Symbol:
Ttc38
Name:
tetratricopeptide repeat domain 38
RGD ID:
1306041
Description:
Orthologous to human TTC38 (tetratricopeptide repeat domain 38); INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC300125; RGD1306041; similar to FLJ20699 protein ; tetratricopeptide repeat protein 38
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 118,805,115 - 118,828,449 (+) NCBI GRCr8 mRatBN7.2 7 116,925,273 - 116,948,616 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 116,925,257 - 116,948,611 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 118,676,127 - 118,697,459 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 120,901,755 - 120,923,085 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 120,871,316 - 120,892,648 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 126,711,674 - 126,735,013 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 126,711,467 - 126,735,007 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 126,422,437 - 126,446,125 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 123,837,048 - 123,858,284 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 123,870,917 - 123,892,294 (+) NCBI Celera 7 113,216,370 - 113,237,599 (+) NCBI Celera Cytogenetic Map 7 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ttc38 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of TTC38 mRNA] CTD PMID:31150632 Ttc38 Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of TTC38 protein CTD PMID:32145629 Ttc38 Rat 17beta-estradiol decreases expression ISO Ttc38 (Mus musculus) 6480464 Estradiol results in decreased expression of TTC38 mRNA CTD PMID:39298647 Ttc38 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO TTC38 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Ttc38 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Ttc38 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of TTC38 mRNA CTD PMID:19770486 and PMID:26290441 Ttc38 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of TTC38 mRNA CTD PMID:33387578 Ttc38 Rat 2,4,6-tribromophenol increases expression ISO TTC38 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Ttc38 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Ttc38 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of TTC38 mRNA CTD PMID:26251327 Ttc38 Rat 4,4'-sulfonyldiphenol decreases expression ISO Ttc38 (Mus musculus) 6480464 bisphenol S results in decreased expression of TTC38 mRNA CTD PMID:39298647 Ttc38 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of TTC38 mRNA CTD PMID:36041667 Ttc38 Rat 4,4'-sulfonyldiphenol increases expression ISO TTC38 (Homo sapiens) 6480464 bisphenol S results in increased expression of TTC38 protein CTD PMID:34186270 Ttc38 Rat aflatoxin B1 affects expression ISO TTC38 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of TTC38 protein CTD PMID:20106945 Ttc38 Rat aflatoxin B1 decreases expression ISO TTC38 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of TTC38 mRNA CTD PMID:27153756 Ttc38 Rat aristolochic acid A increases expression ISO TTC38 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of TTC38 mRNA CTD PMID:33212167 Ttc38 Rat arsenous acid increases expression ISO TTC38 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of TTC38 mRNA CTD PMID:15761015 Ttc38 Rat arsenous acid decreases expression ISO Ttc38 (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of TTC38 mRNA CTD PMID:35676786 Ttc38 Rat benzo[a]pyrene decreases methylation ISO Ttc38 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of TTC38 intron CTD PMID:27901495 Ttc38 Rat benzo[a]pyrene decreases expression ISO TTC38 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of TTC38 mRNA CTD PMID:32234424 Ttc38 Rat benzo[a]pyrene increases expression ISO Ttc38 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of TTC38 mRNA CTD PMID:38641015 Ttc38 Rat benzo[a]pyrene decreases methylation ISO TTC38 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of TTC38 promoter CTD PMID:27901495 Ttc38 Rat benzo[e]pyrene increases methylation ISO TTC38 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of TTC38 intron CTD PMID:30157460 Ttc38 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Ttc38 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of TTC38 mRNA CTD PMID:19850644 Ttc38 Rat bis(2-ethylhexyl) phthalate increases expression ISO Ttc38 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of TTC38 mRNA CTD PMID:35716406 Ttc38 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Ttc38 (Mus musculus) 6480464 PPARA protein promotes the reaction [Diethylhexyl Phthalate results in decreased expression of TTC38 mRNA] CTD PMID:19850644 Ttc38 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TTC38 mRNA CTD PMID:25181051 more ... Ttc38 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of TTC38 mRNA CTD PMID:36041667 Ttc38 Rat bisphenol A increases expression ISO TTC38 (Homo sapiens) 6480464 bisphenol A results in increased expression of TTC38 protein CTD PMID:34186270 Ttc38 Rat bisphenol A decreases methylation ISO TTC38 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of TTC38 gene CTD PMID:31601247 Ttc38 Rat bisphenol A increases expression ISO Ttc38 (Mus musculus) 6480464 bisphenol A results in increased expression of TTC38 mRNA CTD PMID:33221593 Ttc38 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of TTC38 protein CTD PMID:32145629 Ttc38 Rat bisphenol AF increases expression ISO TTC38 (Homo sapiens) 6480464 bisphenol AF results in increased expression of TTC38 protein CTD PMID:34186270 Ttc38 Rat bisphenol F increases expression ISO TTC38 (Homo sapiens) 6480464 bisphenol F results in increased expression of TTC38 protein CTD PMID:34186270 Ttc38 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of TTC38 mRNA CTD PMID:36041667 Ttc38 Rat carbon nanotube decreases expression ISO Ttc38 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Ttc38 Rat chlorpyrifos decreases expression ISO Ttc38 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of TTC38 mRNA CTD PMID:37019170 Ttc38 Rat copper(II) sulfate decreases expression ISO TTC38 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of TTC38 mRNA CTD PMID:19549813 Ttc38 Rat cyclosporin A decreases expression ISO TTC38 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of TTC38 mRNA CTD PMID:20106945 Ttc38 Rat cyclosporin A decreases expression ISO Ttc38 (Mus musculus) 6480464 Cyclosporine results in decreased expression of TTC38 mRNA CTD PMID:19770486 Ttc38 Rat decabromodiphenyl ether increases expression ISO TTC38 (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of TTC38 protein CTD PMID:31675489 Ttc38 Rat diarsenic trioxide increases expression ISO TTC38 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of TTC38 mRNA CTD PMID:15761015 Ttc38 Rat diarsenic trioxide decreases expression ISO Ttc38 (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of TTC38 mRNA CTD PMID:35676786 Ttc38 Rat Dibutyl phosphate affects expression ISO TTC38 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of TTC38 mRNA CTD PMID:37042841 Ttc38 Rat disodium selenite increases expression ISO TTC38 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of TTC38 mRNA CTD PMID:18175754 Ttc38 Rat doxorubicin decreases expression ISO TTC38 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of TTC38 mRNA CTD PMID:29803840 Ttc38 Rat epoxiconazole decreases expression ISO Ttc38 (Mus musculus) 6480464 epoxiconazole results in decreased expression of TTC38 mRNA CTD PMID:35436446 Ttc38 Rat fenthion increases expression ISO Ttc38 (Mus musculus) 6480464 Fenthion results in increased expression of TTC38 mRNA CTD PMID:34813904 Ttc38 Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of TTC38 mRNA CTD PMID:23962444 Ttc38 Rat furan increases methylation EXP 6480464 furan results in increased methylation of TTC38 gene CTD PMID:22079235 Ttc38 Rat ivermectin decreases expression ISO TTC38 (Homo sapiens) 6480464 Ivermectin results in decreased expression of TTC38 protein CTD PMID:32959892 Ttc38 Rat methapyrilene increases methylation ISO TTC38 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of TTC38 intron CTD PMID:30157460 Ttc38 Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of TTC38 mRNA CTD PMID:26720608 Ttc38 Rat paracetamol affects expression ISO Ttc38 (Mus musculus) 6480464 Acetaminophen affects the expression of TTC38 mRNA CTD PMID:17562736 Ttc38 Rat paracetamol decreases expression ISO TTC38 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of TTC38 mRNA CTD PMID:22230336 and PMID:29067470 Ttc38 Rat phenobarbital multiple interactions ISO Ttc38 (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of TTC38 mRNA] CTD PMID:19482888 Ttc38 Rat phenobarbital increases expression ISO Ttc38 (Mus musculus) 6480464 Phenobarbital results in increased expression of TTC38 mRNA CTD PMID:19270015 and PMID:19482888 Ttc38 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of TTC38 mRNA CTD PMID:28374803 Ttc38 Rat sodium arsenite decreases expression ISO TTC38 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of TTC38 mRNA CTD PMID:38568856 Ttc38 Rat sunitinib decreases expression ISO TTC38 (Homo sapiens) 6480464 Sunitinib results in decreased expression of TTC38 mRNA CTD PMID:31533062 Ttc38 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of TTC38 mRNA CTD PMID:31150632 Ttc38 Rat tetrachloromethane decreases expression ISO Ttc38 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of TTC38 mRNA CTD PMID:31919559 Ttc38 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of TTC38 mRNA] CTD PMID:31150632 Ttc38 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of TTC38 mRNA CTD PMID:34492290 Ttc38 Rat titanium dioxide decreases expression ISO Ttc38 (Mus musculus) 6480464 titanium dioxide results in decreased expression of TTC38 mRNA CTD PMID:35295148 Ttc38 Rat triphenyl phosphate affects expression ISO TTC38 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of TTC38 mRNA CTD PMID:37042841 Ttc38 Rat triptonide increases expression ISO Ttc38 (Mus musculus) 6480464 triptonide results in increased expression of TTC38 mRNA CTD PMID:33045310 Ttc38 Rat troglitazone decreases expression ISO Ttc38 (Mus musculus) 6480464 troglitazone results in decreased expression of TTC38 mRNA CTD PMID:28973697 Ttc38 Rat valproic acid decreases expression ISO TTC38 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of TTC38 mRNA CTD PMID:29154799 Ttc38 Rat valproic acid affects expression ISO TTC38 (Homo sapiens) 6480464 Valproic Acid affects the expression of TTC38 mRNA CTD PMID:25979313 Ttc38 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of TTC38 mRNA CTD PMID:23034163
(+)-schisandrin B (EXP) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) aflatoxin B1 (ISO) aristolochic acid A (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (EXP,ISO) carbon nanotube (ISO) chlorpyrifos (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) decabromodiphenyl ether (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) disodium selenite (ISO) doxorubicin (ISO) epoxiconazole (ISO) fenthion (ISO) fipronil (EXP) furan (EXP) ivermectin (ISO) methapyrilene (ISO) nitrofen (EXP) paracetamol (ISO) phenobarbital (ISO) rotenone (EXP) sodium arsenite (ISO) sunitinib (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) titanium dioxide (ISO) triphenyl phosphate (ISO) triptonide (ISO) troglitazone (ISO) valproic acid (ISO) vinclozolin (EXP)
Ttc38 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 118,805,115 - 118,828,449 (+) NCBI GRCr8 mRatBN7.2 7 116,925,273 - 116,948,616 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 116,925,257 - 116,948,611 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 118,676,127 - 118,697,459 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 120,901,755 - 120,923,085 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 120,871,316 - 120,892,648 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 126,711,674 - 126,735,013 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 126,711,467 - 126,735,007 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 126,422,437 - 126,446,125 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 123,837,048 - 123,858,284 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 123,870,917 - 123,892,294 (+) NCBI Celera 7 113,216,370 - 113,237,599 (+) NCBI Celera Cytogenetic Map 7 q34 NCBI
TTC38 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 22 46,268,008 - 46,294,008 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 22 46,267,961 - 46,294,008 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 22 46,663,905 - 46,689,905 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 22 45,042,525 - 45,068,569 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 22 30,571,246 - 30,597,288 (+) NCBI Celera Cytogenetic Map 22 q13.31 NCBI HuRef 22 29,607,837 - 29,633,914 (+) NCBI HuRef CHM1_1 22 46,622,594 - 46,648,635 (+) NCBI CHM1_1 T2T-CHM13v2.0 22 46,752,708 - 46,778,705 (+) NCBI T2T-CHM13v2.0
Ttc38 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 85,716,545 - 85,743,023 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 85,716,507 - 85,743,023 (+) Ensembl GRCm39 Ensembl GRCm38 15 85,832,282 - 85,858,822 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 85,832,306 - 85,858,822 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 85,662,734 - 85,689,252 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 85,660,110 - 85,685,499 (+) NCBI MGSCv36 mm8 Celera 15 87,964,196 - 87,991,957 (+) NCBI Celera Cytogenetic Map 15 E2 NCBI cM Map 15 40.42 NCBI
Ttc38 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955413 30,390,722 - 30,413,955 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955413 30,391,385 - 30,411,210 (+) NCBI ChiLan1.0 ChiLan1.0
TTC38 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 23 56,094,810 - 56,123,432 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 22 58,794,326 - 58,821,455 (+) NCBI NHGRI_mPanPan1 PanPan1.1 22 45,333,321 - 45,360,053 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 22 45,333,321 - 45,360,053 (+) Ensembl panpan1.1 panPan2
TTC38 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 19,887,285 - 19,910,347 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 19,773,373 - 19,910,683 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 19,809,856 - 19,832,910 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 20,620,897 - 20,644,214 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 20,620,908 - 20,644,218 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 20,341,478 - 20,364,501 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 20,654,310 - 20,677,329 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 20,836,049 - 20,859,104 (-) NCBI UU_Cfam_GSD_1.0
Ttc38 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 3,619,198 - 3,640,103 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936629 3,619,175 - 3,640,304 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936629 3,619,190 - 3,640,046 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TTC38 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 3,248,346 - 3,270,778 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 3,248,342 - 3,270,815 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 520,842 - 543,411 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TTC38 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 19 28,749,590 - 28,775,475 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 19 28,749,657 - 28,777,171 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 96,755,394 - 96,781,722 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ttc38
.
Predicted Target Of
Count of predictions: 259 Count of miRNA genes: 177 Interacting mature miRNAs: 202 Transcripts: ENSRNOT00000021582 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 1300112 Bp183 Blood pressure QTL 183 3.51 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 111182207 135012528 Rat 1331728 Bp214 Blood pressure QTL 214 2.825 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 80221299 124373579 Rat 1331731 Bp216 Blood pressure QTL 216 2.851 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 102297359 133492884 Rat 2298475 Eau6 Experimental allergic uveoretinitis QTL 6 0.0029 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 7 84257275 129257275 Rat 71114 Niddm14 Non-insulin dependent diabetes mellitus QTL 14 4.5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 7 84257275 129257275 Rat 631687 Hcas1 Hepatocarcinoma susceptibility QTL 1 3.9 0.001 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 7 91412594 129807172 Rat 1357339 Stl14 Serum triglyceride level QTL 14 3.45 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 112729683 133492707 Rat 634331 Pia17 Pristane induced arthritis QTL 17 4.7 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 7 73829340 130221005 Rat 1358914 Bp266 Blood pressure QTL 266 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 634322 Bw12 Body weight QTL 12 0 body mass (VT:0001259) body weight (CMO:0000012) 7 83153392 128153392 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 1549899 Stresp8 Stress response QTL 8 4.37 0.0008 stress-related behavior trait (VT:0010451) defensive burying duration (CMO:0001961) 7 90482196 135012528 Rat 2317052 Aia17 Adjuvant induced arthritis QTL 17 2.13 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 7 81737938 126737938 Rat 731176 Glom5 Glomerulus QTL 5 2.5 0.0035 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 7 96670164 135012528 Rat 7411607 Foco15 Food consumption QTL 15 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2306821 Bp335 Blood pressure QTL 335 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 106571501 135012528 Rat 631663 Bw6 Body weight QTL 6 3.4 body mass (VT:0001259) body weight (CMO:0000012) 7 111075573 134976056 Rat 1558655 Swd4 Spike wave discharge measurement QTL 4 3.68 0.0002 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge severity grade (CMO:0001988) 7 86983365 131983365 Rat 631201 Panci1 Pancreas inflammation QTL 1 0 0.001 pancreas integrity trait (VT:0010560) percentage of study population displaying chronic pancreatitis at a point in time (CMO:0001214) 7 116677189 127103496 Rat 1331768 Kidm10 Kidney mass QTL 10 4.62096 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 80221299 125221299 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 731174 Uae23 Urinary albumin excretion QTL 23 2.4 0.0042 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 7 104603555 135012528 Rat 1331748 Bp215 Blood pressure QTL 215 4.043 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 112308254 133492884 Rat 7411654 Foco25 Food consumption QTL 25 9.3 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2299163 Iddm34 Insulin dependent diabetes mellitus QTL 34 2.71 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 7 91281130 135012528 Rat 1582240 Sffal1 Serum free fatty acids level QTL 1 3.4 0.0021 blood free fatty acid amount (VT:0001553) serum free fatty acids level (CMO:0000547) 7 116677010 124049952 Rat 631540 Bw9 Body weight QTL 9 4.5 body mass (VT:0001259) body weight (CMO:0000012) 7 69736226 117455174 Rat 1358891 Bp265 Blood pressure QTL 265 2.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat
D3Mit18
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 116,932,605 - 116,932,728 (+) MAPPER mRatBN7.2 mRatBN7.2 3 112,287,552 - 112,287,746 (+) MAPPER mRatBN7.2 Rnor_6.0 3 117,303,473 - 117,303,664 NCBI Rnor6.0 Rnor_6.0 7 126,719,006 - 126,719,128 NCBI Rnor6.0 Rnor_5.0 3 123,827,331 - 123,827,522 UniSTS Rnor5.0 Rnor_5.0 7 126,429,783 - 126,429,905 UniSTS Rnor5.0 RGSC_v3.4 7 123,844,340 - 123,844,462 UniSTS RGSC3.4 RGSC_v3.4 3 112,334,733 - 112,334,924 UniSTS RGSC3.4 RGSC_v3.1 3 112,240,305 - 112,240,497 RGD Celera 7 113,223,662 - 113,223,784 UniSTS Celera 3 111,145,717 - 111,145,908 UniSTS Cytogenetic Map 7 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000021582 ⟹ ENSRNOP00000021583
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 116,925,257 - 116,948,611 (+) Ensembl Rnor_6.0 Ensembl 7 126,711,467 - 126,735,007 (+) Ensembl
RefSeq Acc Id:
NM_001130499 ⟹ NP_001123971
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 118,805,155 - 118,826,391 (+) NCBI mRatBN7.2 7 116,925,312 - 116,946,553 (+) NCBI Rnor_6.0 7 126,711,714 - 126,732,950 (+) NCBI Rnor_5.0 7 126,422,437 - 126,446,125 (+) NCBI RGSC_v3.4 7 123,837,048 - 123,858,284 (+) RGD Celera 7 113,216,370 - 113,237,599 (+) RGD
Sequence:
CAATAACACCCCCAGTTCCCCAGCGGACCTCAGAAACTCCAAAAGCTTTGACCGGTGCTGTCACCCTACAGACCAAATCTATAATCATGTCACTGAGAGACTGCCAGGCGTGGAAGGATGCTGGGCTC
hide sequence
RefSeq Acc Id:
XM_017594774 ⟹ XP_017450263
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 118,805,139 - 118,828,449 (+) NCBI mRatBN7.2 7 116,925,296 - 116,948,616 (+) NCBI Rnor_6.0 7 126,711,731 - 126,735,013 (+) NCBI
Sequence:
CCCCAGCGGACCTCAGAAACTCCAAAAGCTTTGACCGGTGCTGTCACCCTACAGACCAAATCTA
hide sequence
RefSeq Acc Id:
XM_063263330 ⟹ XP_063119400
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 118,805,115 - 118,824,451 (+) NCBI
RefSeq Acc Id:
NP_001123971 ⟸ NM_001130499
- UniProtKB:
A6HTF3 (UniProtKB/TrEMBL), D4ACL2 (UniProtKB/TrEMBL)
- Sequence:
MSLRDCQAWKDAGLPLSTTSNEACKLFDATLTQYVKWTNDKSLGGIEGCLSKLKAADPTFAMGLAISNGLVLIGTGTSVKLDKDLDLAVKTMVEFSQTQTLTPRERLHVSAVEMFAKGNFPKACELWE
hide sequence
RefSeq Acc Id:
XP_017450263 ⟸ XM_017594774
- Peptide Label:
isoform X2
- UniProtKB:
A6HTF5 (UniProtKB/TrEMBL)
- Sequence:
MGLAISNGLVLIGTGTSVKLDKDLDLAVKTMVEFSQTQTLTPRERLHVSAVEMFAKGNFPKACELWEQILRDHPTDMLALKFSHDAYFYLGYQEQMRDSVARVYPFWTPDTPLSSYVKGIYSFGLMET
hide sequence
Ensembl Acc Id:
ENSRNOP00000021583 ⟸ ENSRNOT00000021582
RefSeq Acc Id:
XP_063119400 ⟸ XM_063263330
- Peptide Label:
isoform X1
- UniProtKB:
D4ACL2 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-09-09
Ttc38
tetratricopeptide repeat domain 38
RGD1306041
similar to FLJ20699 protein
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
RGD1306041
similar to FLJ20699 protein
RGD1306041_predicted
similar to FLJ20699 protein (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-20
RGD1306041_predicted
similar to FLJ20699 protein (predicted)
LOC300125_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC300125_predicted
similar to FLJ20699 protein (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
