571 (-)	NCBI
Rnor_6.0	13	90,967,862 - 90,978,752 (-)	NCBI
Rnor_5.0	13	95,487,053 - 95,497,327 (-)	NCBI

Sequence:

show sequence

GCCCACCAGAACCTATGGGGTCCTTTCTCTCTTACTATCTAAATCATGCTTAACAATCCACAGG
TAGATCCAACAGATCTCGAGCATCGCTAATTGCCTGGTGCAATGAATGCTGAATGCCCCCCACACAGAGAGAGAGAGACATGCCCATGTGCCAGCAACCTTCACTCCCTGGCATGTCTGTTTTCACAG
GCAGGGATTTTCTCCCTAACCCTTCCTGCTCGTCAGCTCCCATCCTATATGTCTAATTCCTGATGCAGTGTTACCATGGTACCCATTTGACTGACAAGCTAGATACTGTATAGGACAACACACAATGA
TCCACACTCGGGACCTTTAGAAATCTTCCTCAAGGGCAGCATCTTAAAAATGACTTCCCTGCTCCCAATACGGATACACTGCGGTAGAACATTCCAGAAGCCGTTCATTCTCTCTCTAGTACTGAGGG
AAAGAGGGAGAAAAAAGAAGCTAATATGTAAAAGCAGAGAATAAGAGTGAGGAGGGGACAACTCATGCTCTCTGCACCTCTGTGACCCCTGTGACCCCAGCAAGCTGCCTAACATCACCCTGGCTTTT
AATTCTTCCACCACTAATACTTCCAACAGGGTGACAAGAAGATGAGCTCTGAGAAAGGTCCAGCCTTACATAAAAGCAAAAGGGCTATCCATGTCTGGTAGTCCTTCATTCACTTAATGGCTATCTCT
TAAACAGTAAGCATGTCCAGCACAGAAACAAATACAATTCGCTCTTAAACAGCTAGAGAAACCTTGAAATTATGACCAGCAACACAAGGGAAGAGTAAATGCACGTGGTTACAAAGGGTTTCTCGCTC
TCGTTGTAGCCAGCAAGCCTTGAAGGACAGCCTGGGTGCAAAGCTGGGTCAGGTACGTCTGCTAGGGAAGCCAACCCAGTGCGTGCAAATGTCAATGGATGGTTCTGAAAAGAGGTAGTCTGGCTGGG
ATGGCCGGAGAGGACAGCGGATGTGGGCAGCCAGTCTGGAGAAGCTGAAAACCCTCACGGGTTACGCTCAGTATTGAGTCTTTATCCAGAGGGCGACAGGAGAGTTTCGAAGGTTTTTCAGCAGAGGG
GAAGTGACCCGATCAGAATTGCAGCTCAGAGGGCTTCTCTGTGGCAATGATGGTGTTTAGACACATCCACGGGCAGGGTTGGATGCAGAGACCCGGTGACCATGTGTAAGAAGCGCATGGGCTGTGTG
GGTGTGATTGTCACCACGCTCTGGCCAGCCATGGACACAGAAAGGAGGCTGATTTACAAGAATCTGCTGCTGAAAGCCCAGCTAGGCCTAGCTGGGCCTGCAGCCAACTTCCACTTTACCCGGATGCT
TTCGCTTTCAAGACATCGTGTTTTGAGTAAAGATTCCTCCTTCTGAACACGGGACTTTCCGGCAGGACCACAGCTCCTTCCGAGCACTCCTTTGGCCTAGGATGGATATCCTGGTTTGTTGAGGGAGT
CTTCCAAAGGAGGACATCGGCCATGTGGTCCCTCTGGAGTCTTCTTCTCTTCCAAGGCCTCCTTCCCATTGTGGTTATCAGTGTCCAAGTGCTAAGCAAGGTAGGGGACTCCGGGCTGCTGGTGGCTG
AGTGTCCTCCGGGCTTCCAAGTGCGTGAGGCTATCTGGCGATCTCTCTGGCCATCAGAGGAGCTCCTGGCCACCTTTTTCCGGGGTTCCTTGGAGACTCTGTACCACTCTCGTTTCCTGGGCCGAGTC
CAGCTCTATGACAACCTCAGCCTGGAGCTTGGGCCCCTGAGAACTGGAGACAGTGGCAATTTCTCTGTGCTGATGGTGGATACAGGAGGTCAAACCTGGACCCAGACCCTGCATCTCAAGGTGTACGA
TGCAGTACCCAAGCCTGAGGTTCAAGTGTTCACGGCTGCAACAGAGGAGGCTCAACCTCTCAATACCTGTCAGGTCTTCTTGTCCTGCTGGGCCCCCAACATCAGCGACATAACCTACAGCTGGCGAC
GGGAGGGGACAATGGACTTTAATGGGGAACTGCGCAGCCTTTTCTCAAATGGACAGGTGTTAAGTGTTTCACTGGGACTGGGGGACAAGGATGTGGCCTTTACCTGCATTGCCTCCAACCCTGTCAGC
TGGGATATGACCACAGTCACCCCCTGGGAGAGCTGCCATCATGAGGCAGCCTCCTCTGGGAAGGCCTCCTACAAGGACGTGCTCCTGGTTGTAATGCCAATTACACTGTTCCTGATTCTGGCTGGTCT
CTTTGGGGCATGGCACCATGGCCTGTGCTCAGCAGGGAAGAGGAAGGATGCCTGCACTGACAGAGCGCTTCCAGAGACAGAGAGTGCCGTCGCATAGAGGATGTCATGAAAGACAGCATACACTGGTG
CTTGGACCATGATGAGATGCCTGCCCAGCCACATGATGCTCCACGTCTGGACACCTCCAGGATCCTCCTAACTTCCACAAGTCTGTCTGCCTCTGCTGGACAGCCAAGAAAACCACCATCCTGGAACA
TGGCCCTAGCCTAAACTTCCTCCCTCCTCCATTCAGTCTGCACGTGCTGGACGCTCTCTGGGCAAGGTGGACTAATAGGACGCGTCCTTAAAAACACCGAACTTTCTCTAGGATCTACAGAGACATTG
ATTATCCAAGGCATCCATTCTTCTACCACTGTACATAAGGTCCATCTTACCCAACTGCCACCAAGAGATTGCCTCCAGGTCCTGGGCTCAAAGAGAGATCAGAAGTTTGAATGAACATAAGATGGAGC
TCATCTCTGCCAACTGCACCCCCACCCCCAGAGTCTGAGGTCCTTATGTTCAAGATGTTGTCATAAGAAAAGTCATAGAACAGGGAAAGATGGAGGGCAGGGCTTTCTCTTTCTGGCCTGAAGGACTT
TAAGGTCATCTGAGTTCAAGGACCCTCAAAGGTAAGTTGAGGTTACAGATGACGAGGGATAGCTATTGCGCCATGTTGGGATGGAAGCCATTTTTCTAGTAGCACCACATTAATAGACATCATAATTG
CCATTAATTCTGGTGTCTCCTGCATATCCGGGGTGGTGTTTCAAACTCTTTCCATATATTCTACATGGTTGCCAGAAAAAAAGAAAGAAAAGCAAAGAAAAAAATACAGAGAGTTTGACCCAGCCAGC
AGGAAATTCTTCCACAATGTCAAGAGAAACAGCTAAGTTCAGGATAAGTCTGTCTTCCTAAAACTGGGAGAATGAAGAGCCATAAAAAGCTATGCAAGGGGGGCTGGAGAGATGGCTCAGCGGTTAAG
AGCATTGACCATTCTTCCGGAGGTCCTGAGTTCAATTCCCAGCAACCACATGGTGGCTCACAACCATCTGTAATGGGATCCAATGTTCTCTTCTGGTGTGTGTGAAGAGATCTATAGTGTACTCATAT
ACATAAAATAAATAAATCTTTTTTAAAAGCTA

