Advanced Search (OLGA)

Gene: Cpsf7 (cleavage and polyadenylation specific factor 7) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Cpsf7

Name:

cleavage and polyadenylation specific factor 7

RGD ID:

1305441

Description:

Predicted to enable mRNA binding activity. Predicted to be involved in co-transcriptional mRNA 3'-end processing, cleavage and polyadenylation pathway; mRNA alternative polyadenylation; and protein heterotetramerization. Predicted to be located in cytoplasm and nucleus. Predicted to be part of mRNA cleavage and polyadenylation specificity factor complex. Orthologous to human CPSF7 (cleavage and polyadenylation specific factor 7); PARTICIPATES IN 3'-end pre-mRNA processing pathway; RNA polymerase II transcription termination pathway; mRNA decay pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

cleavage and polyadenylation specific factor 7, 59kDa; cleavage and polyadenylation specificity factor subunit 7; LOC365407; RGD1305441; similar to RIKEN cDNA 5730453I16

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	216,592,745 - 216,616,860 (+)	NCBI		GRCr8
mRatBN7.2	1	207,167,690 - 207,191,938 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	207,167,859 - 207,191,905 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	215,546,294 - 215,570,323 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	222,601,738 - 222,625,783 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	215,296,741 - 215,320,782 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	226,572,399 - 226,596,185 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	226,573,105 - 226,596,131 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	233,518,603 - 233,542,664 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	213,009,572 - 213,032,612 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	213,168,001 - 213,191,028 (+)	NCBI
Celera	1	204,662,017 - 204,685,057 (+)	NCBI		Celera
Cytogenetic Map	1	q43	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cpsf7	Rat	intellectual disability		ISO	CPSF7 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Intellectual disability	ClinVar
Cpsf7	Rat	Joubert syndrome 1		ISO	CPSF7 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Familial aplasia of the vermis	ClinVar	PMID:28492532
Cpsf7	Rat	leukocyte adhesion deficiency 3		ISO	CPSF7 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Leukocyte adhesion deficiency 3	ClinVar	PMID:28492532
Cpsf7	Rat	prostate cancer		ISO	CPSF7 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Malignant tumor of prostate	ClinVar	PMID:23265383

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cpsf7	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	Cpsf7 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of CPSF7 mRNA	CTD	PMID:36331819
Cpsf7	Rat	1,2-dimethylhydrazine	decreases expression	ISO	Cpsf7 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of CPSF7 mRNA	CTD	PMID:22206623
Cpsf7	Rat	17beta-estradiol	decreases expression	EXP		6480464	Estradiol results in decreased expression of CPSF7 mRNA	CTD	PMID:35192832
Cpsf7	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of CPSF7 mRNA	CTD	PMID:33387578
Cpsf7	Rat	aflatoxin B1	increases expression	ISO	Cpsf7 (Mus musculus)	6480464	Aflatoxin B1 results in increased expression of CPSF7 mRNA	CTD	PMID:19770486
Cpsf7	Rat	aflatoxin B1	increases methylation	ISO	CPSF7 (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of CPSF7 gene	CTD	PMID:27153756
Cpsf7	Rat	all-trans-retinoic acid	decreases expression	ISO	CPSF7 (Homo sapiens)	6480464	Tretinoin results in decreased expression of CPSF7 mRNA	CTD	PMID:33167477
Cpsf7	Rat	atrazine	decreases expression	ISO	Cpsf7 (Mus musculus)	6480464	Atrazine results in decreased expression of CPSF7 mRNA	CTD	PMID:26518232
Cpsf7	Rat	atrazine	increases expression	ISO	CPSF7 (Homo sapiens)	6480464	Atrazine results in increased expression of CPSF7 mRNA	CTD	PMID:22378314
Cpsf7	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of CPSF7 mRNA	CTD	PMID:25181051
Cpsf7	Rat	bisphenol A	decreases expression	ISO	CPSF7 (Homo sapiens)	6480464	bisphenol A results in decreased expression of CPSF7 protein	CTD	PMID:34186270
Cpsf7	Rat	bisphenol A	increases expression	ISO	Cpsf7 (Mus musculus)	6480464	bisphenol A results in increased expression of CPSF7 mRNA	CTD	PMID:33221593
Cpsf7	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of CPSF7 mRNA	CTD	PMID:31129395 and PMID:35192832
Cpsf7	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of CPSF7 gene	CTD	PMID:28505145
Cpsf7	Rat	bisphenol F	decreases expression	ISO	Cpsf7 (Mus musculus)	6480464	bisphenol F results in decreased expression of CPSF7 mRNA	CTD	PMID:38685157
Cpsf7	Rat	Brodifacoum	decreases expression	EXP		6480464	bromfenacoum results in decreased expression of CPSF7 protein	CTD	PMID:28903499
Cpsf7	Rat	cadmium atom	multiple interactions	ISO	CPSF7 (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of CPSF7 mRNA	CTD	PMID:35301059
Cpsf7	Rat	cadmium dichloride	decreases expression	ISO	CPSF7 (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of CPSF7 mRNA	CTD	PMID:38568856
Cpsf7	Rat	cadmium dichloride	multiple interactions	ISO	CPSF7 (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of CPSF7 mRNA	CTD	PMID:35301059
Cpsf7	Rat	caffeine	decreases phosphorylation	ISO	CPSF7 (Homo sapiens)	6480464	Caffeine results in decreased phosphorylation of CPSF7 protein	CTD	PMID:35688186
Cpsf7	Rat	carbamazepine	affects expression	ISO	CPSF7 (Homo sapiens)	6480464	Carbamazepine affects the expression of CPSF7 mRNA	CTD	PMID:25979313
Cpsf7	Rat	carnosic acid	decreases expression	ISO	Cpsf7 (Mus musculus)	6480464	salvin results in decreased expression of CPSF7 protein	CTD	PMID:35926579
Cpsf7	Rat	copper atom	increases expression	EXP		6480464	Copper results in increased expression of CPSF7 mRNA	CTD	PMID:30556269
Cpsf7	Rat	copper(0)	increases expression	EXP		6480464	Copper results in increased expression of CPSF7 mRNA	CTD	PMID:30556269
Cpsf7	Rat	coumarin	increases phosphorylation	ISO	CPSF7 (Homo sapiens)	6480464	coumarin results in increased phosphorylation of CPSF7 protein	CTD	PMID:35688186
Cpsf7	Rat	dicrotophos	increases expression	ISO	CPSF7 (Homo sapiens)	6480464	dicrotophos results in increased expression of CPSF7 mRNA	CTD	PMID:28302478
Cpsf7	Rat	diquat	decreases expression	ISO	Cpsf7 (Mus musculus)	6480464	Diquat results in decreased expression of CPSF7 protein	CTD	PMID:36851058
Cpsf7	Rat	epoxiconazole	increases expression	ISO	Cpsf7 (Mus musculus)	6480464	epoxiconazole results in increased expression of CPSF7 mRNA	CTD	PMID:35436446
Cpsf7	Rat	ethanol	affects splicing	ISO	Cpsf7 (Mus musculus)	6480464	Ethanol affects the splicing of CPSF7 mRNA	CTD	PMID:30319688
Cpsf7	Rat	flusilazole	decreases expression	EXP		6480464	flusilazole results in decreased expression of CPSF7 mRNA	CTD	PMID:28263823
Cpsf7	Rat	FR900359	affects phosphorylation	ISO	CPSF7 (Homo sapiens)	6480464	FR900359 affects the phosphorylation of CPSF7 protein	CTD	PMID:37730182
Cpsf7	Rat	gallic acid	increases expression	ISO	CPSF7 (Homo sapiens)	6480464	Gallic Acid results in increased expression of CPSF7 mRNA	CTD	PMID:34408198
Cpsf7	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of CPSF7 mRNA	CTD	PMID:33387578
Cpsf7	Rat	glyphosate	increases expression	EXP		6480464	Glyphosate results in increased expression of CPSF7 mRNA	CTD	PMID:26302742
Cpsf7	Rat	hydrogen peroxide	multiple interactions	ISO	Cpsf7 (Mus musculus)	6480464	[Hydrogen Peroxide co-treated with N-(oxo-5 more ...	CTD	PMID:31494107
Cpsf7	Rat	inulin	multiple interactions	ISO	Cpsf7 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of CPSF7 mRNA	CTD	PMID:36331819
Cpsf7	Rat	ivermectin	decreases expression	ISO	CPSF7 (Homo sapiens)	6480464	Ivermectin results in decreased expression of CPSF7 protein	CTD	PMID:32959892
Cpsf7	Rat	nitrates	multiple interactions	ISO	Cpsf7 (Mus musculus)	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of CPSF7 mRNA	CTD	PMID:35964746
Cpsf7	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Cpsf7 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of CPSF7 mRNA more ...	CTD	PMID:36331819
Cpsf7	Rat	resveratrol	multiple interactions	ISO	CPSF7 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of CPSF7 mRNA	CTD	PMID:23557933
Cpsf7	Rat	SB 431542	multiple interactions	ISO	CPSF7 (Homo sapiens)	6480464	[LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of CPSF7 protein	CTD	PMID:37664457
Cpsf7	Rat	sodium arsenite	increases activity	ISO	CPSF7 (Homo sapiens)	6480464	sodium arsenite results in increased activity of CPSF7 protein	CTD	PMID:30528433
Cpsf7	Rat	sodium dichromate	affects expression	EXP		6480464	sodium bichromate affects the expression of CPSF7 mRNA	CTD	PMID:22110744
Cpsf7	Rat	thapsigargin	decreases expression	EXP		6480464	Thapsigargin results in decreased expression of CPSF7 protein	CTD	PMID:35544339
Cpsf7	Rat	titanium dioxide	increases methylation	ISO	Cpsf7 (Mus musculus)	6480464	titanium dioxide results in increased methylation of CPSF7 gene	CTD	PMID:35295148
Cpsf7	Rat	titanium dioxide	decreases methylation	ISO	Cpsf7 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of CPSF7 gene	CTD	PMID:35295148
Cpsf7	Rat	triphenyl phosphate	affects expression	ISO	CPSF7 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of CPSF7 mRNA	CTD	PMID:37042841
Cpsf7	Rat	triticonazole	decreases expression	EXP		6480464	triticonazole results in decreased expression of CPSF7 mRNA	CTD	PMID:36084822
Cpsf7	Rat	valproic acid	decreases expression	ISO	Cpsf7 (Mus musculus)	6480464	Valproic Acid results in decreased expression of CPSF7 mRNA	CTD	PMID:21427059
Cpsf7	Rat	valproic acid	decreases expression	ISO	CPSF7 (Homo sapiens)	6480464	Valproic Acid results in decreased expression of CPSF7 mRNA	CTD	PMID:28001369 and PMID:29154799
Cpsf7	Rat	valproic acid	affects expression	ISO	CPSF7 (Homo sapiens)	6480464	Valproic Acid affects the expression of CPSF7 mRNA	CTD	PMID:25979313
Cpsf7	Rat	vinclozolin	increases expression	EXP		6480464	vinclozolin results in increased expression of CPSF7 mRNA	CTD	PMID:23034163

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cpsf7	Rat	biological_process		ND		1598407	01/2015: no relevant rat data	RGD
Cpsf7	Rat	co-transcriptional mRNA 3'-end processing, cleavage and polyadenylation pathway	involved_in	ISO	CPSF7 (Homo sapiens)	1624291	PMID:29276085	RGD	PMID:29276085
Cpsf7	Rat	co-transcriptional mRNA 3'-end processing, cleavage and polyadenylation pathway	involved_in	IEA	UniProtKB:Q8N684 and ensembl:ENSP00000397203	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cpsf7	Rat	co-transcriptional mRNA 3'-end processing, cleavage and polyadenylation pathway	involved_in	ISS	UniProtKB:Q8N684	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Cpsf7	Rat	mRNA 3'-end processing	involved_in	ISO	CPSF7 (Homo sapiens)	1624291	PMID:20695905	RGD	PMID:20695905
Cpsf7	Rat	mRNA 3'-end processing	involved_in	IEA	UniProtKB:Q8N684 and ensembl:ENSP00000397203	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cpsf7	Rat	mRNA alternative polyadenylation	involved_in	ISS	UniProtKB:Q8N684	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Cpsf7	Rat	mRNA alternative polyadenylation	involved_in	IBA	PANTHER:PTN002755060 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Cpsf7	Rat	mRNA alternative polyadenylation	involved_in	ISO	CPSF7 (Homo sapiens)	1624291	PMID:20695905 and PMID:29276085	RGD	PMID:20695905 and PMID:29276085
Cpsf7	Rat	mRNA alternative polyadenylation	involved_in	IEA	UniProtKB:Q8N684 and ensembl:ENSP00000397203	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cpsf7	Rat	mRNA processing	involved_in	IEA	UniProtKB-KW:KW-0507	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Cpsf7	Rat	protein heterotetramerization	involved_in	ISO	CPSF7 (Homo sapiens)	1624291	PMID:23187700	RGD	PMID:23187700
Cpsf7	Rat	protein heterotetramerization	involved_in	IEA	UniProtKB:Q8N684 and ensembl:ENSP00000397203	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cpsf7	Rat	protein heterotetramerization	involved_in	ISS	UniProtKB:Q8N684	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Cpsf7	Rat	protein tetramerization	involved_in	ISO	CPSF7 (Homo sapiens)	1624291	PMID:20695905	RGD	PMID:20695905
Cpsf7	Rat	protein tetramerization	involved_in	IEA	UniProtKB:Q8N684 and ensembl:ENSP00000397203	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cpsf7	Rat	cytoplasm	located_in	IEA	UniProtKB:Q8N684 and ensembl:ENSP00000397203	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cpsf7	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Cpsf7	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Cpsf7	Rat	cytoplasm	located_in	ISS	UniProtKB:Q8N684	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Cpsf7	Rat	cytoplasm	located_in	ISO	CPSF7 (Homo sapiens)	1624291	PMID:19864460	RGD	PMID:19864460
Cpsf7	Rat	mRNA cleavage and polyadenylation specificity factor complex	part_of	ISO	CPSF7 (Homo sapiens)	1624291	PMID:23187700	RGD	PMID:23187700
Cpsf7	Rat	mRNA cleavage and polyadenylation specificity factor complex	part_of	IBA	PANTHER:PTN002755060 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Cpsf7	Rat	mRNA cleavage and polyadenylation specificity factor complex	part_of	IEA	UniProtKB:Q8N684 and ensembl:ENSP00000397203	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cpsf7	Rat	mRNA cleavage factor complex	part_of	ISO	CPSF7 (Homo sapiens)	1624291	PMID:20695905 and PMID:29276085	RGD	PMID:20695905 and PMID:29276085
Cpsf7	Rat	mRNA cleavage factor complex	part_of	IEA	UniProtKB:Q8N684 and ensembl:ENSP00000397203	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cpsf7	Rat	mRNA cleavage factor complex	part_of	ISS	UniProtKB:Q8N684	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Cpsf7	Rat	nucleus	located_in	ISO	CPSF7 (Homo sapiens)	1624291	PMID:19864460 and PMID:20695905	RGD	PMID:19864460 and PMID:20695905
Cpsf7	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Cpsf7	Rat	nucleus	located_in	IEA	ARBA:ARBA00026330	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Cpsf7	Rat	nucleus	located_in	IEA	UniProtKB:Q8N684 and ensembl:ENSP00000397203	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cpsf7	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Cpsf7	Rat	nucleus	located_in	ISS	UniProtKB:Q8N684	1600115	GO_REF:0000024	UniProt	GO_REF:0000024

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cpsf7	Rat	mRNA binding	enables	IBA	FB:FBgn0035872 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Cpsf7	Rat	nucleic acid binding	enables	IEA	InterPro:IPR035979	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Cpsf7	Rat	protein binding	enables	ISO	CPSF7 (Homo sapiens) and UniProtKB:Q8N684-3	1624291	UniProtKB:O43639 more ...	RGD	PMID:25910212 more ...
Cpsf7	Rat	protein binding	enables	ISO	CPSF7 (Homo sapiens)	1624291	UniProtKB:O43639 more ...	RGD	PMID:16189514 more ...
Cpsf7	Rat	RNA binding	enables	IEA	UniRule:UR000414619	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Cpsf7	Rat	RNA binding	enables	IEA	UniProtKB-KW:KW-0694	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Cpsf7	Rat	RNA binding	enables	IEA	InterPro:IPR000504	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cpsf7	Rat	3'-end pre-mRNA processing pathway		ISO	CPSF7 (Homo sapiens)	9681741		RGD
Cpsf7	Rat	3'-end pre-mRNA processing pathway		ISO	CPSF7 (Homo sapiens)	9681742		RGD
Cpsf7	Rat	RNA polymerase II transcription termination pathway		ISO	CPSF7 (Homo sapiens)	9681741		RGD
Cpsf7	Rat	RNA polymerase II transcription termination pathway		ISO	CPSF7 (Homo sapiens)	9681742		RGD

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cpsf7	Rat	mRNA decay pathway		IEA		6907045		KEGG	rno:03015

#	Reference Title	Reference Citation
1.	Pre-mRNA 3'-end processing complex assembly and function.	Chan S, etal., Wiley Interdiscip Rev RNA. 2011 May-Jun;2(3):321-35. doi: 10.1002/wrna.54. Epub 2010 Oct 18.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Means to an end: mechanisms of alternative polyadenylation of messenger RNA precursors.	Gruber AR, etal., Wiley Interdiscip Rev RNA. 2014 Mar-Apr;5(2):183-96. doi: 10.1002/wrna.1206. Epub 2013 Nov 14.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Comprehensive gene review and curation	RGD comprehensive gene curation
10.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

PMID:15489334	PMID:19864460	PMID:19946888	PMID:20695905	PMID:22658674	PMID:22681889	PMID:23187700	PMID:29276085	PMID:31505169

Cpsf7
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	216,592,745 - 216,616,860 (+)	NCBI		GRCr8
mRatBN7.2	1	207,167,690 - 207,191,938 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	207,167,859 - 207,191,905 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	215,546,294 - 215,570,323 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	222,601,738 - 222,625,783 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	215,296,741 - 215,320,782 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	226,572,399 - 226,596,185 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	226,573,105 - 226,596,131 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	233,518,603 - 233,542,664 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	213,009,572 - 213,032,612 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	213,168,001 - 213,191,028 (+)	NCBI
Celera	1	204,662,017 - 204,685,057 (+)	NCBI		Celera
Cytogenetic Map	1	q43	NCBI

CPSF7
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	61,402,729 - 61,429,975 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	61,402,641 - 61,430,031 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	61,170,201 - 61,197,447 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	60,926,777 - 60,953,849 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	11	58,505,642 - 58,532,986 (-)	NCBI		Celera
Cytogenetic Map	11	q12.2	NCBI
HuRef	11	57,498,010 - 57,525,354 (-)	NCBI		HuRef
CHM1_1	11	61,053,123 - 61,080,467 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	11	61,391,627 - 61,418,874 (-)	NCBI		T2T-CHM13v2.0

Cpsf7
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	10,502,594 - 10,525,099 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	10,502,630 - 10,525,017 (+)	Ensembl		GRCm39 Ensembl
GRCm38	19	10,525,223 - 10,547,735 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	10,525,266 - 10,547,653 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	19	10,599,734 - 10,622,225 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	19	10,592,311 - 10,614,698 (+)	NCBI		MGSCv36	mm8
Celera	19	11,221,128 - 11,243,624 (+)	NCBI		Celera
Cytogenetic Map	19	A	NCBI
cM Map	19	6.6	NCBI

Cpsf7
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955511	6,139,118 - 6,161,130 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955511	6,139,118 - 6,161,130 (+)	NCBI	ChiLan1.0	ChiLan1.0

CPSF7
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	62,570,633 - 62,597,988 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	63,614,202 - 63,641,631 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	56,702,510 - 56,729,316 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	60,065,832 - 60,092,720 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	60,065,832 - 60,092,720 (-)	Ensembl	panpan1.1		panPan2

CPSF7
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	54,986,709 - 55,012,499 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	18	54,986,810 - 55,009,382 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	53,559,662 - 53,585,514 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	56,034,104 - 56,060,195 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	18	56,034,171 - 56,058,185 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	18	55,092,629 - 55,118,450 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	54,714,618 - 54,740,435 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	55,594,658 - 55,620,764 (+)	NCBI		UU_Cfam_GSD_1.0

Cpsf7
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	11,515,249 - 11,537,317 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936581	1,629,041 - 1,651,328 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936581	1,629,078 - 1,651,147 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CPSF7
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	10,087,632 - 10,115,076 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	10,087,581 - 10,112,929 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	9,635,042 - 9,659,648 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CPSF7
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	12,417,452 - 12,445,984 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	12,417,490 - 12,446,527 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	109,794,801 - 109,823,341 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cpsf7
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624926	802,033 - 822,372 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Cpsf7
85 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	905
Count of miRNA genes:	331
Interacting mature miRNAs:	426
Transcripts:	ENSRNOT00000028074
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	150700247	252085048	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
1357335	Bw39	Body weight QTL 39	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	1	197814409	242814409	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
2302375	Bw83	Body weight QTL 83	4.87	0.0002	body mass (VT:0001259)	body weight (CMO:0000012)	1	197697768	242697768	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	177227632	256448636	Rat
2293674	Bss39	Bone structure and strength QTL 39	7.1	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	1	201554356	246554356	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
1354653	Despr9	Despair related QTL 9		0.00019	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	167909849	212909849	Rat
2293673	Bss27	Bone structure and strength QTL 27	18.63	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	1	171629477	216629477	Rat
2293677	Bss41	Bone structure and strength QTL 41	9.38	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	1	171629477	216629477	Rat
1302787	Stl25	Serum triglyceride level QTL 25	2.7	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	1	180359209	210702199	Rat
1549830	Bss1	Bone structure and strength QTL 1	4.8		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	172609619	217609619	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
70163	Bw20	Body weight QTL 20	5.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	174133260	219133260	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	179567751	260522016	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	195804352	257091168	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	177227632	256448636	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
1558658	Bw59	Body weight QTL 59	3.5	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	1	178784622	223784622	Rat
1600397	Edcs4	Endometrial carcinoma susceptibility QTL 4	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	1	206081677	251081677	Rat
631838	Niddm36	Non-insulin dependent diabetes mellitus QTL 36		0.01	insulin secretion trait (VT:0003564)	calculated pancreatic islet insulin release measurement (CMO:0001217)	1	184550676	229550676	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
2293689	Bss47	Bone structure and strength QTL 47	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	1	171629477	216629477	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	123556856	242907031	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
2293694	Bss38	Bone structure and strength QTL 38	7.05	0.0001	femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	1	201554356	246554356	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	143506580	212458660	Rat
61341	Bp26	Blood pressure QTL 26			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	169537671	214537671	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	150700247	252085048	Rat
2293693	Bss22	Bone structure and strength QTL 22	33.52	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	1	171629477	216629477	Rat
2300161	Bmd43	Bone mineral density QTL 43	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
1300145	Rf7	Renal function QTL 7	2.96		urine creatinine amount (VT:0010540)	urine creatinine level (CMO:0000125)	1	185145134	221264292	Rat
8655655	Arrd2	Age-related retinal degeneration QTL 2	7.79		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	183970203	243914901	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	191019702	246062233	Rat
631214	Bw61	Body weight QTL61	3.4	0.0001	intramuscular adipose amount (VT:0010044)	intramuscular fat area (CMO:0001162)	1	173108781	218108781	Rat
7771612	Cm80	Cardiac mass QTL 80	8.4		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	1	149448574	221264292	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642644	214537671	Rat
2300175	Bmd40	Bone mineral density QTL 40	15.4	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	1	201554356	246554356	Rat
2300174	Bmd42	Bone mineral density QTL 42	8.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	1	171629477	216629477	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	144267353	222987745	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	151162766	225824951	Rat
737977	Bp160	Blood pressure QTL 160		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	181133855	226133855	Rat
2293654	Bss30	Bone structure and strength QTL 30	32.65	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	1	171629477	216629477	Rat
2293655	Bss36	Bone structure and strength QTL 36	10.66	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	201554356	246554356	Rat
1298084	Thym4	Thymus enlargement QTL 4	10.68		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	197814409	242814409	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	150700142	252085212	Rat
2300187	Bmd41	Bone mineral density QTL 41	8.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
8552891	Epfw5	Epididymal fat weight QTL 5	4.4		epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	1	193113876	238113876	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	156677124	256448636	Rat
1358292	Cm37	Cardiac mass QTL 37	6.2	8e-07	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	1	196248093	241248093	Rat
61376	Bp42	Blood pressure QTL 42	23.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	197814409	242814409	Rat
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	199050459	259647894	Rat
634312	Bp143	Blood pressure QTL 143	3	0.0002	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	182623426	219932796	Rat
1358294	Bw37	Body weight QTL 37	5	0.000011	body mass (VT:0001259)	body weight (CMO:0000012)	1	171310381	216310381	Rat
1357399	Bw45	Body weight QTL 45	3.05		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	1	206329708	251329708	Rat
724559	Pancm1	Pancreatic morphology QTL 1	7.1		islet of Langerhans morphology trait (VT:0005215)	pancreatic islet damage composite score (CMO:0001156)	1	181759564	214537555	Rat
2312420	Pur17	Proteinuria QTL 17	7.1	0.0001	urine protein amount (VT:0005160)	urine total protein excretion rate (CMO:0000756)	1	156677124	218753816	Rat
1357404	Bw42	Body weight QTL 42	4.49	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	1	206329708	251329708	Rat
10059600	Bp378	Blood pressure QTL 378	3.08	0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	176869060	221869060	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
619613	Bp77	Blood pressure QTL 77		0.01	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	164747424	209747424	Rat
2312564	Glom18	Glomerulus QTL 18	2.4	0.003	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	185356336	231689108	Rat
634321	Hc1	Hypercalciuria QTL 1	2.91		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	178810256	240830002	Rat
2292218	Kidm35	Kidney mass QTL 35			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	199368955	224569684	Rat
724562	Rends1	Renal damage susceptibility QTL 1		0.05	kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	1	169537671	214537671	Rat
1331790	Bp201	Blood pressure QTL 201	3.127		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	198211513	225126682	Rat
10059587	Bw173	Body weight QTL 173	3.23	0.025	body mass (VT:0001259)	body weight (CMO:0000012)	1	202069611	247069611	Rat
61403	Niddm4	Non-insulin dependent diabetes mellitus QTL 4			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	206329708	222745518	Rat
2292222	Bp307	Blood pressure QTL 307	3.06	0.0014	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	213533942	Rat
2292220	Bp306	Blood pressure QTL 306	3.47	0.00087	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	243914901	Rat
10059590	Kidm44	Kidney mass QTL 44	3.42	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	191033875	236033875	Rat
1641926	Teswt2	Testicular weight QTL 2	2.82		testis mass (VT:1000644)	both testes wet weight (CMO:0000175)	1	197697768	238755659	Rat
631658	Cm7	Cardiac mass QTL 7	5.32	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	1	196248093	241248093	Rat
1600380	Niddm70	Non-insulin dependent diabetes mellitus QTL 70	3.1	0.0008	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	176550523	221550523	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1582206	Kidm33	Kidney mass QTL 33	6.9		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	188377360	224054420	Rat
8655855	Arrd3	Age-related retinal degeneration QTL 3	3.07		lens clarity trait (VT:0001304)	cataract incidence/prevalence measurement (CMO:0001585)	1	183970203	243914901	Rat
634338	Hcar4	Hepatocarcinoma resistance QTL 4	4.6		liver integrity trait (VT:0010547)	liver tumorous lesion number to liver area ratio (CMO:0001210)	1	193422268	214537671	Rat
6903303	Scl34	Serum cholesterol QTL 34	2.5	0.0033	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	180359209	218108781	Rat
1600374	Mcs17	Mammary carcinoma susceptibility QTL 17	3		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	197670404	242670404	Rat
1600363	Hc6	Hypercalciuria QTL 6	2.7		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	203995416	244113296	Rat
2293083	Iddm25	Insulin dependent diabetes mellitus QTL 25	4.18		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	181829673	224569684	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	102813953	218753816	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	176426412	257976495	Rat
1358191	Ept10	Estrogen-induced pituitary tumorigenesis QTL 10	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	192825253	243914732	Rat
7394701	Uae46	Urinary albumin excretion QTL 46	3.6	0.0056	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	201554356	246554356	Rat

RH142902

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	207,183,794 - 207,183,909 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	226,588,339 - 226,588,453	NCBI	Rnor6.0
Rnor_5.0	1	233,534,594 - 233,534,708	UniSTS	Rnor5.0
RGSC_v3.4	7	139,916,134 - 139,916,248	UniSTS	RGSC3.4
RGSC_v3.4	1	213,024,806 - 213,024,920	UniSTS	RGSC3.4
Celera	1	204,677,251 - 204,677,365	UniSTS
RH 3.4 Map	1	1510.2	UniSTS
Cytogenetic Map	1	q43	UniSTS
Cytogenetic Map	7	q35	UniSTS

RH139325

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	207,183,793 - 207,183,924 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	226,588,338 - 226,588,468	NCBI	Rnor6.0
Rnor_5.0	1	233,534,593 - 233,534,723	UniSTS	Rnor5.0
RGSC_v3.4	7	139,916,133 - 139,916,263	UniSTS	RGSC3.4
RGSC_v3.4	1	213,024,805 - 213,024,935	UniSTS	RGSC3.4
Celera	1	204,677,250 - 204,677,380	UniSTS
Cytogenetic Map	1	q43	UniSTS
Cytogenetic Map	7	q35	UniSTS

RH140202

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	207,191,213 - 207,191,395 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	226,595,758 - 226,595,939	NCBI	Rnor6.0
Rnor_5.0	1	233,542,013 - 233,542,194	UniSTS	Rnor5.0
RGSC_v3.4	1	213,032,225 - 213,032,406	UniSTS	RGSC3.4
Celera	1	204,684,670 - 204,684,851	UniSTS
RH 3.4 Map	1	1510.5	UniSTS
Cytogenetic Map	1	q43	UniSTS

AW521848

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	207,167,685 - 207,167,836 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	226,572,291 - 226,572,441	NCBI	Rnor6.0
Rnor_5.0	1	233,518,487 - 233,518,637	UniSTS	Rnor5.0
RGSC_v3.4	1	213,008,699 - 213,008,849	UniSTS	RGSC3.4
Celera	1	204,661,144 - 204,661,294	UniSTS
RH 3.4 Map	1	1510.3	UniSTS
Cytogenetic Map	1	q43	UniSTS

UniSTS:478984

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	207,189,926 - 207,190,468 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	226,594,471 - 226,595,012	NCBI	Rnor6.0
Rnor_5.0	1	233,540,726 - 233,541,267	UniSTS	Rnor5.0
RGSC_v3.4	1	213,030,938 - 213,031,479	UniSTS	RGSC3.4
Celera	1	204,683,383 - 204,683,924	UniSTS
Cytogenetic Map	1	q43	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001014245	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001399757	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008760238	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008760239	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008760240	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085585	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085601	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085607	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269902	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269906	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269909	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010055261	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010055262	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010055263	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010055264	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010055265	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010055266	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010055267	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC095662	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC083864	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232033	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000028074 ⟹ ENSRNOP00000028074

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	207,167,859 - 207,191,905 (+)	Ensembl
Rnor_6.0 Ensembl	1	226,573,105 - 226,596,131 (+)	Ensembl

RefSeq Acc Id:

NM_001014245 ⟹ NP_001014267

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	216,592,790 - 216,616,860 (+)	NCBI
mRatBN7.2	1	207,167,866 - 207,191,938 (+)	NCBI
Rnor_6.0	1	226,573,105 - 226,596,145 (+)	NCBI
Rnor_5.0	1	233,518,603 - 233,542,664 (+)	NCBI
RGSC_v3.4	1	213,009,572 - 213,032,612 (+)	RGD
Celera	1	204,662,017 - 204,685,057 (+)	RGD

Sequence:

show sequence

GTGGCATCTTTCTTACTTTGTCCGTTCTCCGGGCTCGAGAGCGTGTTTCCGGAGCCATGTCAGAAGGAGTGGATTTGATTGATATATACGCTGATGAAGAGTTCAATCAGGACTCGGAGTTCAACAAC
ACAGATCAGATTGACCTATATGATGATGTGCTGACGGCGGCCTCACAGCCCTCGGATGACAGAAGCAGTAGCACAGAACCACCCCCTCCTGTCCGCCAGGAGCCAGCTCCCAAACCAAACAACAAGAC
CCCTGCAATTCTGTACACATACAGTGGCCTGCGGAGTCGGCGAGCAGCTGTCTATGTAGGCAGTTTCTCCTGGTGGACCACAGACCAGCAGCTGATCCAGGTTATTCGCTCTATAGGAGTCTATGATG
TGGTGGAGTTGAAATTTGCAGAGAACCGTGCAAATGGCCAGTCTAAAGGGTATGCTGAGGTGGTGGTAGCCTCTGAAAATTCTGTCCACAAATTGCTGGAACTCTTACCAGGAAAAGTTCTTAATGGA
GAAAAAGTAGATGTGAGGCCAGCCACTCGGCAGAACTTATCACAATTTGAGGCTCAGGCTCGGAAACGAATACCTCCACGGGCCCACTCCCGAGATTCTAGTGATTCTGCTGATGGACGGGCAACCCC
CTCTGAGAATCTTGTACCCTCATCTGCTCGTGTGGATAAGCCCCCCAGCGTGTTGCCCTACTTTAACCGTCCTCCTTCAGCCCTTCCCCTAATGGGTCTGCCCCCACCCCCAATTCCACCCCCACCAC
CTCTCTCCTCAAGCTTTGGTGTCCCTCCTCCTCCTCCTGGTATCCACTACCAGCATCTCATGCCCCCCCCTCCTCGATTACCTCCTCATCTGGCTGTACCTCCCCCTGGGGCCATCCCACCAGCCCTT
CACCTCAATCCAGCCTTCTTCCCCCCACCAAATGCTACAGTGGGGCCTCCACCAGATACTTACATGAAGGCCTCTACACCCTATAACCACCATGGCAGCCGAGATTCAGGCCCTCTACCGTCTACAGT
GAGTGAAGCTGAATTTGAAGAGATAATGAAGCGAAACAGAGCAATTTCCAGCAGTGCCATTTCCAAAGCAGTGTCTGGAGCTAGTGCAGGGGATTACAGTGACGCCATTGAGACACTACTCACAGCCA
TTGCAGTTATCAAACAGTCCCGAGTCGCCAATGATGAGCGTTGTCGGGTCCTCATCTCTTCACTTAAGGACTGTCTTCATGGCATAGAGGCCAAGTCTTACAGTGTGGGTGCCAGTGGAAGCTCTTCT
AGGAAAAGACATCGGTCAAGGGAGAGGTCACCCAGCCGGTCCCGAGAGAGTAGCAGAAGGCACCGAGACTTGCTTCATAATGAAGACCGACATGATGATTATTTCCAAGAAAGGAACCGGGAGCATGA
GAGACACCGGGATAGAGAACGGGACCGGCACCACTGAGAAAGGAGTCTGGGTGGAAGCAAATTGTTTTTAATGGACTTGCATCTCCTCACCTTGATCAGGACTAAAGGACGGAGGCCGCTCCACCCCT
TCCCCTTCTTCCAAACCCCTAACTTCCTCCAGGCAAAACCCTCTGCCCTGCAGGATTGAAGATGGCTTGGCAGCCCTCCCAATCCCACACCTTCTGTTTGCCATGGGGGAAGAACCTAAAGACTTGCT
GGGGTAGTGAACGAGGGCATACAGGAAGACAGCAACATGTCCAGCCCATAGTCTCCATAGAGAATGGTGCTTTGTCCAAGGAAACCTGAGTTTCTGATTGCCCAGAAGCAGTCAGTGGTGAGGTTACT
ATGAGAAAATTTCCTTCCCAGAGAAAATGGATCCTCTATGTGGGGTCTTAGGAAAGTGACTGGGTGTGCCAAAAATGCCCAGGGTTCTGCCCTCAGTACTAGATTTGATGGGGCCAAAAGGGTCCAAA
CCCTGCTAACATACCACTTTGTTCAACTCCTGTACTTTCCTAGCCAGTTGAGGAGGGACCATGAGAACAGAAACTACCTTGTGACAAGAAACGTGTTCTCAGTTTTCTCCTCACGTGTTGATGGTTTA
TTTCCATGGCCTCCTAGAGGGCTGAATCCTTTTGACTCCTTACTATCTGACTCCTCAGTGGACTTGCCCCTCTGAAACAGAACCCAGGAAGCTTCGGCTATCTGCCGGAAGCCTAGGCCAGCCAGATA
CCACCATTTGCTGCTTTAGGCTTGTCTGTTTGTTGCAATAACCAGCTCTTAGGTATTTCCTTTCCCCAAGGCTTTCCATTTAACATGGAATCCTTCCCCAAGAAGGCTTCTTCCTTGTTTTAGAGGAA
GGTACTGCCTTTGGGACTTAGGGATGTCATGGGACCTCAGTAACTAGGACCCCTAGTTAATAAAGTACCAGAAGTGTGGAGAAGAGAGCAATTTGAGCAGTATGTAGCCTACTCACATGGGCTCTTTT
GCAGGTTAATGTGAGCATAGGCTTGCATTTCCAAGGTACATACTTTGACTTAACTGTGGAATAACTCAGCACTAATAGGCAGGTAAAGTCAAGACTGGTTTTTGGGGGTTTCTTTTTTGGTGTTTTTG
TTTTTGTTTTTATTCCTTTGCTCTGATACTTCCCCCGTCACTTTGCCTGGAGGTGCTTCCAGCCTTTAAGAAGGAGCAGAGAATTGGAGCTCAGAGTTGTAAGGACCAGCACACTAGTGGCCATTTTC
TGCACAAGCAAATGGAATTGCTTTTTTCAGCATCCAGACTGTGATAGGTTGCTCTTGATGGAGGTAGCCACAGTCCTGGAGTACCATAGGGTAATGTTCCTTCAGCAGGGCCTGTGAGATCTAATGTG
AAGAGAGACACAACATGTGAGATGGGACTTGGTGTGTGAGGCATGGAGTCATTGGAGACTCTTCAGATTCAGAGGGGAGACTGAATTGGATGCTTTCTCTCTTCTCGGCACACTTCTGACAGACCCCT
TCAGTCACTGAGGGAGTGCCCCCAAGGTTGGAGAGGCACATTCCCTTTGGACAGAGGCTACAAGTTGTAGCTTATTTTCCTGTCCCCTAAACCAATCCCTATTCCATCAACATGGCATCCTGCCTAAT
TTTCTAAGGGTTAAGTGATATGCTTATTCTTGAAAGCAACTCGGGTGTCTTTTTAAAAAAGAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

NM_001399757 ⟹ NP_001386686

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	216,592,790 - 216,616,860 (+)	NCBI
mRatBN7.2	1	207,167,866 - 207,191,938 (+)	NCBI

RefSeq Acc Id:

XM_039085585 ⟹ XP_038941513

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	216,592,988 - 216,616,856 (+)	NCBI
mRatBN7.2	1	207,167,979 - 207,191,865 (+)	NCBI

RefSeq Acc Id:

XM_039085601 ⟹ XP_038941529

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	216,593,459 - 216,608,543 (+)	NCBI
mRatBN7.2	1	207,167,975 - 207,183,620 (+)	NCBI

RefSeq Acc Id:

XM_039085607 ⟹ XP_038941535

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	216,599,449 - 216,616,856 (+)	NCBI
mRatBN7.2	1	207,174,523 - 207,191,865 (+)	NCBI

RefSeq Acc Id:

XM_063269902 ⟹ XP_063125972

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	216,599,450 - 216,616,856 (+)	NCBI

RefSeq Acc Id:

XM_063269906 ⟹ XP_063125976

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	216,599,451 - 216,616,856 (+)	NCBI

RefSeq Acc Id:

XM_063269909 ⟹ XP_063125979

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	216,599,451 - 216,616,856 (+)	NCBI

RefSeq Acc Id:

XR_010055261

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	216,592,760 - 216,616,856 (+)	NCBI

RefSeq Acc Id:

XR_010055262

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	216,592,988 - 216,616,856 (+)	NCBI

RefSeq Acc Id:

XR_010055263

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	216,593,459 - 216,616,856 (+)	NCBI

RefSeq Acc Id:

XR_010055264

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	216,592,745 - 216,616,856 (+)	NCBI

RefSeq Acc Id:

XR_010055265

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	216,592,760 - 216,616,856 (+)	NCBI

RefSeq Acc Id:

XR_010055266

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	216,592,760 - 216,616,856 (+)	NCBI

RefSeq Acc Id:

XR_010055267

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	216,592,760 - 216,616,856 (+)	NCBI


Protein RefSeqs	NP_001014267	(Get FASTA)	NCBI Sequence Viewer
	NP_001386686	(Get FASTA)	NCBI Sequence Viewer
	XP_038941513	(Get FASTA)	NCBI Sequence Viewer
	XP_038941529	(Get FASTA)	NCBI Sequence Viewer
	XP_038941535	(Get FASTA)	NCBI Sequence Viewer
	XP_063125972	(Get FASTA)	NCBI Sequence Viewer
	XP_063125976	(Get FASTA)	NCBI Sequence Viewer
	XP_063125979	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH83864	(Get FASTA)	NCBI Sequence Viewer
	EDM12817	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000028074
	ENSRNOP00000108140
GenBank Protein	Q5XI29	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001014267 ⟸ NM_001014245
- Peptide Label:	isoform 2
- UniProtKB:	Q5XI29 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MSEGVDLIDIYADEEFNQDSEFNNTDQIDLYDDVLTAASQPSDDRSSSTEPPPPVRQEPAPKPNNKTPAILYTYSGLRSRRAAVYVGSFSWWTTDQQLIQVIRSIGVYDVVELKFAENRANGQSKGYA EVVVASENSVHKLLELLPGKVLNGEKVDVRPATRQNLSQFEAQARKRIPPRAHSRDSSDSADGRATPSENLVPSSARVDKPPSVLPYFNRPPSALPLMGLPPPPIPPPPPLSSSFGVPPPPPGIHYQH LMPPPPRLPPHLAVPPPGAIPPALHLNPAFFPPPNATVGPPPDTYMKASTPYNHHGSRDSGPLPSTVSEAEFEEIMKRNRAISSSAISKAVSGASAGDYSDAIETLLTAIAVIKQSRVANDERCRVLI SSLKDCLHGIEAKSYSVGASGSSSRKRHRSRERSPSRSRESSRRHRDLLHNEDRHDDYFQERNREHERHRDRERDRHH hide sequence

Ensembl Acc Id:

ENSRNOP00000028074 ⟸ ENSRNOT00000028074

RefSeq Acc Id:	XP_038941529 ⟸ XM_039085601
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038941513 ⟸ XM_039085585
- Peptide Label:	isoform X1
- UniProtKB:	A0A8L2QG69 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038941535 ⟸ XM_039085607
- Peptide Label:	isoform X3

Protein Domains

RRM

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5XI29-F1-model_v2	AlphaFold	Q5XI29	1-462	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-56427	BioCyc
Ensembl Genes	ENSRNOG00000020668	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000028074	ENTREZGENE
	ENSRNOT00000166988	ENTREZGENE
Gene3D-CATH	3.30.70.330	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7127736	IMAGE-MGC_LOAD
InterPro	CPSF6/7	UniProtKB/Swiss-Prot
	CPSF7_RRM	UniProtKB/Swiss-Prot
	Nucleotide-bd_a/b_plait_sf	UniProtKB/Swiss-Prot
	RBD_domain_sf	UniProtKB/Swiss-Prot
	RRM_dom	UniProtKB/Swiss-Prot
KEGG Report	rno:365407	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:95116	IMAGE-MGC_LOAD
NCBI Gene	365407	ENTREZGENE
PANTHER	PTHR23204	UniProtKB/Swiss-Prot
Pfam	RRM_1	UniProtKB/Swiss-Prot
PhenoGen	Cpsf7	PhenoGen
PROSITE	RRM	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000020668	RatGTEx
SMART	RRM	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF54928	UniProtKB/Swiss-Prot
UniProt	A0A8L2QG69	ENTREZGENE, UniProtKB/TrEMBL
	CPSF7_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-04-27	Cpsf7	cleavage and polyadenylation specific factor 7	Cpsf7	cleavage and polyadenylation specific factor 7, 59kDa	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2009-06-12	Cpsf7	cleavage and polyadenylation specific factor 7, 59kDa	RGD1305441	similar to RIKEN cDNA 5730453I16	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1305441	similar to RIKEN cDNA 5730453I16	RGD1305441_predicted	similar to RIKEN cDNA 5730453I16 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1305441_predicted	similar to RIKEN cDNA 5730453I16 (predicted)	LOC365407_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC365407_predicted	similar to RIKEN cDNA 5730453I16 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)