hide sequence


Protein RefSeqs	NP_001099443	(Get FASTA)	NCBI Sequence Viewer
	NP_001420958	(Get FASTA)	NCBI Sequence Viewer
	XP_006250346	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL94723	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000011869
	ENSRNOP00000011869.6
	ENSRNOP00000111960

RefSeq Acc Id:

NP_001099443 ⟸ NM_001105973

- UniProtKB:

A6JG67 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MWSLWSLLLFQGLLPIVVISVQVLSKVGDSGLLVAECPPGFQVREAIWRSLWPSEELLATFFRGSLETLYHSRFLGRVQLYDNLSLELGPLRTGDSGNFSVLMVDTGGQTWTQTLHLKVYDAVPKPEV
QVFTAATEEAQPLNTCQVFLSCWAPNISDITYSWRREGTMDFNGELRSLFSNGQVLSVSLGLGDKDVAFTCIASNPVSWDMTTVTPWESCHHEAASSGKASYKDVLLVVMPITLFLILAGLFGAWHHG
LCSGKRKDACTDRALPETESAVA

hide sequence

RefSeq Acc Id:

XP_006250346 ⟸ XM_006250284

- Peptide Label:

isoform X1

- Sequence:

show sequence

MWSLWSLLLFQGLLPIVVISVQVLSKVGDSGLLVAECPPGFQVREAIWRSLWPSEELLATFFRG
SLETLYHSRFLGRVQLYDNLSLELGPLRTGDSGNFSVLMVDTGGQTWTQTLHLKVYDAVPKPEVQVFTAATEEAQPLNTCQVFLSCWAPNISDITYSWRREGTMDFNGELRSLFSNGQVLSVSLGLGD
KDVAFTCIASNPVSWDMTTVTPWESCHHEAASSGKASYKDVLLVVMPITLFLILAGLFGAWHHGLCSAGKRKDACTDRALPETESAVA

hide sequence

Ensembl Acc Id:

ENSRNOP00000011869 ⟸ ENSRNOT00000011869

Protein Domains

Ig-like

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZS24-F1-model_v2	AlphaFold	D3ZS24	1-279	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-17299	BioCyc
Ensembl Genes	ENSRNOG00000008736	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000011869	ENTREZGENE
	ENSRNOT00000011869.7	UniProtKB/TrEMBL
	ENSRNOT00000133531	ENTREZGENE
Gene3D-CATH	2.60.40.10	UniProtKB/TrEMBL
InterPro	CD2/SLAM_rcpt	UniProtKB/TrEMBL
	Ig-like	UniProtKB/TrEMBL
	Ig-like_dom_sf	UniProtKB/TrEMBL
	Ig-like_fold	UniProtKB/TrEMBL
KEGG Report	rno:289237	UniProtKB/TrEMBL
NCBI Gene	289237	ENTREZGENE
PANTHER	SIGNALING LYMPHOCYTIC ACTIVATION MOLECULE	UniProtKB/TrEMBL
	SLAM FAMILY MEMBER 8	UniProtKB/TrEMBL
PhenoGen	Slamf8	PhenoGen
PROSITE	IG_LIKE	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000008736	RatGTEx
Superfamily-SCOP	SSF48726	UniProtKB/TrEMBL
UniProt	A6JG67	ENTREZGENE, UniProtKB/TrEMBL
	D3ZS24	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Slamf8	SLAM family member 8	Slamf8_predicted	SLAM family member 8 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Slamf8_predicted	SLAM family member 8 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD